Dehydrogenase/reductase SDR family member 7B

Overview
NameDehydrogenase/reductase SDR family member 7B
Smed IDSMED30002394
Length (bp)1059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dehydrogenase/reductase SDR family member 7B (SMED30002394) t-SNE clustered cells

Violin plots show distribution of expression levels for Dehydrogenase/reductase SDR family member 7B (SMED30002394) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dehydrogenase/reductase SDR family member 7B (SMED30002394) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dehydrogenase/reductase SDR family member 7B (SMED30002394) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002394

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002394SMESG000047014.1 dd_Smed_v4_3512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002394SMESG000047014.1 dd_Smed_v4_3512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002394SMESG000047014.1 dd_Smed_v4_3512_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Human
Match: DHRS7B (dehydrogenase/reductase 7B [Source:HGNC Symbol;Acc:HGNC:24547])

HSP 1 Score: 177.563 bits (449), Expect = 1.709e-52
Identity = 111/311 (35.69%), Postives = 179/311 (57.56%), Query Frame = 1
Query:  100 EMISSAIVTTITMGVF-VYLAFRK-KW---KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            + I+S  +  +  G   V+  FR  +W   K ++++ VV++TGA +  GLG   A +     AK +++  R      E +  L          H    VT DL      + +  E +    G +D+++ +AG+SYRG ++ T+++V K +M++NYFG V+L  ++  L    K + G+ IV I+SIQG++SIP+RSAY+ASKHA  AF DCL++E+ +  I V  + P YI TNLS NA+   G+++  +D TTA+G +  EVA  V +A+ +   ++ L DL   +A+Y+RTLAP L+F +M  RA   +
Sbjct:    2 DFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATS--GLGKECAKVFYAAGAK-LVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAE-ILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKAL--LPSMIKRRQGH-IVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKER 305          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Human
Match: DHRS7B (dehydrogenase/reductase 7B [Source:HGNC Symbol;Acc:HGNC:24547])

HSP 1 Score: 177.563 bits (449), Expect = 1.994e-52
Identity = 111/311 (35.69%), Postives = 179/311 (57.56%), Query Frame = 1
Query:  100 EMISSAIVTTITMGVF-VYLAFRK-KW---KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            + I+S  +  +  G   V+  FR  +W   K ++++ VV++TGA +  GLG   A +     AK +++  R      E +  L          H    VT DL      + +  E +    G +D+++ +AG+SYRG ++ T+++V K +M++NYFG V+L  ++  L    K + G+ IV I+SIQG++SIP+RSAY+ASKHA  AF DCL++E+ +  I V  + P YI TNLS NA+   G+++  +D TTA+G +  EVA  V +A+ +   ++ L DL   +A+Y+RTLAP L+F +M  RA   +
Sbjct:   17 DFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATS--GLGKECAKVFYAAGAK-LVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAE-ILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKAL--LPSMIKRRQGH-IVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKER 320          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Human
Match: DHRS7C (dehydrogenase/reductase 7C [Source:HGNC Symbol;Acc:HGNC:32423])

HSP 1 Score: 114.005 bits (284), Expect = 1.595e-28
Identity = 83/288 (28.82%), Postives = 148/288 (51.39%), Query Frame = 1
Query:  145 FVYLAFRKKW-KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIIT---SRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAK----GMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            F+Y    + W K  +++KVV++T A +  GLG   A +  T  A+ ++      R EN     ++  D  P K       + L+  D   +  V + V D  G +D++I +A V  +G   K S+E+ K IM +NYFG ++L  ++   M   +T     IV + +IQG+  IP+R+ Y+ASKHA   F DCL++EV + ++ + +V P++I+   S +   + G   + + +   +    G++  EVA  V   ++R   E+ + +     A+Y+RT  P  +F ++
Sbjct:   21 FIYQEVSRLWSKSAVQNKVVVITDAIS--GLGKECARVFHTGGARLVLCGKNWERLENLYDALISVAD--PSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQ---IVLVNNIQGKFGIPFRTTYAASKHAALGFFDCLRAEVEEYDVVISTVSPTFIR---SYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVV 298          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Human
Match: DHRS7C (dehydrogenase/reductase 7C [Source:HGNC Symbol;Acc:HGNC:32423])

HSP 1 Score: 112.464 bits (280), Expect = 6.940e-28
Identity = 84/288 (29.17%), Postives = 149/288 (51.74%), Query Frame = 1
Query:  145 FVYLAFRKKW-KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIIT---SRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAK----GMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            F+Y    + W K  +++KVV++T A +  GLG   A +  T  A+ ++      R EN     ++  D  P K     + L L+  D   +  V + V D  G +D++I +A V  +G   K S+E+ K IM +NYFG ++L  ++   M   +T     IV + +IQG+  IP+R+ Y+ASKHA   F DCL++EV + ++ + +V P++I+   S +   + G   + + +   +    G++  EVA  V   ++R   E+ + +     A+Y+RT  P  +F ++
Sbjct:   21 FIYQEVSRLWSKSAVQNKVVVITDAIS--GLGKECARVFHTGGARLVLCGKNWERLENLYDALISVAD--PSKTFTPKLVL-LDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQ---IVLVNNIQGKFGIPFRTTYAASKHAALGFFDCLRAEVEEYDVVISTVSPTFIR---SYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVV 297          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Human
Match: DHRS7B (dehydrogenase/reductase 7B [Source:HGNC Symbol;Acc:HGNC:24547])

HSP 1 Score: 83.1889 bits (204), Expect = 3.725e-19
Identity = 39/75 (52.00%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 KTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKH 813
            K + G+ IV I+SIQG++SIP+RSAY+ASKHA  AF DCL++E+ +  I V  + P YI TNLS NA+   G+++
Sbjct:    3 KRRQGH-IVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRY 76          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Celegans
Match: dhs-30 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q65ZI3])

HSP 1 Score: 127.102 bits (318), Expect = 1.073e-33
Identity = 81/262 (30.92%), Postives = 133/262 (50.76%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVP-GKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFL 966
            +K+KVV++TGA +  GLG SLA       A+ I++    E          +  P  +   I+   D       I    ++ W ++  +D++I +AG+S RG    T+ME+H+  M++NYFG+V +  ++ + +    + DG  +V  +SIQG+++IPYR +Y ASKHA   + DCL++E    N+ +L V   YI T     AL  SG      DE   KG   E  A  +  AI+    +  +    + +A+++R   P L
Sbjct:   45 VKNKVVVITGASS--GLGKSLAFELYKRGAQVILLARSTEKLKEICEELKETFPLNQNEPIYYYFD-------ITDSEQAPWAEIPRVDILINNAGMSNRGSCQDTTMEIHRQAMETNYFGHVHVTQALLSKL----SPDGCIVV-TSSIQGKVAIPYRGSYGASKHALQGYFDCLRAE--HKNLHILVVSAGYINTGFGSRALDPSGKVVGVEDENQKKGYTPEHCARMISDAIRDRKTDFDMAPFDARIAVFLRYFWPTL 290          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Celegans
Match: T25G12.13 (pep chromosome:WBcel235:X:17243357:17244762:1 gene:WBGene00219274.1 transcript:T25G12.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T25G12.13)

HSP 1 Score: 122.479 bits (306), Expect = 4.477e-32
Identity = 81/262 (30.92%), Postives = 131/262 (50.00%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVP-GKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFL 966
            +K+K+V++TGA +  GLG SLA       A+ I++    E             P  K    +   D+  PD+       + W ++  +DV+I +AG+S RG    T+M +H+  M++N FG+V +  S+ + +    + DG  +V  +SIQG+++IPYR +YSASKHA   + DCL++E    N+ +L V   YI T     AL   G      DE   KG + E  A  +  AI+    +  +    +  A+++R   P L
Sbjct:   44 VKNKIVVITGASS--GLGKSLAFELYKRGAQVILLARSTEKLKEICAELTKTFPLNKNKPTYYFFDITNPDK-------APWAQIPKVDVLINNAGMSNRGSCQDTTMAIHRKAMETNLFGHVQVTQSLLSKL----SPDGCIVV-TSSIQGKVAIPYRGSYSASKHALQGYFDCLRAE--HKNLHILVVSAGYINTGFGSRALDTDGKVVGVEDENQKKGYSPEHSARMISDAIRDRVSDFDMAPFGARFAIFLRYFWPTL 289          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Celegans
Match: Y47G6A.22 (pep chromosome:WBcel235:I:3559923:3562851:-1 gene:WBGene00021647.1 transcript:Y47G6A.22.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.22)

HSP 1 Score: 69.707 bits (169), Expect = 1.743e-13
Identity = 49/167 (29.34%), Postives = 80/167 (47.90%), Query Frame = 1
Query:  391 DEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAVF 876
            +E  ++++++   K G ID +I SAG+   G +L + +EV+  +M  N     SLI      +    T  G  +V ++SI G    P  + Y  SK A   F  CL  E+A + +RV +V P    TNL + + +D        + SK      +  +A EVA A++
Sbjct:   65 EEAPKTIVDATVQKFGRIDTLINSAGILRAGPVLDSGIEVYDELMNVNVR---SLIRLTRAALPHIITTKGT-VVNVSSINGPCPFPNVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVTVTNLHRTSGQDETTYSAFLERSKTTHALGRPGDANEVAEAIY 227          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Celegans
Match: Y47G6A.21 (pep chromosome:WBcel235:I:3551949:3559807:-1 gene:WBGene00021646.1 transcript:Y47G6A.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.21)

HSP 1 Score: 69.3218 bits (168), Expect = 2.610e-13
Identity = 64/234 (27.35%), Postives = 108/234 (46.15%), Query Frame = 1
Query:  196 VVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKEND--GIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAVF 876
            V ++TGA +  G G +L    K Y+   + +T R  +    + AL   +G     +I+   ++L+  DE  ++++++   K G ID +I SAG+   G +L + +EV+  +M  N     SLI      +    T  G  +V ++SI G       + Y  SK A   F  CL  E+A + +RV +V P  I TN+ + + +D        + SK      +     EVA A+ 
Sbjct:    3 VAIITGASSGIGKGTALLFAKKKYQ---LSLTGRNTDSLKEVAALCISEGAISADDILITAVELSS-DEAPKAIVDATVQKFGRIDSLINSAGILRAGPVLDSGIEVYDELMNVNVR---SLIRLTRAALPHIITTKGT-VVNVSSINGPCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVTNIHRASGQDEATYAAFLEKSKTTHALGRPGTTSEVAEAIL 228          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Celegans
Match: drd-5 (Dietary restriction down regulated [Source:UniProtKB/TrEMBL;Acc:Q20840])

HSP 1 Score: 69.3218 bits (168), Expect = 4.784e-13
Identity = 57/192 (29.69%), Postives = 93/192 (48.44%), Query Frame = 1
Query:  391 DEKIQSVIESVWDKVG--GIDVVIASAGV---SYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAE---EVASAVFSAIKRGDDEL-ALLDLKSHVAL 939
            DE ++  ++ V   V   G+  V+A+AG+   S   D L  S + + N MQ N FG +  I  +   +KK + +    +V I+SI GR   P    Y  SKHA  A+ D ++ E+   N+ V  + P +  TN+++ A  D  A   +LD+ T K    E   +  ++ FS +    D+L  ++D   H  L
Sbjct:   96 DESVKEFVKLVEKTVENRGLWGVVANAGILGNSGPDDWL--SAQDYINTMQVNTFGVMRFIQGLKKFVKKQEGR----VVIISSISGRTPRPTVGPYCVSKHAVEAYADVIRHELIDFNVSVHLLEPGFFTTNITQTATNDLDAVWERLDDETKKEYGKEFYDDYKNSRFSRLSHCADDLNPVIDAYDHALL 281          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Fly
Match: CG7601 (gene:FBgn0027583 transcript:FBtr0085544)

HSP 1 Score: 174.481 bits (441), Expect = 1.953e-51
Identity = 116/306 (37.91%), Postives = 178/306 (58.17%), Query Frame = 1
Query:  118 IVTTITMGVFVYLAFRKKWKYF--------IKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEA----LNFLDGVPG-KGNIIHVTL-DLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRA 993
            ++ T+ M V + LA    W+ F        +  KVVL+TGA +  GLG SLA +   Y A   +I + +    +E     L  LD  P     ++ + L +LN   E +  V+ +V+++V   D++I + G+S R D+  T+++V   +M  NYFG+V+L  ++   M K  +    FI   +S+QG+ +IP R+AYSASKHA  AF D L++EVA  NI V  V P YI+T LS NAL  SG+ + K+DETTAKGM+ +++A  +   I R + ++ + D+++ +A Y+R L P LYF IM KRA
Sbjct:   21 VLGTVLMPVALPLAIINIWQRFQAQKFRNQLPGKVVLITGASS--GLGESLAHV--FYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLDLAELNSIPEFVTRVL-AVYNQV---DILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFI---SSVQGKFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMSPDKLAERILQCILRKEPDIIVSDVQAKIAYYLRHLCPSLYFWIMAKRA 315          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Fly
Match: CG12171 (gene:FBgn0037354 transcript:FBtr0078708)

HSP 1 Score: 80.1073 bits (196), Expect = 6.800e-17
Identity = 72/235 (30.64%), Postives = 113/235 (48.09%), Query Frame = 1
Query:  187 KDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITS-RKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAV 873
            KDKV++VTGA +  G G S+  +AK     TI+  +  K N+  E +    G P     + V  D+N  +  +Q ++ +   K G IDV++ +AG+   G +  TS+E    +M +N      L + V   + K K      IV ++S+ G  S P   AY+ SK A   F  C+  E+A   +RV SV P  I T L +    D  A     +H+K+     +    +EVA+A+
Sbjct:    5 KDKVIIVTGASSGIGAGTSVL-LAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPA----LQVAADINS-ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKGN----IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAI 229          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Fly
Match: CG31549 (gene:FBgn0051549 transcript:FBtr0078707)

HSP 1 Score: 70.8626 bits (172), Expect = 1.144e-13
Identity = 65/235 (27.66%), Postives = 108/235 (45.96%), Query Frame = 1
Query:  187 KDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDE-KIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAV 873
            KDKV++VTGA +  G+G S A +        ++I  R E    E     D +   G    + L  +   E ++Q ++ +   K G IDV++ +AG+   G +  TS+E    +M +N    V  +  +  L      K    IV ++S+ G  + P   AY+ SK A   F  C+  E+A   +RV +V P  I T++ K    D        +H K+     +  + +EVA+A+
Sbjct:    5 KDKVIIVTGASS--GIGAS-AAVHLAKLGGLLVIVGRNEEKLKETA---DNIVAAGGATPLELQADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTN----VRSLYQLTMLATPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAI 229          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Fly
Match: CG31549 (gene:FBgn0051549 transcript:FBtr0335215)

HSP 1 Score: 70.8626 bits (172), Expect = 1.144e-13
Identity = 65/235 (27.66%), Postives = 108/235 (45.96%), Query Frame = 1
Query:  187 KDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDE-KIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAV 873
            KDKV++VTGA +  G+G S A +        ++I  R E    E     D +   G    + L  +   E ++Q ++ +   K G IDV++ +AG+   G +  TS+E    +M +N    V  +  +  L      K    IV ++S+ G  + P   AY+ SK A   F  C+  E+A   +RV +V P  I T++ K    D        +H K+     +  + +EVA+A+
Sbjct:    5 KDKVIIVTGASS--GIGAS-AAVHLAKLGGLLVIVGRNEEKLKETA---DNIVAAGGATPLELQADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTN----VRSLYQLTMLATPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAI 229          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Fly
Match: CG31937 (gene:FBgn0031360 transcript:FBtr0077884)

HSP 1 Score: 65.4698 bits (158), Expect = 1.373e-11
Identity = 56/230 (24.35%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRK----ENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEV 861
            ++ +VV +TGA +  G+G +LA ++       +++++R+    E    E L    G+    +++ + +D+   DE  ++ + +V +    +DV++ +AG S R    +  +EV + + + + F  V L   V     +     G+ I   +SI G   +P+   Y A+KHA +A+L  LK E+ K ++ + +  P  I T+  + A   S      L     K M A+  
Sbjct:   44 MRGQVVWITGASS--GIGRALA-LSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEH-KTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGH-IAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSLFA--PGPIATDFLQEAFTGSQGGKVGLSTANQKRMTAQRC 266          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Zebrafish
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:550454])

HSP 1 Score: 175.252 bits (443), Expect = 7.901e-52
Identity = 109/293 (37.20%), Postives = 169/293 (57.68%), Query Frame = 1
Query:  133 TMGVFVYLAF--RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIII--TSRKENDGIEAL-NFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAE 996
            T+G+ + L    R + +  I+DKVV++TGA +  GLG   A +     A+ I+     R+  + +E L N   G         VT DL+     + S    +    G IDV+I +AGVSYRG++L T + V + +M++NYFG V+L  ++   M    +  G+ +V I+S+QG+ISIPYRSAY+ASKHA  A+ DCL++EV    + V  + P Y++TN+S NA+   G+K+  +D TTA G +  +VA  +  A+ +   ++ +  L    A+Y+RTL P LYFR+M  RA 
Sbjct:   23 TVGLLILLKVIQRLRRRPNIQDKVVVITGASS--GLGKECARVFHAAGARLILCGRDQRRLQEVVEELRNKTYGKTQTYTPCTVTFDLSN-TSVVCSAAAEILKCHGHIDVLINNAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPSMVDRGS--GHIVV-ISSVQGKISIPYRSAYAASKHAMQAYYDCLRAEVDSLGLHVSVLSPGYVRTNMSINAVTGDGSKYGVMDRTTATGADPVDVAKDILKAVCQKKKDVVMAGLGPTTAIYLRTLWPALYFRVMASRAR 309          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Zebrafish
Match: dhrs7cb (dehydrogenase/reductase (SDR family) member 7Cb [Source:NCBI gene;Acc:553684])

HSP 1 Score: 108.612 bits (270), Expect = 1.583e-26
Identity = 84/325 (25.85%), Postives = 157/325 (48.31%), Query Frame = 1
Query:  106 ISSAIVTTITMGVF--VYLAFRKKWKYF----IKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL--NFLDGVPGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTA------------------------KGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            + S +V  + + VF  VY  + +  ++     +++KVV++T A +  G+G   A +     A+ ++       D +E+L  +   G           + L++ D E I  V+  + +  G +DV+I ++ +  +  +   S+E+ K IM  NYFG ++L   V  LM   +T  G F++ + SIQG++++P+R+ Y+ASKHA  AF DCL++EV +  I V ++  ++I          ++GA+++   E T                          G++ + +A  +  ++ R   E+ L      VALYIR L P  +F ++
Sbjct:    3 VPSVMVLPLLIVVFAGVYYVYNEVMRFMSKSVVRNKVVVITDAVS--GMGSECARLFHAGGARLVLCG--PSWDKLESLYDSLCSGSDPSQTFTPKLVLLDFSDMENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMITRRT--GQFVL-VNSIQGKLALPFRTCYAASKHAVQAFFDCLRAEVEEFGISVSTISHTFI----------NAGAENATPTEATPITATPTKATPTNPIWAYVCSKLNTHGVSPQILAQEIVRSVNRQSREVFLAHPVPTVALYIRALMPGCFFSVV 310          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Zebrafish
Match: dhrs7ca (dehydrogenase/reductase (SDR family) member 7Ca [Source:NCBI gene;Acc:558764])

HSP 1 Score: 102.449 bits (254), Expect = 1.883e-24
Identity = 60/208 (28.85%), Postives = 117/208 (56.25%), Query Frame = 1
Query:  394 EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKT--NLSKNALRDSGAKHSKLDE-TTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSKA 1008
            E +  VI  + +    +DV++ ++ +  +  +   S+++ + +M  NYFG ++L+   G L      + G+ ++ + SIQG++++P+R+ Y+ASKHA  AF +CL++EV +  I V ++  ++IKT  ++SK+ +    A+  K D   T  G++ ++VA+ +   +     E  +       ALY+R+L P L+F IM  R  ++ A
Sbjct:  112 ESVPEVISEILECFCCLDVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVK--GFLPSLISRRSGHILL-VNSIQGKLAMPFRTTYAASKHAVQAFFECLRAEVQEYGITVSTINHTFIKTSSSISKDEI---TARSMKTDHRQTPPGVSPKDVATELLRTLSSKKKESLMARWVPKAALYVRSLFPNLFFAIMAARVSNTVA 313          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Zebrafish
Match: dhrs7ca (dehydrogenase/reductase (SDR family) member 7Ca [Source:NCBI gene;Acc:558764])

HSP 1 Score: 82.4185 bits (202), Expect = 3.651e-18
Identity = 44/154 (28.57%), Postives = 87/154 (56.49%), Query Frame = 1
Query:  394 EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAE 855
            E +  VI  + +    +DV++ ++ +  +  +   S+++ + +M  NYFG ++L+   G L      + G+ ++ + SIQG++++P+R+ Y+ASKHA  AF +CL++EV +  I V ++  ++IKT+ S +            DE TA+ M  +
Sbjct:   45 ESVPEVISEILECFCCLDVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVK--GFLPSLISRRSGHILL-VNSIQGKLAMPFRTTYAASKHAVQAFFECLRAEVQEYGITVSTINHTFIKTSSSISK-----------DEITARSMKTD 184          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Zebrafish
Match: dhrs7 (dehydrogenase/reductase (SDR family) member 7 [Source:ZFIN;Acc:ZDB-GENE-060825-21])

HSP 1 Score: 78.9518 bits (193), Expect = 4.548e-16
Identity = 77/296 (26.01%), Postives = 138/296 (46.62%), Query Frame = 1
Query:  160 FRKKWKYFIKDKVVLVTGACTPGG--LGISLAGIAKTYEAKTIIITSRKEND--GIEALNFLDGVPGKGNIIHVTLDL----NWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAK-DNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLD----LKSHVALYIRTLAPFLYFRIMKKRAEHSKA 1008
            F K  +   + KVV +TGA +  G  L + LA I        +++++R+EN+   ++ L          +I+ + LDL    + P EK  + +E      G IDV+I + G S R   +   ++V++ +M+ NY G VS+   V   M +  T     I  ++S+ G +  P  + Y+ASKHA   F + L++E++   NI + ++ P  + +++ +NA  +   K           M+ E         +     E+ + +    L  +V  Y  TLA +L   + KKR ++ KA
Sbjct:   39 FGKTPESTFRGKVVWITGASSGIGEELSLQLAAIGAR-----LVLSARRENELERVKRLCLERSSLKAEDILVLPLDLMDRASHP-EKTTAALE----HFGEIDVLINNGGRSQRALCVDADVDVYQALMELNYLGTVSITKQVLPHMIRRGTG---IIATVSSVAGFVGAPLATGYAASKHALQGFFNSLRTELSDCPNILISNICPGPVISSIVQNAFTEELGKPVATAGDQTHKMSTERCVHLTLVGLANRVKEMWIAEQPFLLFCYVWQYTPTLAWYLTNVLGKKRVQNFKA 321          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Xenopus
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:779695])

HSP 1 Score: 179.489 bits (454), Expect = 2.380e-53
Identity = 110/286 (38.46%), Postives = 167/286 (58.39%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL-NFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            R +   +++D VV++TGA +  GLG   A +   Y A T ++   +  +G++ L   L  +  K   +H    V  DL+   E + S    +    G +D++I +AG+SYRG +L T + V + +M +NYFG V+L  ++   M KN+   G+ +V I+S+QG+ISIP+RSAYSASKHA  AF DCL++E++   I V  V P YIKTNLS NA+   G+ +  +D  TA+G   EEVA  V  A+     EL +  L   +A+Y+RTLAP ++F  M  RA+  +
Sbjct:   27 RLRSGAYLQDAVVVITGATS--GLGRECAKV--FYAAGTRLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVIFDLS-DVEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRR--GHIVV-ISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTGDGSNYGVMDNNTAEGRTPEEVAQTVLRAVGERRKELLVAGLVPTLAVYLRTLAPTIFFSFMAARAKKER 304          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Xenopus
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:779695])

HSP 1 Score: 179.104 bits (453), Expect = 4.623e-53
Identity = 110/286 (38.46%), Postives = 167/286 (58.39%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL-NFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            R +   +++D VV++TGA +  GLG   A +   Y A T ++   +  +G++ L   L  +  K   +H    V  DL+   E + S    +    G +D++I +AG+SYRG +L T + V + +M +NYFG V+L  ++   M KN+   G+ +V I+S+QG+ISIP+RSAYSASKHA  AF DCL++E++   I V  V P YIKTNLS NA+   G+ +  +D  TA+G   EEVA  V  A+     EL +  L   +A+Y+RTLAP ++F  M  RA+  +
Sbjct:   41 RLRSGAYLQDAVVVITGATS--GLGRECAKV--FYAAGTRLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVIFDLS-DVEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRR--GHIVV-ISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTGDGSNYGVMDNNTAEGRTPEEVAQTVLRAVGERRKELLVAGLVPTLAVYLRTLAPTIFFSFMAARAKKER 318          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Xenopus
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:779695])

HSP 1 Score: 176.792 bits (447), Expect = 6.331e-52
Identity = 109/281 (38.79%), Postives = 164/281 (58.36%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL-NFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKR 990
            R +   +++D VV++TGA +  GLG   A +   Y A T ++   +  +G++ L   L  +  K   +H    V  DL+   E + S    +    G +D++I +AG+SYRG +L T + V + +M +NYFG V+L  ++   M KN+   G+ +V I+S+QG+ISIP+RSAYSASKHA  AF DCL++E++   I V  V P YIKTNLS NA+   G+ +  +D  TA+G   EEVA  V  A+     EL +  L   +A+Y+RTLAP ++F  M  R
Sbjct:   27 RLRSGAYLQDAVVVITGATS--GLGRECAKV--FYAAGTRLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVIFDLS-DVEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNR--RGHIVV-ISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTGDGSNYGVMDNNTAEGRTPEEVAQTVLRAVGERRKELLVAGLVPTLAVYLRTLAPTIFFSFMAAR 299          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Xenopus
Match: dhrs7c (dehydrogenase/reductase (SDR family) member 7C [Source:NCBI gene;Acc:100135266])

HSP 1 Score: 116.701 bits (291), Expect = 1.778e-29
Identity = 89/310 (28.71%), Postives = 163/310 (52.58%), Query Frame = 1
Query:   85 MWTLSEMISSAIVTTITMGVFVYL-AFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGV-----PGKGNIIHVTL----DLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSK-LDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            M  L+ +I   ++  I+  V++Y    R   +  +K+KVV++T A +  GLG   + +  +  A+ ++    K  + +EAL+  D +     P       + L    D+N     ++++ + + D  G +DV+I +A +  +G L   S+E+ K IM +NYFG ++L+ ++   M   +T     IV + +IQG+I +P+R+AY+ASKHA   F DCL++EV + ++ V +V P++I++   +    +  A   K      + G +  EVA  V S + R   E+ + +     A+YIRT  P L+F ++
Sbjct:    1 MGFLTFLIVPLLILGISGIVYIYREVVRLMSRSALKNKVVVITDAIS--GLGKECSRVFHSAGARLVLCG--KTWEKLEALH--DALISVADPSVTFTPKLVLLDISDIN----NMEAMGKEIQDCYGCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQ---IVLVNTIQGKIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSPTFIRSYHVQPQPGNWEASIWKFFFRKLSYGAHPVEVAEEVLSTVSRKKQEVFMANPIPRAAVYIRTFLPELFFAVV 297          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Xenopus
Match: gria4 (glutamate receptor, ionotropic, AMPA 4 [Source:Xenbase;Acc:XB-GENE-5838893])

HSP 1 Score: 74.3294 bits (181), Expect = 2.430e-14
Identity = 59/209 (28.23%), Postives = 109/209 (52.15%), Query Frame = 1
Query:  196 VVLVTGACTPGGLGISLA-GIAKTYEAKTIIITSRKENDGIEALNFLDGVPG--KGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEV-AKDNIRVLSVFPSYIKTNLSKNALRDSGAK 810
            VV VTGA +  G+G  L+  +AK      ++++SR+E + +        +      +I+ + LD+       ++  E      G ID+++ +AG S R   ++T+++V + +++ NY G +S+   V   M + K      IV I+S+ G I  P  S YSASKHA   F + L++E+ A  +I + ++ P  +++ + +NAL +   K
Sbjct:   52 VVWVTGASS--GIGEELSYQLAKI--GCPLVLSSRRETELLRVKQKCLEISSLEDQDILILPLDMTQTSMHKEAT-EKALQHFGRIDILVNNAGRSQRSLFVETNLDVFRALIELNYLGTISITKHVLQHMIERKQGK---IVNISSVVGLIGAPLSSGYSASKHALQGFFNSLRTELTAYPDIIISNICPGPVQSKIVENALTEECEK 252          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Mouse
Match: Dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:MGI Symbol;Acc:MGI:2384931])

HSP 1 Score: 189.889 bits (481), Expect = 1.650e-57
Identity = 117/296 (39.53%), Postives = 174/296 (58.78%), Query Frame = 1
Query:  133 TMGVF--VYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH---VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
             +G+F    L  R + K ++++ VV+VTGA +  GLG   A +     AK ++    +    +E L+       +G       VT DL  P   I +    +    G +DV+I +AG+SYRG +  T ++V + +M+ NYFG V+L  ++  L    + K G+ IV I+SIQG+ISIP+RSAYSASKHA  AF DCL++E+ + NI+V  + P YI TNLS NA+   G+++  LD+ TA+G +A EVA  VF A+ +   ++ L D    +A+YIRTLAP L+FRIM  RA   +
Sbjct:   16 CLGIFSLFRLLQRIRSKAYLRNAVVVVTGATS--GLGRECAKVFHAAGAKLVLCG--RNVKALEELSRELAGSSQGQTHQPFVVTFDLADPG-TIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKAL--LPSMVERKQGH-IVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGLFFRIMASRARKER 303          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Mouse
Match: Dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:MGI Symbol;Acc:MGI:2384931])

HSP 1 Score: 189.889 bits (481), Expect = 2.394e-57
Identity = 117/296 (39.53%), Postives = 174/296 (58.78%), Query Frame = 1
Query:  133 TMGVF--VYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH---VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
             +G+F    L  R + K ++++ VV+VTGA +  GLG   A +     AK ++    +    +E L+       +G       VT DL  P   I +    +    G +DV+I +AG+SYRG +  T ++V + +M+ NYFG V+L  ++  L    + K G+ IV I+SIQG+ISIP+RSAYSASKHA  AF DCL++E+ + NI+V  + P YI TNLS NA+   G+++  LD+ TA+G +A EVA  VF A+ +   ++ L D    +A+YIRTLAP L+FRIM  RA   +
Sbjct:   31 CLGIFSLFRLLQRIRSKAYLRNAVVVVTGATS--GLGRECAKVFHAAGAKLVLCG--RNVKALEELSRELAGSSQGQTHQPFVVTFDLADPGT-IAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKAL--LPSMVERKQGH-IVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGLFFRIMASRARKER 318          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Mouse
Match: Dhrs7c (dehydrogenase/reductase (SDR family) member 7C [Source:MGI Symbol;Acc:MGI:1915710])

HSP 1 Score: 119.013 bits (297), Expect = 1.749e-30
Identity = 88/285 (30.88%), Postives = 149/285 (52.28%), Query Frame = 1
Query:  145 FVYLAFRKKW-KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL-NFLDGV--PGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSK-LDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            F+Y    + W K  +++KVV++T A +  GLG   A +     A+ ++    K  +G+E+L   L  V  P K     + L L+  D   +Q V + V D  G +D++I +A V  +G   K S+E+ K IM +NYFG ++L   +   M   +T     IV + +IQ +  IP+R+AY+ASKHA   F DCL++EV + ++ V +V P++I++  +    R+      K      A G++  EVA  V   ++R   E+ + +     A++IRT  P  +F ++
Sbjct:   21 FIYQEASRLWSKSAVQNKVVVITDAIS--GLGKECARVFHAGGARLVLCG--KNWEGLESLYATLTSVADPSKTFTPKLVL-LDLSDISCVQDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLPNMISRRTGQ---IVLVNNIQAKFGIPFRTAYAASKHAVMGFFDCLRAEVEEYDVVVSTVSPTFIRSYRASPEQRNWETSICKFFCRKLAYGVHPVEVAEEVMRTVRRKKQEVFMANPVPKAAVFIRTFFPEFFFAVV 297          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Mouse
Match: Dhrs7 (dehydrogenase/reductase (SDR family) member 7 [Source:MGI Symbol;Acc:MGI:1913625])

HSP 1 Score: 85.1149 bits (209), Expect = 4.469e-18
Identity = 74/289 (25.61%), Postives = 148/289 (51.21%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRK--ENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSV-GNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAK-DNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLD----LKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            R +W+  + D VV VTGA +  G+G  LA    +    ++++++R+  E + ++     +G   + +I+ + LDL       ++  ++V  + G ID+++ + G S R  +L+T+++V K ++  NY G VSL   V  +++++ + K    IV + SI G  S+   S Y ASKHA   F + L SE+ +   I   +V+P  +++++ KNA  +   K  + +   +  M        +  ++     E+ + D    L +++  Y+ T A +L  ++ K+R ++ K
Sbjct:   43 RPEWE--LTDMVVWVTGASS--GIGEELA-FQLSKLGVSLVLSARRAQELERVKRRCLENGNLKEKDILVLPLDLT-DTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERKQGK----IVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSELGQYPGITFCNVYPGPVQSDIVKNAFTEEVTKSMRNNIDQSYKMPTSRCVRLMLISMANDLKEVWISDHPVLLGAYIWQYMPTWAAWLNCKLGKERIQNFK 321          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Mouse
Match: Dhrs7 (dehydrogenase/reductase (SDR family) member 7 [Source:MGI Symbol;Acc:MGI:1913625])

HSP 1 Score: 78.5666 bits (192), Expect = 1.053e-15
Identity = 81/312 (25.96%), Postives = 150/312 (48.08%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGG---------LGISLAGIAKTYE----------AKTIIITSR----KENDGIEALNFLD--GVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSV-GNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAK-DNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLD----LKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            R +W+  + D VV VTGA +  G         LG+SL   A+  +           ++I  TSR    +E+    AL   +  G   + +I+ + LDL       ++  ++V  + G ID+++ + G S R  +L+T+++V K ++  NY G VSL   V  +++++ + K    IV + SI G  S+   S Y ASKHA   F + L SE+ +   I   +V+P  +++++ KNA  +   K  + +   +  M        +  ++     E+ + D    L +++  Y+ T A +L  ++ K+R ++ K
Sbjct:   41 RPEWE--LTDMVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLGESIPNTSRASQQRESKLSAALEVREENGNLKEKDILVLPLDLT-DTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERKQGK----IVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSELGQYPGITFCNVYPGPVQSDIVKNAFTEEVTKSMRNNIDQSYKMPTSRCVRLMLISMANDLKEVWISDHPVLLGAYIWQYMPTWAAWLNCKLGKERIQNFK 345          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. UniProt/SwissProt
Match: sp|Q99J47|DRS7B_MOUSE (Dehydrogenase/reductase SDR family member 7B OS=Mus musculus OX=10090 GN=Dhrs7b PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.675e-56
Identity = 117/296 (39.53%), Postives = 174/296 (58.78%), Query Frame = 1
Query:  133 TMGVF--VYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH---VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
             +G+F    L  R + K ++++ VV+VTGA +  GLG   A +     AK ++    +    +E L+       +G       VT DL  P   I +    +    G +DV+I +AG+SYRG +  T ++V + +M+ NYFG V+L  ++  L    + K G+ IV I+SIQG+ISIP+RSAYSASKHA  AF DCL++E+ + NI+V  + P YI TNLS NA+   G+++  LD+ TA+G +A EVA  VF A+ +   ++ L D    +A+YIRTLAP L+FRIM  RA   +
Sbjct:   31 CLGIFSLFRLLQRIRSKAYLRNAVVVVTGATS--GLGRECAKVFHAAGAKLVLCG--RNVKALEELSRELAGSSQGQTHQPFVVTFDLADPGT-IAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKAL--LPSMVERKQGH-IVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGLFFRIMASRARKER 318          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. UniProt/SwissProt
Match: sp|Q3T0R4|DRS7B_BOVIN (Dehydrogenase/reductase SDR family member 7B OS=Bos taurus OX=9913 GN=DHRS7B PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 5.831e-55
Identity = 111/311 (35.69%), Postives = 178/311 (57.23%), Query Frame = 1
Query:  100 EMISSAIVTTITMGVFVYLAFRK--KW---KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            + I+S  +  + +G     +  K  +W   + ++++ VV++TGA +  GLG   A +     A+ +++  R      E    L      G   H    VT DL  P   I      +    G +DV+I +AG+SYRG ++ TS +V K +M++NYFG V+L  ++   M + +   G+ +V I+SIQG+IS+P+RSAY+ASKHA  AF DCL++EV + +I V  + P YI TNLS NA+   G+K+  +DETTA+G +  +VA  + +A+ +   ++ L D    +A+Y+RTLAP L+FR+M  RA   +
Sbjct:   17 DFITSTAILPLLLGCVGLFSLFKLLQWLRMRAYVRNAVVVITGATS--GLGRECARVFHAAGAR-LVLCGRNAEALEELSQELAASRAPGVQTHKPCTVTFDLADPGA-IAGAASEILQCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRR--QGH-VVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTADGSKYGVMDETTAQGRSPVQVAQDILAALGKKKKDVVLADPMPSLAVYLRTLAPGLFFRLMASRARKER 320          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. UniProt/SwissProt
Match: sp|Q7Q732|DHRS7_ANOGA (Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae OX=7165 GN=AGAP005532 PE=3 SV=3)

HSP 1 Score: 184.111 bits (466), Expect = 2.486e-54
Identity = 118/310 (38.06%), Postives = 180/310 (58.06%), Query Frame = 1
Query:   88 WTLSEMISSAIVTTITMGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRK---ENDGIEALNFLDGVPGKGNIIHVTLDL---NWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINS-VGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAE 996
            W L+ +     +  + + +   +  ++  ++ +  KVVL+TGA +  GLG +LA        K ++   RK   E    + L     VP    II + LDL   N    K+QSV+E      G ID+++ + G+S RGD L T+++V   IM  NYFG+V+L  + + ++M + + +    IV I+S+QG+ +IP+RSAYSASKHA  AF D L++EVAKDNI+V  + P YI T LS NAL  +GA + K+D  TA G + ++ AS++  AI R + ++ L  +    A ++R LAP +YF IMKKRAE
Sbjct:   15 WLLATLFLPIAIPGLVLKLLTMMKEQRNARH-LNGKVVLITGASS--GLGEALAHSFFLAGCKVVLAARRKDELERVRKDLLELHATVPTHPPII-LPLDLSDLNSIGGKVQSVLEIH----GAIDILVNNGGISVRGDALSTAIDVDIRIMLVNYFGSVALTKACLPSMMARKEGR----IVSISSVQGKFAIPHRSAYSASKHAMQAFCDSLRAEVAKDNIKVTLISPGYINTALSLNALTGTGASYGKMDAATAGGASPQDTASSILKAIARDEKDVMLAPIAPRAAYWLRHLAPSVYFWIMKKRAE 312          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. UniProt/SwissProt
Match: sp|Q5RJY4|DRS7B_RAT (Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus OX=10116 GN=Dhrs7b PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 5.610e-54
Identity = 114/301 (37.87%), Postives = 171/301 (56.81%), Query Frame = 1
Query:  133 TMGVF--VYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALN-----FLDGVPGKGNIIH---VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
             +G+F    L  R + K ++++ VV+VTGA +  GLG   A +     AK ++         ++AL        D    +G       VT DL  P   I      +    G +D++I +AG+SYRG +  T ++V + +M+ NYFG V+L  ++  L    + K G+ IV I+SIQG+ISIP+RSAY+ASKHA  AF DCL++E+   +I V  + P YI TNLS NA+   G+++  LD+ TA+G +A EVA  +F A+ +   ++ L D    +A+YIRTLAP L+FRIM  RA   +
Sbjct:   31 CLGIFSLFRLLQRTRSKAYLRNAVVVVTGATS--GLGKECARVFHAAGAKVVLC-----GRNVKALEEFTRELADSSSSQGQTHQPCVVTFDLADPGA-IAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKAL--LPSMVERKRGH-IVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAVEVAQDIFDAVGKKKKDVLLTDFLPTMAVYIRTLAPRLFFRIMASRARKER 320          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. UniProt/SwissProt
Match: sp|Q0VFE7|DRS7B_XENTR (Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis OX=8364 GN=dhrs7b PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.261e-52
Identity = 110/286 (38.46%), Postives = 167/286 (58.39%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL-NFLDGVPGKGNIIH----VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            R +   +++D VV++TGA +  GLG   A +   Y A T ++   +  +G++ L   L  +  K   +H    V  DL+   E + S    +    G +D++I +AG+SYRG +L T + V + +M +NYFG V+L  ++   M KN+   G+ +V I+S+QG+ISIP+RSAYSASKHA  AF DCL++E++   I V  V P YIKTNLS NA+   G+ +  +D  TA+G   EEVA  V  A+     EL +  L   +A+Y+RTLAP ++F  M  RA+  +
Sbjct:   27 RLRSGAYLQDAVVVITGATS--GLGRECAKV--FYAAGTRLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVIFDLS-DVEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRR--GHIVV-ISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTGDGSNYGVMDNNTAEGRTPEEVAQTVLRAVGERRKELLVAGLVPTLAVYLRTLAPTIFFSFMAARAKKER 304          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. TrEMBL
Match: A0A1B6CN93 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.36337 PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.320e-58
Identity = 127/317 (40.06%), Postives = 184/317 (58.04%), Query Frame = 1
Query:   88 WTLSEMISSAIVTTITMGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKT-IIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPD---------EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSKA 1008
            W L  M     +  +   +F Y    KK K  +K KVVL+TGA +  GLG +LA     Y+A   +I+ +R+E         L+ V      +H TL  + P          E+I S IE +    G +D++I +AG+S+RGD+L T ++V KN+M  NYFG ++L  ++ + M   ++     IV ++S+QGRISIP+RSAY+ASKHA  AF DCL++EVA+  I V  V P YI+TNLS NAL  SG ++   DE+TA G + ++VA  + SA+ R   EL L +    +A+Y+RT  P LYF IMK RA+  K+
Sbjct:   11 WLLGSMCIPITIPWLLFKIFQY----KKMKENLKGKVVLITGASS--GLGEALAH--AFYKAGCRLILAARREAQ-------LERVKKDLLSLHPTLLTHPPVIIPIDLSKIEEIPSHIEKIKAIFGHVDILINNAGISFRGDILSTKLDVDKNVMNVNYFGQIALTKALLSSMIDRRSGH---IVAVSSVQGRISIPHRSAYAASKHALQAFCDCLRAEVAQYKINVTVVSPGYIRTNLSLNALTSSGQQYGVTDESTASGYSPDKVADDILSAVIRKKPELILSETTPRLAIYLRTFFPSLYFYIMKNRAKRLKS 309          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. TrEMBL
Match: A0A1S3HIF6 (dehydrogenase/reductase SDR family protein 7-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154831 PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.640e-57
Identity = 122/307 (39.74%), Postives = 184/307 (59.93%), Query Frame = 1
Query:  103 MISSAIVTTIT-MGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKT-IIITSRKEND----GIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            M+SS+I   I  M V+V     +K    ++DKVVL+TGA +  GLG + A     Y+A + +I+ +R+E +      +  N    +  K   I +TLDL+  D  I    +      G ID+++ + G+SYRG+ ++T + +H ++M  NYFG ++L  +   L+    ++D   IV I+S+QG+I+IPYRSAY+ASKHA  A+ D L++EVA  NI+V  + P YIKTNLS NAL+  G ++  +D+TT  GM+ E VAS V  A++   +EL L      VA+++RT  P LYF +MKKRA H K
Sbjct:    9 MMSSSIYIPIALMAVWVSYRLFRKCHCDLRDKVVLITGASS--GLGEACAH--AFYKAGSRVILCARREAELKRVKQDLQNLKLAIETKEPSI-LTLDLSDLDS-IPQRADHALKIHGQIDILVNNGGISYRGEAMETELGIHMSVMTVNYFGQIALTQA---LLPSMVSRDCGHIVAISSVQGKIAIPYRSAYAASKHAAQAYFDSLRAEVADKNIKVSVISPGYIKTNLSLNALQGDGTRYGVMDKTTETGMSPEYVASKVLKAVQEQKNELILAPFTVTVAVFLRTFCPSLYFSLMKKRAAHQK 306          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. TrEMBL
Match: A0A2R2MQJ0 (dehydrogenase/reductase SDR family protein 7-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154831 PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.900e-57
Identity = 122/307 (39.74%), Postives = 184/307 (59.93%), Query Frame = 1
Query:  103 MISSAIVTTIT-MGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKT-IIITSRKEND----GIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            M+SS+I   I  M V+V     +K    ++DKVVL+TGA +  GLG + A     Y+A + +I+ +R+E +      +  N    +  K   I +TLDL+  D  I    +      G ID+++ + G+SYRG+ ++T + +H ++M  NYFG ++L  +   L+    ++D   IV I+S+QG+I+IPYRSAY+ASKHA  A+ D L++EVA  NI+V  + P YIKTNLS NAL+  G ++  +D+TT  GM+ E VAS V  A++   +EL L      VA+++RT  P LYF +MKKRA H K
Sbjct:    1 MMSSSIYIPIALMAVWVSYRLFRKCHCDLRDKVVLITGASS--GLGEACAH--AFYKAGSRVILCARREAELKRVKQDLQNLKLAIETKEPSI-LTLDLSDLDS-IPQRADHALKIHGQIDILVNNGGISYRGEAMETELGIHMSVMTVNYFGQIALTQA---LLPSMVSRDCGHIVAISSVQGKIAIPYRSAYAASKHAAQAYFDSLRAEVADKNIKVSVISPGYIKTNLSLNALQGDGTRYGVMDKTTETGMSPEYVASKVLKAVQEQKNELILAPFTVTVAVFLRTFCPSLYFSLMKKRAAHQK 298          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. TrEMBL
Match: A0A1S3HFH7 (dehydrogenase/reductase SDR family protein 7-like OS=Lingula unguis OX=7574 GN=LOC106154833 PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.232e-57
Identity = 123/308 (39.94%), Postives = 187/308 (60.71%), Query Frame = 1
Query:  103 MISSAIVTTIT-MGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKT-IIITSRKEND----GIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGG-IDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            M+S +I   I  M V+V     KK    ++DKVVL+TGA +  GLG + A     Y+A + +I+ +R+E +      +  N    +  K   I +TLDL+  D   Q   +++  K+ G ID+++ + G+SYRG+ ++T + +H ++M  NYFG ++L  +   L+    ++D   IV I+S+QG+I+IPYRSAY+ASKHA  A+ D L++EVA  NI+V  + P YIKTNLS NAL+  G ++  +D+TT  GM+ E VAS V  A++   +EL L      VA+++RT  P LYF +MKKRA H K
Sbjct:    1 MMSYSIYIPIALMAVWVSYRLFKKRHCDLRDKVVLITGASS--GLGEACAH--AFYKAGSRVILCARREAELKRVKQDLQNLKLAIETKEPSI-LTLDLSDLDSVPQRAAQAL--KIHGHIDILVNNGGISYRGEAMETELGIHMSVMTVNYFGQIALTQA---LLPSMVSRDCGHIVAISSVQGKIAIPYRSAYAASKHAAQAYFDSLRAEVADKNIKVSVISPGYIKTNLSLNALQGDGTRYGVMDKTTETGMSPEYVASKVLKAVQEQKNELILAPFTVTVAVFLRTFCPSLYFSLMKKRAAHQK 298          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. TrEMBL
Match: T1K980 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107361967 PE=3 SV=2)

HSP 1 Score: 196.052 bits (497), Expect = 1.445e-56
Identity = 115/280 (41.07%), Postives = 173/280 (61.79%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVA--KDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAE 996
            R+K+K   KDKV+ +TGA +  GLG +L  +   + AK II     E   +     ++  P       + LDL+  D  I+ + +S  D  G ID++I +AG+SYRG ++ T + V++N+M  NYFG + +I ++    +   T     IVG+ S+Q +ISIPYRSAYSASKHAF AF+DCL++E++  +  I VL+V P YI+TNLS NAL   G+ ++K+DETTA GM+ E VA+ + +AI +   EL L  +   +A+ +R L P L+F +M KRA+
Sbjct:   29 RQKYKDSFKDKVIFITGASS--GLGEALTRVFHKFGAKLIIAARNIEKLNVLRDELVENYPEGYRPTPLELDLSKID-TIRQITKSAIDIHGNIDIIINNAGISYRGAIISTDINVYQNLMTVNYFGQIEVIKAI---TEHFVTIGKGTIVGVGSVQSQISIPYRSAYSASKHAFQAFMDCLRAELSSIQPGIDVLAVNPGYIRTNLSLNALSSDGSLYNKMDETTALGMDPEIVANEIAAAIYQKKKELFLSSVTHRLAIILRYLFPNLFFILMSKRAK 302          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Cavefish
Match: dhrs7b (dehydrogenase/reductase 7B [Source:NCBI gene;Acc:103035886])

HSP 1 Score: 179.104 bits (453), Expect = 2.481e-53
Identity = 103/283 (36.40%), Postives = 168/283 (59.36%), Query Frame = 1
Query:  169 KWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFL----DGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            + +  ++DKVV++TGA +  GLG   A +     A+ +I+  R +    E +  L    DG         VT DL+  D   ++ +E +    G +DV+I +AG+SYRG++L T + V +++M++NYFG V+L  ++   +     +    IV I+S+QG+I+IPYRSAY+ASKHA  A+ DCL++EV +  ++V  + P YI+TNLS NA+   G+K+  +D+TTA G +  +VA AV  A+     ++ L      +A+Y+RTL P  +FR+M  RA+  +
Sbjct:   30 RGRQILQDKVVVITGASS--GLGKECARVFHAAGAR-LILCGRDQKRLQEVVQELRTVTDGQKKTYTPCTVTFDLSNTDTVARAAVE-ILKCHGHVDVLINNAGISYRGNILDTHVSVQRDVMETNYFGPVALTQAI---LPSMVGRGSGHIVAISSVQGKIAIPYRSAYAASKHATQAYFDCLRAEVERFGLQVSVISPGYIRTNLSLNAVTGDGSKYGVMDKTTATGWDPTKVAHAVLKAVHYRQKDILLAGPLPTLAVYLRTLWPAAFFRVMASRAKKEQ 305          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Cavefish
Match: dhrs7cb (dehydrogenase/reductase 7C [Source:NCBI gene;Acc:103021458])

HSP 1 Score: 115.931 bits (289), Expect = 1.908e-29
Identity = 81/277 (29.24%), Postives = 146/277 (52.71%), Query Frame = 1
Query:  175 KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL--NFLDGV-PGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSK----LDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            K  +++KVV++T A +  G+G   A +   +E    ++      D +E+L  +   G  P K     + L L++ D + +  VI  + +  G +DV+I ++ +  +  +   S+E+ K +M  N+FG +SL   +  LM   +T  G+F++ + SIQGR+++PYRS+Y+ SKHA  AF DCL++EV +  I V ++  ++I       A  +S  K++     L   T  G+N +++A  +   +     E+ L       ALYIR+L P  +F ++
Sbjct:   32 KSIVRNKVVVITDAVS--GMGSECARM--LHEGGARLVLCGPSWDKLESLYDSLCSGADPSKTFTPKLVL-LDFSDIDSMAEVITEIGECYGCVDVLIFNSSMKVKAPVQNLSLEMDKTVMDVNFFGPISLAKGILPLMISRRT--GHFVL-VNSIQGRLAVPYRSSYAPSKHAVQAFFDCLRAEVEEYGISVSTISHTFINATAQNPAPSNSQPKNALWAYILRTVTTHGVNPKDLAGEIVKVVNGKRREVLLAHPIPWTALYIRSLLPSFFFAVV 300          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Cavefish
Match: dhrs7cb (dehydrogenase/reductase 7C [Source:NCBI gene;Acc:103021458])

HSP 1 Score: 115.931 bits (289), Expect = 1.908e-29
Identity = 81/277 (29.24%), Postives = 146/277 (52.71%), Query Frame = 1
Query:  175 KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL--NFLDGV-PGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSK----LDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            K  +++KVV++T A +  G+G   A +   +E    ++      D +E+L  +   G  P K     + L L++ D + +  VI  + +  G +DV+I ++ +  +  +   S+E+ K +M  N+FG +SL   +  LM   +T  G+F++ + SIQGR+++PYRS+Y+ SKHA  AF DCL++EV +  I V ++  ++I       A  +S  K++     L   T  G+N +++A  +   +     E+ L       ALYIR+L P  +F ++
Sbjct:   32 KSIVRNKVVVITDAVS--GMGSECARM--LHEGGARLVLCGPSWDKLESLYDSLCSGADPSKTFTPKLVL-LDFSDIDSMAEVITEIGECYGCVDVLIFNSSMKVKAPVQNLSLEMDKTVMDVNFFGPISLAKGILPLMISRRT--GHFVL-VNSIQGRLAVPYRSSYAPSKHAVQAFFDCLRAEVEEYGISVSTISHTFINATAQNPAPSNSQPKNALWAYILRTVTTHGVNPKDLAGEIVKVVNGKRREVLLAHPIPWTALYIRSLLPSFFFAVV 300          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Cavefish
Match: dhrs7ca (dehydrogenase/reductase SDR family member 7C-B-like [Source:NCBI gene;Acc:111192971])

HSP 1 Score: 102.449 bits (254), Expect = 2.054e-24
Identity = 82/306 (26.80%), Postives = 152/306 (49.67%), Query Frame = 1
Query:  133 TMGVFVYL---AFRKKWKYFIKDKVVLVTGACTP-----------GGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKT--------NLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            T G+F YL     R   K  +++KVVL+T + +            GG  + L G  K++E K   +  +  N+    L F    P K       ++L++ D E +  ++  V D  G +DV+I ++ +  +      S+E+ + +M +NYFG V+L   V   M   ++  G+ ++ + SIQG++++P+R+ Y+ASKHA  AF DCL++EV +  I V ++  ++I T          + +    S +  S L      G++A E+A  +   +   ++E+ + +  S  A+Y R+  P  +F ++
Sbjct:   22 TAGIF-YLYGVILRMLRKTTVRNKVVLITDSASALGNECAKLFHKGGAQLILCG--KSWE-KLEDLAEQLANESDPTLTF----PPK------LVELDFSDTESLPDMVSDVLDCYGCLDVLIFNSSMKVKAPAHTLSLEIDRLVMDTNYFGPVTLAKGVLPSMISRRS--GHILL-VNSIQGKLTVPFRTTYAASKHAVQAFFDCLRAEVQEYGISVSTISHTFITTAPSSIQSTTSTSSNSNTSKSILSDLSRQQHHGVSAAEMAGELLRTLSSKNNEIIMANFLSRAAIYARSFCPNFFFSVI 310          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Cavefish
Match: dhrs7 (dehydrogenase/reductase 7 [Source:NCBI gene;Acc:103024222])

HSP 1 Score: 75.8702 bits (185), Expect = 4.402e-15
Identity = 77/320 (24.06%), Postives = 150/320 (46.88%), Query Frame = 1
Query:  103 MISSAIVTTITMGVFVY------LAFRKKW----KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEAL--NFLDGVP-GKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVA-KDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELAL----LDLKSHVALYIRTLAPFLYFRIMKKRAEHSKA 1008
            ++++ +   + + VF+       L + +KW    +  ++ KVV +TGA +  G+G  LA       A+ +++++R+E + +E +  N L+     + +I+ + LDL       Q    ++    G ID++I + G S R   + T +EV++ +M+ N+ G VS+   V   M ++       I  ++SI G    P  + YSASKHA   F + L++E+     I + ++ P  + + + +NA  +   K           M+ E     + + +     E+ +      L  +V  Y  TLA F+   + +KR ++ KA
Sbjct:   11 LLAAGVCALLLLLVFIVSDRDFTLLWAEKWGTKPEVALRGKVVWITGASS--GIGEELAYQLAAARAR-LVLSARREAE-LERVKQNCLERTSLEEKDILVLPLDL-LDRASHQEKTNAILHHFGNIDMLINNGGRSQRSLCVDTDVEVYQGLMELNFIGTVSITRQVLPHMIRHGNG---IIATVSSIVGLAGAPLSTGYSASKHALQGFFNSLRTELTDSPGITISTILPGPVVSQIVQNAFTEHTDKPVSSAGDQTHKMSTERCVHLIMAGLANRVKEMWIGQQPFLLFFYVWQYTPTLAWFMTSLLGRKRVQNFKA 322          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Sea Lamprey
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:550454])

HSP 1 Score: 168.703 bits (426), Expect = 7.992e-50
Identity = 108/282 (38.30%), Postives = 160/282 (56.74%), Query Frame = 1
Query:  193 KVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIH-----------VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            KVV+VTGA +  GLG++ A  A   E   +++  R     +E+L   D +  +  I+            V  DL  P E +    E V    G +DV+++ AG+SYRG+   T+M+VH+ +M+ NYFG ++L+ ++  L    K  +G+ IV I+S+QGRI+IP+RSAY+ASKHA  A+ D L++EVA   ++V  V P YI+TNLS NAL   G  +   D  TA G + + VA  V  A+  G  E+    L    A+Y+RTL P LYF +M +RA   +
Sbjct:   56 KVVVVTGASS--GLGLACA-RAFHAEGARLVLCGRDLRR-LESLR--DELSERVRILAPQGPEDRTPRVVPFDLGSPGE-VARAAELVVAAHGRVDVLVSGAGISYRGEAALTAMDVHRQLMEVNYFGAIALLTAL--LPSMLKQGEGH-IVAISSVQGRIAIPFRSAYAASKHATQAYFDSLRAEVADSGLKVTVVSPGYIRTNLSLNALTADGTPYHAQDANTAGGRSPDSVAQDVVGAVLDGRAEVVSAGLVPTAAVYLRTLLPSLYFILMARRARSDR 327          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010315.1 (pep scaffold:Pmarinus_7.0:GL479994:4152:14615:1 gene:ENSPMAG00000009341.1 transcript:ENSPMAT00000010315.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.812e-14
Identity = 70/275 (25.45%), Postives = 130/275 (47.27%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLA-GIAKTYEAKTIIITSRKENDGIEAL-NFLDGVPGKGNIIHV----TLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAK-DNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKK 987
            ++  VV VTGA +  G+G +LA  +A+      +++++R+E +      N L+    K + I V     LDL+      ++  ++V D+ G +DV++ +AG S R   + T + V++ + + N    VSL   V   M    +  G  ++ ++SI G   +P  + Y ASKHA     + L+SE+ +   I + +V P  +++++  NA    G +     +     M+AE  A  +  ++     E  +       A Y+   AP L +R+  K
Sbjct:   48 LRGHVVWVTGASS--GIGEALARELARC--GCQLVLSARREAELQRVRKNCLEDSSLKESDILVLPMDVLDLS----THEACTKAVLDRFGRVDVLVNNAGRSQRSLFMDTDLCVYRTLFELNVLAPVSLARCVLPGMMAPGSHGG-ILLAVSSIAGLAGVPLSAGYCASKHAVQGAFNALRSELDEYPQITISTVCPGPVQSHIISNAFSGKGDEAVGEQKDQTYKMSAERCARLIAVSLAARLPEAWIAQQPYLSAAYLWQYAPTLAWRLTAK 313          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Sea Lamprey
Match: bdh1 (3-hydroxybutyrate dehydrogenase, type 1 [Source:ZFIN;Acc:ZDB-GENE-070410-130])

HSP 1 Score: 62.7734 bits (151), Expect = 2.041e-11
Identity = 57/197 (28.93%), Postives = 98/197 (49.75%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLAGI--AKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLD--LNWPDEKIQSVIESVWDKVGGIDV--VIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFP 756
            I+DK VLVTG  +  G G+SLA    +K ++     +   K  DG + L  +     K   ++V  D  +    E I+S +    D   G  +  V+ +AG+S  G++  T M+ +KN+ + N +G V    +   L+++ + +    +V I+S+ GR+    RS Y  +K    AF DCL+ E+ +  ++V  V P
Sbjct:   23 IRDKAVLVTGCDS--GFGLSLAQHLHSKGFKIFAGCLLKDKGGDGAKQLEAMKSERLKVVQMNVASDDEVAKAVEFIRSSLPDPEDGERGTGLWGVVNNAGISTFGEIEWTPMDTYKNVAEVNLWGIVRTTKACLPLIRRARGR----VVNISSMMGRMGNTARSPYCITKFGIEAFSDCLRYEMMRWGVKVSVVEP 213          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Sea Lamprey
Match: kdsr (3-ketodihydrosphingosine reductase [Source:ZFIN;Acc:ZDB-GENE-040426-853])

HSP 1 Score: 58.5362 bits (140), Expect = 5.081e-10
Identity = 39/158 (24.68%), Postives = 79/158 (50.00%), Query Frame = 1
Query:  358 IIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDET 831
            ++ +++D++    +++SVI+   +K+G +D+++ +AG S  G       +  K +M+ NY G+V    +V   MK+ +      +V ++S  G++ +   +AYS +K A     + L+ EV   N+ V   FP    T      ++D   +   + ET
Sbjct:   54 VLCISVDVSNDFNQVESVIKQAQEKLGPVDMLVNAAGTSVAGRFEDIKPQEFKRLMEVNYLGSVFTSLAVVPGMKERRKGR---VVYVSSQAGQLGLYGFTAYSPTKFALRGLAEALQMEVKPYNVYVTLAFPPDTDTPGFHEEIKDKPLETKLISET 208          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004317.1 (pep scaffold:Pmarinus_7.0:GL477490:75458:82048:1 gene:ENSPMAG00000003943.1 transcript:ENSPMAT00000004317.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 8.497e-9
Identity = 40/151 (26.49%), Postives = 81/151 (53.64%), Query Frame = 1
Query:  391 DEKIQSVIESVWDKVGGIDV--VIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFP-SYIK-TNLSKNALRDSGAKHSKLDET 831
            DE++Q    +V       D+  V+ +AG+++ G++   +M  ++     N +G +    +   L+K +K +    IV ++SI   +  P+ SAY  SK    AF +CL+ E+ K +++V+ + P ++I  TN+ +N  +D+ + +  L E+
Sbjct:  110 DEQVQEARAAVTRMGRQADLWAVVNNAGITHLGEVEMCNMNSYQRAANVNLWGTIRTTMAFLPLVKASKGR----IVNMSSISAHLHTPFNSAYCVSKSGVDAFSNCLRVEMKKWDVKVVLIEPGTFISHTNIMQN--QDTKSIYRSLTES 254          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Yeast
Match: YMR226C (NADP(+)-dependent serine dehydrogenase and carbonyl reductase; acts on serine, L-allo-threonine, and other 3-hydroxy acids; green fluorescent protein fusion protein localizes to the cytoplasm and nucleus; may interact with ribosomes, based on co-purification experiments [Source:SGD;Acc:S000004839])

HSP 1 Score: 63.5438 bits (153), Expect = 5.042e-12
Identity = 65/244 (26.64%), Postives = 113/244 (46.31%), Query Frame = 1
Query:  163 RKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLL-KTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKR 891
            RK  +   K K VL+TGA    G   +L  +  +     +I+ +R+     E    +D       +    LD+    EKI+  IE++  +   ID+++ +AG +   D + + + E  +++  +N     +LIN    ++   + K+   IV + SI GR + P  S Y ASK A  AF D L+ E+    IRV+ + P  ++T  S    R +  +   + + T   M A++VA  +  A  R
Sbjct:    5 RKAAERLAK-KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQLDITQA-EKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNV---TALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLM-ADDVADLIVYATSR 242          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Yeast
Match: OAR1 (Mitochondrial 3-oxoacyl-[acyl-carrier-protein] reductase; may comprise a type II mitochondrial fatty acid synthase along with Mct1p; human homolog CBR4 complements yeast null mutant [Source:SGD;Acc:S000001538])

HSP 1 Score: 53.9138 bits (128), Expect = 8.248e-9
Identity = 46/162 (28.40%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  442 IDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYF--------IVGITSI--QGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIK-TNLSKNALRDSGAKHSKLDETTAKGMNAE-EVASAVFSAIKR 891
            ++++I  AG++     ++T+    ++IM  N+   V++ N     M K++ +            IV I+SI   G++ +P  S YSASK A S F + L +E+   NIR  ++ P  +K T++ +N   +  AK        A G +A  E+A  V+S   R
Sbjct:  114 VNLLINCAGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPVE--AKEMLERTIGASGTSAPAEIAEEVWSLYSR 273          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Yeast
Match: YKL071W_mRNA (Putative protein of unknown function; expression induced in cells treated with the mycotoxin patulin, and also the quinone methide triterpene celastrol; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm [Source:SGD;Acc:S000001554])

HSP 1 Score: 48.521 bits (114), Expect = 4.690e-7
Identity = 62/234 (26.50%), Postives = 105/234 (44.87%), Query Frame = 1
Query:  229 GLGISLAGIAKTYEAKTIIITSR-----KENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDK--VGGIDVVIASAGVS---YRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRIS--IPYR-SAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKR 891
            G+G +L  I       T+I + R      +N  +E L  +     + NI  V LDL   DE I ++ + +       GID+ IA + VS   Y+  +L+T   V  N   +N  G +  +  V  L+   KT+  +F   I+S+ G I+  +P   SAY  SK A +  +  L  E+  +   V++  P  + T++ +  L     K   +D +    +  EE ASA+    ++
Sbjct:   17 GIGFNLVKILSASTGNTVITSIRGSPSLPKNKQVEDLAKI-----RKNIHIVQLDLT-KDESIGNIADEIKKTPFFLGIDIFIACSAVSDSYYK--VLETPKSVWLNHYSTNALGPILALQKVYPLLLLKKTRKIFF---ISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLSFELKPEGFTVVAFHPGMVSTDMGQYGLDH--FKEKNIDISGVNIITPEESASALIDVFRK 237          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Nematostella
Match: EDO33257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSS1])

HSP 1 Score: 83.5741 bits (205), Expect = 1.528e-18
Identity = 44/119 (36.97%), Postives = 71/119 (59.66%), Query Frame = 1
Query:  442 IDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRD 798
            ID+++ + GVS RG +  T ++V K ++  N FG +SL  +V   M+K K      IV ++S+ G+   PY + YSASK A   + D L+ EV + NI +L V P  +K+ ++KNA+ +
Sbjct:   90 IDILVNNGGVSQRGFVRNTPLDVDKYLLDINLFGTISLTKAVLPHMEKKKQGQ---IVVLSSVMGKWGFPYEATYSASKFALHGYFDALRLEVEESNINILMVCPGPVKSEVAKNAVTE 205          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Nematostella
Match: EDO43014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZW0])

HSP 1 Score: 71.633 bits (174), Expect = 3.539e-14
Identity = 62/241 (25.73%), Postives = 116/241 (48.13%), Query Frame = 1
Query:  193 KVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRK-ENDGIEALNFLD-GVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTS-MEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDEL 906
            +V  +TGA +  G+G +LA     +  K ++   R+ E + ++     +       +I+ + +D+   D+  + ++ SV D    ID++I ++G S RG  ++T  +EV K ++  N+   VSL  +V  L    + K+G+ +V  +S+ G+I  P  ++Y+A+K A   + D L+ E+   NI V  V P  ++T +  NA  +          T    M     A  + + +    DEL
Sbjct:   43 RVCWITGASS--GIGENLAYELAKFGCKLVLSARRRSELERVKEQCIANTSYNADQDILVLPMDVTEYDKHTE-LVRSVLDHFNKIDILINNSGRSQRGLAVETPGIEVEKAMLDLNFLAVVSLTKAV--LPHMIERKNGHIVV-TSSVAGKIGAPMSTSYNATKFAVQGYFDGLRVELFPKNIHVTLVCPGPVRTAIRDNAFTEQDKGVVAPPATKDNRMETSRCAQLIVTGVTNKLDEL 277          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Nematostella
Match: EDO45710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA6])

HSP 1 Score: 71.2478 bits (173), Expect = 4.720e-14
Identity = 52/181 (28.73%), Postives = 96/181 (53.04%), Query Frame = 1
Query:  391 DEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSK-LDETTAKGM-NAEEVASAVFSAIKRGDDELA--LLDL 921
            DE +  V++S++     IDV++ +AGV   G L   +M + + +   N+FG V L  +V   MK+N +  G+ I+ ITSI G   +P+ + Y +SK A     + L   + K N+++ +V P  +KT    N+   +     + +DE T + + NA+    + F+ + +  +E+A  +LD+
Sbjct:   69 DESVTEVLQSIYSAERRIDVLVNNAGVGLIGVLETHTMSLVREMFNVNFFGVVRLTKAVIPKMKENHS--GH-IINITSIGGIRGVPFNAIYCSSKFAVEGMAESLAPLLRKFNVKITNVEPGPVKTAFVANSTEMAPVYDDEGVDEETKQLLENAKTKMMSAFATVAQSPEEIAQCILDI 246          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Nematostella
Match: EDO44080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWS5])

HSP 1 Score: 67.3958 bits (163), Expect = 6.066e-13
Identity = 53/183 (28.96%), Postives = 88/183 (48.09%), Query Frame = 1
Query:  346 GKGN-IIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLIN-SVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAV 873
            GKG+ ++ V  DL+  ++ ++ ++E   +K G +D+++  AG+   G +  TS++    +M  N      L + +V +L+K         IV ++S+ G  S P    Y+ SK A   F  C+  E+A   +R  SV P  I T L +    D  A     +HSK      +   AEEVA A+
Sbjct:   47 GKGSEVLAVEGDLSH-EKDVKDLLEKTLEKFGKLDILVNCAGILPTGTIENTSLQTFDEVMNVNVRAVFYLTSLAVPHLIKTEGC-----IVNVSSVNGLRSFPGVLGYNMSKAALDQFTRCVALELAPKKVRCNSVNPGVIVTGLQRRGGLDEEAYQKFLEHSKTTHALGRPGEAEEVARAI 223          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Nematostella
Match: EDO33036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STD1])

HSP 1 Score: 64.3142 bits (155), Expect = 7.049e-12
Identity = 71/232 (30.60%), Postives = 111/232 (47.84%), Query Frame = 1
Query:  193 KVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLD--GVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVS-YRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNAL--RDSGAKHSKLDETTAKGMNAEEVASAV 873
            KV +VT +    G+G+++A       AK ++++SRK+++ I+A NFL+  G+   G + HV      P+ + Q++I    +  GGID+++++A  +   G LL+T+ +    I + N   +  L   V   M+K   + G  IV I+SI G   +    AYS SK         L  E A   IRV  V P  IKT  S      RD    H  +      G  +EE+  AV
Sbjct:   14 KVAIVTASTD--GIGLAIAQQLGKDGAK-VVVSSRKQDNVIKAANFLENEGIDVMGVMCHV----GKPEHR-QNLINRTINHFGGIDILVSNAATNPVFGPLLQTTEDAWDKIFEVNVKASFLLSKDVIPHMEK---RGGGNIVYISSIGGYQPLQGLGAYSISKTTLLGLTKALADECADIGIRVNCVAPGVIKTRFSAAVRRGRDKMYSHCCIHSFHRLG-TSEEIGGAV 233          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Medaka
Match: dhrs7b (dehydrogenase/reductase 7B [Source:NCBI gene;Acc:101157135])

HSP 1 Score: 166.392 bits (420), Expect = 2.286e-48
Identity = 86/213 (40.38%), Postives = 133/213 (62.44%), Query Frame = 1
Query:  367 VTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSK 1005
            V  DL   D  I    E +    G +DV+I +AG+SYRG++L T + V + +M++NYFG +SL  ++  L      + G+ +V I+S+QG+I+IP RSAY+ASKHA  AF DCL++E+ ++ I V  + P YI+T+LS NA+   G+K+  +D+ TA G N  +VA AV  A+ +   ++ L      VA+Y+RTL P L+F++M  RA   +
Sbjct:   94 VIFDLAKAD-TIGKAAEEILKCYGHVDVLINNAGISYRGNILDTHISVQREVMETNYFGPISLTQAL--LPSMVHRRSGHIVV-ISSVQGKIAIPSRSAYAASKHATQAFFDCLRAEIEQNGISVTVISPGYIQTDLSINAVTGDGSKYGIMDKATAAGQNPRDVAHAVLKAVCQRSSDVLLAGTLPSVAVYLRTLWPALFFKLMSSRARKEQ 302          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Medaka
Match: dhrs7cb (dehydrogenase/reductase 7C [Source:NCBI gene;Acc:101171865])

HSP 1 Score: 102.064 bits (253), Expect = 2.278e-24
Identity = 79/277 (28.52%), Postives = 141/277 (50.90%), Query Frame = 1
Query:  175 KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHV----TLDLNWPD-EKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDS---GAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM 981
            K  +++KVV++T A +  G+G   A +     A+ I+       D +E+L   D + G  +         + L++ D   ++ V+  V +  G +DV+I ++ V  +      S+E  +NIM  NYFG  +L   V   M   ++  G+ I+ + S+QGR+++P+RS+Y+ASKHA  AF DCL++EV +  + V +V  ++I  N ++ A   S    A  + +      G+    +A+ +   + R   E+ L      VALY+R+L P   F ++
Sbjct:   32 KSLVRNKVVVITDAVS--GVGTECARLFHKGGARLILCG--MSWDKLESL--YDSLTGDADPRETFAPKLVILDFSDMASMEEVVSEVMECYGCVDVLICNSSVKLKAPARSVSLETDRNIMDINYFGPSTLAKGVLPAMISRRS--GHIIL-VNSVQGRLAVPFRSSYAASKHAAQAFFDCLRAEVEEYGLVVSTVSHTFI--NSAEPAPLPSPKPNALAAFIKSQLTHGVRPSVLANEIMQTVNRKRKEVVLAHPIPRVALYLRSLFPPFLFAVL 297          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Medaka
Match: dhrs7ca (dehydrogenase/reductase SDR family member 7C-B [Source:NCBI gene;Acc:101160164])

HSP 1 Score: 97.4413 bits (241), Expect = 2.410e-22
Identity = 85/317 (26.81%), Postives = 151/317 (47.63%), Query Frame = 1
Query:   88 WTLSEMISSAIVTTITMGVF----VYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDG------VPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSKA 1008
            W  S  +   +V  +T G F      LA   K    +++KVV++T A +   LG   AG+     A+ I+     E     A +  DG       P K     V LD    D   ++V E V +  G +D++I ++ +  +      ++E  K +M +NYFG ++L   V   M   ++  G+ I+ + SIQG++++P+R+AY+ASKHA  AF DCL++EV +  I V ++  ++I  + S    +   +  S L      G++ +E  + +   +     E+ +      +A+Y R+  P ++F +M     +S A
Sbjct:   79 WATSAFLVPCVVV-LTAGFFYLYGAVLALLSKTS--VRNKVVIITNALS--ELGKECAGVFHRGGARLILCGKSWEKLEELADDLTDGSDPTLTFPPK----LVLLDFGDVDGTAEAVSE-VLECYGCLDILIFNSSMKVKAPAQTLTLETDKLLMDNNYFGPITLAKGVLPSMISRRS--GHLIL-VNSIQGKLAVPFRTAYAASKHAVQAFFDCLRAEVEEYGISVSTINHTFIGRSSSNT--KPPKSFMSPLFTKKPLGVSPDEATAEIMKTLSNKKKEVLMAPSLPKLAVYARSFFPGVFFSVMAAGVNNSAA 380          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Medaka
Match: dhrs7 (dehydrogenase/reductase 7 [Source:NCBI gene;Acc:101155311])

HSP 1 Score: 76.6406 bits (187), Expect = 2.359e-15
Identity = 77/291 (26.46%), Postives = 133/291 (45.70%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLA-GIAKTYEAKTIIITSRKEND-------GIEALNFLDGVPGKGNIIHVTLDL---NWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAK-DNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIM----KKRAEHSKA 1008
            +K  VV VTGA +  G+G  LA  +AK      +I+++R++++        +E  N  D      +I+ + LDL      +EK ++VI+      G ID++I + G S R   L+TS++V++ +M+ N+ G VSL   V   M +        IV ++S+ G    P  + YSASKHA   F + L++E+     I + +  P  +++ +  NA  +   K           M        +   I  G  E+ +      V  Y+   AP   + +     +KR ++ KA
Sbjct:   47 LKGLVVWVTGASS--GIGEELAYQLAKC--GSRLILSARRKDELNKVKQHCLETSNLKDE-----DILVLPLDLLERTSHEEKTKAVIQ----HFGQIDILINNGGRSQRSLCLETSVDVYQALMELNFLGTVSLTKQVLPHMTQRGRGS---IVTVSSVVGLAGAPLATGYSASKHALQGFFNSLRTELTDFPKILISTACPGPVQSQIVNNAFTEELNKPVTTVGYQGHKMPTSRCVHLMLVGISNGVKEMWIAQQPFLVFYYLWQYAPSFAWSVTDLLGRKRVQNFKA 321          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Medaka
Match: rdh8a (retinol dehydrogenase 8 [Source:NCBI gene;Acc:101157056])

HSP 1 Score: 75.485 bits (184), Expect = 5.759e-15
Identity = 65/242 (26.86%), Postives = 121/242 (50.00%), Query Frame = 1
Query:  193 KVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRD-SGAKHSKLDETTAKGMNAEEVASA--VFSAIKRGDDELA 909
            KVVL+TG  +  GL I++   +   +   +I T R      + L     V GK  ++ + LD+   DE ++  I SV D+   ID++I +AGV   G +   S+E  K +  +N+FG V +I  V   MKK ++  G+ +V ++S+ G   + +   Y+ASK A   F + +  ++ K NIR+  + P  + T      + + +  ++  +D  T +      + S+  +F A+ +  +++A
Sbjct:    7 KVVLITGCSSGIGLRIAVTLASDEKKRYHVIATMRDLKKKDKLLEAAGDVYGK-TLMLLPLDV-CSDESVRQCINSVKDR--HIDILINNAGVGLLGPVESISIEEMKRVFDTNFFGVVRMIKEVMPDMKKRRS--GHIVV-MSSVMGLQGVVFNDVYTASKFAMEGFCESMAVQLLKFNIRLSMIEPGPVHTEFETKMMEEVAKMEYPGVDADTIRYFKDVYLPSSIDIFEAMGQTPEDIA 241          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Planmine SMEST
Match: SMESG000047014.1 (SMESG000047014.1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 308/309 (99.68%), Postives = 308/309 (99.68%), Query Frame = 1
Query:   85 MWTLSEMISSAIVTTITMGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSKAY 1011
            MWTLSEMISSAIVTTITMGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISL GIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSKAY
Sbjct:    1 MWTLSEMISSAIVTTITMGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGLGISLVGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMKKRAEHSKAY 309          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Planmine SMEST
Match: SMESG000006643.1 (SMESG000006643.1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.461e-12
Identity = 62/228 (27.19%), Postives = 110/228 (48.25%), Query Frame = 1
Query:  112 SAIVTTITMGVFVYLAFR---KKWK-----YFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITS-----RKENDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFP 756
            + +V T  +G+ V + F+   K WK       +K+K V+VTG  +  G+G+SLA +A +Y A   II       +K  + I   N +      G I ++++DL      I+  ++ +   +G  D++I  AG +   D  +   E  +  M+ NY  +  +   +   M + KT+    +  ++S+ G++ I   ++YSASK A     +CL+ EVA   + V   FP
Sbjct:    7 TCVVLTGLVGICVLIIFKWLYKIWKSDEGLLSLKNKTVVVTGGSS--GIGLSLAKLAYSYGAHVTIIARNVVNLKKAEEEIRNQNCVS----IGQIKYLSVDLTIDYYTIEKQLKQI---IGLTDILINCAGGALSKDFHQMDPENIETQMRLNYLASAHVTRIMLPAMLETKTQ--CRVTFVSSMAGQVGIYGLASYSASKFALRGLAECLQMEVANRGVSVTLAFP 223          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Planmine SMEST
Match: SMESG000018759.1 (SMESG000018759.1)

HSP 1 Score: 60.077 bits (144), Expect = 5.482e-10
Identity = 72/293 (24.57%), Postives = 136/293 (46.42%), Query Frame = 1
Query:  133 TMGVFVYLAFRKKWKYFI---------KDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGN---IIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEV---AKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFL 966
             +G+ ++ +    +K+FI          +KVVL+TGA    GLG +LA   K  + +  ++    + D ++ +  +D      +   ++ + +D++   + I +  + V  KVG +D++I +AGV++   +  T ME   NI ++     +S I  V + ++   +++   +V I+S  G + +   + Y  SK A + F + L  E+    K  + VL+V+P ++KT + +N          K D    K +  E VAS +  AI           L +   LY+  L  FL
Sbjct:   13 VIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITGA--GNGLGAALA--IKFAKQRCRLVLWETDIDSLKII--IDECKKYQSDLFVLGIQVDISNRSQIINAA-DMVKTKVGFVDIIINNAGVAFTSSI--TEME-ENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQN---------YKFDCPILKSLEVEYVASKIEEAI-----------LTNATVLYLPKLLHFL 275          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Planmine SMEST
Match: SMESG000018759.1 (SMESG000018759.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.097e-9
Identity = 68/267 (25.47%), Postives = 126/267 (47.19%), Query Frame = 1
Query:  184 IKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGN---IIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEV---AKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETTAKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFL 966
            + +KVVL+TGA    GLG +LA   K  + +  ++    + D ++ +  +D      +   ++ + +D++   + I +  + V  KVG +D++I +AGV++   +  T ME   NI ++     +S I  V + ++   +++   +V I+S  G + +   + Y  SK A + F + L  E+    K  + VL+V+P ++KT + +N          K D    K +  E VAS +  AI           L +   LY+  L  FL
Sbjct:    4 VNNKVVLITGA--GNGLGAALA--IKFAKQRCRLVLWETDIDSLKII--IDECKKYQSDLFVLGIQVDISNRSQIINAA-DMVKTKVGFVDIIINNAGVAFTSSI--TEME-ENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNY---------KFDCPILKSLEVEYVASKIEEAI-----------LTNATVLYLPKLLHFL 240          
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Planmine SMEST
Match: SMESG000079254.1 (SMESG000079254.1)

HSP 1 Score: 56.6102 bits (135), Expect = 6.426e-9
Identity = 66/241 (27.39%), Postives = 105/241 (43.57%), Query Frame = 1
Query:  175 KYFIKDKVVLVTGACTPGGLGISLAGIAKTYEAKTIIITSRKE---NDGIEALNFLDGVPGKGNIIHVTLDLNWPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSNYFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHAFSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGA-----KHSKLDETTAKGMNAEEVASAV 873
            K+ +  K  L+TGA +  G+G S A +     A  I+IT R     ND I+ L  L  V     I+  T DL   +E ++ + E    +   +D++I +AGV     +    ME   ++M  N    + L N +   +   K      IV ++S+ G  + P   +Y  SK A   F  C   ++A   +RV +V P    TNL K A     A     + SK      +   +EE+A ++
Sbjct:    4 KFSLNFKNALITGASS--GIGKSTAELFFKLGAN-ILITGRNLENLNDTIK-LCELSKVNENQRIVAFTADL-TNEEDVKKLAEKTLLEFPKLDILINNAGVISNDTIENVEMENFDSVMNMNLRSVIQLTNLLSPSLIDRKGS----IVNVSSVAGTRAFPNVMSYCISKAALEQFTKCTALDLASKGVRVNAVSPGVTVTNLHKRAGMSESAYQAFLEKSKTTHALGRAGESEEIAYSI 235          
The following BLAST results are available for this feature:
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHRS7B1.709e-5235.69dehydrogenase/reductase 7B [Source:HGNC Symbol;Acc... [more]
DHRS7B1.994e-5235.69dehydrogenase/reductase 7B [Source:HGNC Symbol;Acc... [more]
DHRS7C1.595e-2828.82dehydrogenase/reductase 7C [Source:HGNC Symbol;Acc... [more]
DHRS7C6.940e-2829.17dehydrogenase/reductase 7C [Source:HGNC Symbol;Acc... [more]
DHRS7B3.725e-1952.00dehydrogenase/reductase 7B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhs-301.073e-3330.92DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
T25G12.134.477e-3230.92pep chromosome:WBcel235:X:17243357:17244762:1 gene... [more]
Y47G6A.221.743e-1329.34pep chromosome:WBcel235:I:3559923:3562851:-1 gene:... [more]
Y47G6A.212.610e-1327.35pep chromosome:WBcel235:I:3551949:3559807:-1 gene:... [more]
drd-54.784e-1329.69Dietary restriction down regulated [Source:UniPro... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG76011.953e-5137.91gene:FBgn0027583 transcript:FBtr0085544[more]
CG121716.800e-1730.64gene:FBgn0037354 transcript:FBtr0078708[more]
CG315491.144e-1327.66gene:FBgn0051549 transcript:FBtr0078707[more]
CG315491.144e-1327.66gene:FBgn0051549 transcript:FBtr0335215[more]
CG319371.373e-1124.35gene:FBgn0031360 transcript:FBtr0077884[more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhrs7b7.901e-5237.20dehydrogenase/reductase (SDR family) member 7B [So... [more]
dhrs7cb1.583e-2625.85dehydrogenase/reductase (SDR family) member 7Cb [S... [more]
dhrs7ca1.883e-2428.85dehydrogenase/reductase (SDR family) member 7Ca [S... [more]
dhrs7ca3.651e-1828.57dehydrogenase/reductase (SDR family) member 7Ca [S... [more]
dhrs74.548e-1626.01dehydrogenase/reductase (SDR family) member 7 [Sou... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhrs7b2.380e-5338.46dehydrogenase/reductase (SDR family) member 7B [So... [more]
dhrs7b4.623e-5338.46dehydrogenase/reductase (SDR family) member 7B [So... [more]
dhrs7b6.331e-5238.79dehydrogenase/reductase (SDR family) member 7B [So... [more]
dhrs7c1.778e-2928.71dehydrogenase/reductase (SDR family) member 7C [So... [more]
gria42.430e-1428.23glutamate receptor, ionotropic, AMPA 4 [Source:Xen... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhrs7b1.650e-5739.53dehydrogenase/reductase (SDR family) member 7B [So... [more]
Dhrs7b2.394e-5739.53dehydrogenase/reductase (SDR family) member 7B [So... [more]
Dhrs7c1.749e-3030.88dehydrogenase/reductase (SDR family) member 7C [So... [more]
Dhrs74.469e-1825.61dehydrogenase/reductase (SDR family) member 7 [Sou... [more]
Dhrs71.053e-1525.96dehydrogenase/reductase (SDR family) member 7 [Sou... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99J47|DRS7B_MOUSE1.675e-5639.53Dehydrogenase/reductase SDR family member 7B OS=Mu... [more]
sp|Q3T0R4|DRS7B_BOVIN5.831e-5535.69Dehydrogenase/reductase SDR family member 7B OS=Bo... [more]
sp|Q7Q732|DHRS7_ANOGA2.486e-5438.06Dehydrogenase/reductase SDR family protein 7-like ... [more]
sp|Q5RJY4|DRS7B_RAT5.610e-5437.87Dehydrogenase/reductase SDR family member 7B OS=Ra... [more]
sp|Q0VFE7|DRS7B_XENTR1.261e-5238.46Dehydrogenase/reductase SDR family member 7B OS=Xe... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6CN931.320e-5840.06Uncharacterized protein OS=Clastoptera arizonana O... [more]
A0A1S3HIF61.640e-5739.74dehydrogenase/reductase SDR family protein 7-like ... [more]
A0A2R2MQJ01.900e-5739.74dehydrogenase/reductase SDR family protein 7-like ... [more]
A0A1S3HFH72.232e-5739.94dehydrogenase/reductase SDR family protein 7-like ... [more]
T1K9801.445e-5641.07Uncharacterized protein OS=Tetranychus urticae OX=... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhrs7b2.481e-5336.40dehydrogenase/reductase 7B [Source:NCBI gene;Acc:1... [more]
dhrs7cb1.908e-2929.24dehydrogenase/reductase 7C [Source:NCBI gene;Acc:1... [more]
dhrs7cb1.908e-2929.24dehydrogenase/reductase 7C [Source:NCBI gene;Acc:1... [more]
dhrs7ca2.054e-2426.80dehydrogenase/reductase SDR family member 7C-B-lik... [more]
dhrs74.402e-1524.06dehydrogenase/reductase 7 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhrs7b7.992e-5038.30dehydrogenase/reductase (SDR family) member 7B [So... [more]
ENSPMAT00000010315.11.812e-1425.45pep scaffold:Pmarinus_7.0:GL479994:4152:14615:1 ge... [more]
bdh12.041e-1128.933-hydroxybutyrate dehydrogenase, type 1 [Source:ZF... [more]
kdsr5.081e-1024.683-ketodihydrosphingosine reductase [Source:ZFIN;Ac... [more]
ENSPMAT00000004317.18.497e-926.49pep scaffold:Pmarinus_7.0:GL477490:75458:82048:1 g... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YMR226C5.042e-1226.64NADP(+)-dependent serine dehydrogenase and carbony... [more]
OAR18.248e-928.40Mitochondrial 3-oxoacyl-[acyl-carrier-protein] red... [more]
YKL071W_mRNA4.690e-726.50Putative protein of unknown function; expression i... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332571.528e-1836.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430143.539e-1425.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457104.720e-1428.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440806.066e-1328.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330367.049e-1230.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhrs7b2.286e-4840.38dehydrogenase/reductase 7B [Source:NCBI gene;Acc:1... [more]
dhrs7cb2.278e-2428.52dehydrogenase/reductase 7C [Source:NCBI gene;Acc:1... [more]
dhrs7ca2.410e-2226.81dehydrogenase/reductase SDR family member 7C-B [So... [more]
dhrs72.359e-1526.46dehydrogenase/reductase 7 [Source:NCBI gene;Acc:10... [more]
rdh8a5.759e-1526.86retinol dehydrogenase 8 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Dehydrogenase/reductase SDR family member 7B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047014.10.000e+099.68SMESG000047014.1[more]
SMESG000006643.13.461e-1227.19SMESG000006643.1[more]
SMESG000018759.15.482e-1024.57SMESG000018759.1[more]
SMESG000018759.11.097e-925.47SMESG000018759.1[more]
SMESG000079254.16.426e-927.39SMESG000079254.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002394 ID=SMED30002394|Name=Dehydrogenase/reductase SDR family member 7B|organism=Schmidtea mediterranea sexual|type=transcript|length=1059bp
CTTCATTTCCTTACGCAAATTTAGGGTCTAAGGATTTGAAATAAATTTTA
GCATATAATTTTTATTATTAAAATTTTTAGCTCAATGTGGACTCTTTCTG
AAATGATATCATCAGCTATTGTTACAACTATAACAATGGGAGTTTTTGTA
TATCTGGCATTTAGAAAAAAGTGGAAGTATTTTATTAAAGATAAAGTAGT
TTTAGTTACCGGTGCATGTACACCGGGTGGCTTAGGAATAAGTCTAGCCG
GTATTGCTAAAACATACGAAGCTAAAACAATAATAATAACCAGCAGGAAA
GAAAATGATGGGATTGAAGCTTTAAATTTTTTAGATGGAGTTCCAGGAAA
AGGAAACATTATTCATGTGACGTTGGATTTAAATTGGCCAGATGAAAAAA
TCCAATCTGTAATAGAATCCGTTTGGGATAAAGTAGGTGGTATTGACGTT
GTAATTGCAAGTGCAGGGGTGTCTTATCGTGGAGATTTACTGAAGACATC
AATGGAAGTTCATAAAAATATTATGCAGAGTAATTATTTTGGTAACGTCA
GTTTGATCAACTCAGTCGGTAACTTGATGAAAAAAAATAAAACCAAAGAC
GGATATTTCATTGTCGGAATTACCAGCATACAAGGGAGAATTTCTATTCC
TTACCGATCTGCTTATTCAGCATCGAAACACGCATTTTCTGCATTTCTCG
ATTGTTTGAAATCTGAAGTTGCGAAAGATAATATTCGTGTTTTGAGCGTG
TTTCCAAGTTATATCAAAACTAATTTGTCCAAAAATGCACTAAGAGATTC
TGGCGCTAAGCACTCAAAACTCGATGAAACCACCGCAAAAGGCATGAATG
CTGAGGAAGTTGCCAGCGCAGTATTTTCGGCGATTAAAAGAGGCGATGAC
GAGTTAGCACTGCTAGATTTGAAGTCTCATGTCGCATTATATATTCGAAC
ATTAGCACCATTTTTATATTTTCGTATTATGAAAAAAAGAGCAGAACACT
CAAAAGCTTATTGATTTAATAAAAAATGTGTTTATATATCATTTATGCAT
TAAGTCGAT
back to top

protein sequence of SMED30002394-orf-1

>SMED30002394-orf-1 ID=SMED30002394-orf-1|Name=SMED30002394-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MWTLSEMISSAIVTTITMGVFVYLAFRKKWKYFIKDKVVLVTGACTPGGL
GISLAGIAKTYEAKTIIITSRKENDGIEALNFLDGVPGKGNIIHVTLDLN
WPDEKIQSVIESVWDKVGGIDVVIASAGVSYRGDLLKTSMEVHKNIMQSN
YFGNVSLINSVGNLMKKNKTKDGYFIVGITSIQGRISIPYRSAYSASKHA
FSAFLDCLKSEVAKDNIRVLSVFPSYIKTNLSKNALRDSGAKHSKLDETT
AKGMNAEEVASAVFSAIKRGDDELALLDLKSHVALYIRTLAPFLYFRIMK
KRAEHSKAY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 118..129
score: 41.58
coord: 215..232
score: 33.19
coord: 38..55
score: 34.38
coord: 194..213
score: 32.46
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 37..236
e-value: 1.9E-31
score: 109.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 34..286
e-value: 1.8E-42
score: 147.3
NoneNo IPR availablePANTHERPTHR44196:SF1DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 7Bcoord: 24..307
NoneNo IPR availablePANTHERPTHR44196FAMILY NOT NAMEDcoord: 24..307
NoneNo IPR availableTMHMMTMhelixcoord: 38..57
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 32..300