Acyl-CoA synthetase short chain family member 3

Overview
NameAcyl-CoA synthetase short chain family member 3
Smed IDSMED30002393
Length (bp)3336
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acyl-CoA synthetase short chain family member 3 (SMED30002393) t-SNE clustered cells

Violin plots show distribution of expression levels for Acyl-CoA synthetase short chain family member 3 (SMED30002393) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acyl-CoA synthetase short chain family member 3 (SMED30002393) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acyl-CoA synthetase short chain family member 3 (SMED30002393) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002393

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30002393h1SMcG0020259 Contig39510uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002393h1SMcG0020259 Contig39510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002393h1SMcG0020259 Contig8533newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002393h1SMcG0020259 Contig8533uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30002393h1SMcG0020259 dd_Smed_v4_3948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002393h1SMcG0020259 dd_Smed_v4_3948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002393h1SMcG0020259 dd_Smed_v4_3948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 466.848 bits (1200), Expect = 2.139e-150
Identity = 239/631 (37.88%), Postives = 385/631 (61.01%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRS-TSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E K+ PS +WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+     +TY E+L+ V  +AG++V K GI+ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+++        ++Y+ P+ E   L  GRD +W+ E+ K Q     PV S+HP +++YTSGTTG  KG++  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W  + F+  V + W QTE G+  T+ C+G   S T   G+  +S   PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  + ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    +      +  +++++E VK+V   +G VA+F  AV V ++PK+ +GK  +++L A++NGKP+KI +  +D  ++  + ++LK++
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSV--PGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 458.373 bits (1178), Expect = 4.053e-147
Identity = 238/631 (37.72%), Postives = 384/631 (60.86%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRS-TSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E K+ PS + FV G LN+CYN +D+ IE G GD+ A+IY+SPV+     +TY E+L+ V  +AG++V K GI+ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+++        ++Y+ P+ E   L  GRD +W+ E+ K Q     PV S+HP +++YTSGTTG  KG++  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W  + F+  V + W QTE G+  T+ C+G   S T   G+  +S   PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  + ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    +      +  +++++E VK+V   +G VA+F  AV V ++PK+ +GK  +++L A++NGKP+KI +  +D  ++  + ++LK++
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTR-FVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSV--PGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 238.039 bits (606), Expect = 5.980e-66
Identity = 165/613 (26.92%), Postives = 294/613 (47.96%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQ-VTWTKPYVSIIEGKYFPSP-KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPT--ERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVH---DKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKI---VDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGK 3161
            + A+   +   P  FW   A+  + W  PY ++ +  +      WF+GG+LN+  NCLD+ + +   +  A+I+E          TY ELL++   +A  + ++ G+  GD V I+MP+ P  + AMLACARIGAV++  F GF+ + ++ RIN  + K+V T N G+    ++  KK +D A++     V+  +V    D +  V +   D     E+ K  P   P  + S+   F++YTSG+TG  KG+V    G  + +  +        P + F C++   WI G S + YGPL +   +++++  P         E +  LK ++       PT +RL  K+ +    +     L+++  +GE  N E  +W+H      +C + ++W QTE G    +P     R +    E   +     + G +   +D +  VV      G   +     P  A+T+Y +H+RF+  YF  YPGYY T D A        +I  R D++I+++  R+    + +A   +P +   +++     IKG   F F++  +  A  +  +V+E    V   + + A  ++ +VV ++PK+ +GK ++  L  +I  +
Sbjct:   58 YPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSP-ESVALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHC-PTVQHVLVAHRTDNK--VHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGA---PTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAP-----RPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAW-PGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVKD-SAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSE 655          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 226.483 bits (576), Expect = 8.100e-62
Identity = 172/642 (26.79%), Postives = 293/642 (45.64%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPY--------VSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVY-----------DLPDYEPAV----------LVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVH---DKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGY-------IGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            +  ++  SV  P  FW + AK+  W  P           + +GK F   +W  G   N+CYN LD+ + E   GD+ A  +E     +    TY++LL  V   + ++  K GI+ GD V I+MP+IPE ++AMLACARIGA++S  F GF+ + +  RI      L+ T++     ++++N K+  D A++     G  V+ C+V            D     P +            +G D  W+  + +   + +P    ++ P F++YTSG+TG  KG+V   GG  +    +          + F+C +   WI G S + YGPL +   +++++  PT    +  +  I+  +KV      PT +RL  KF +    ++    L+ +  +GE  N E   W H      +C + +++ QTE G    +P  G             + + PG        +   +  ESG  L    +G  V K P  P   +T+Y NHERF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+   +      K + +E  K +   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   47 YRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFI--EWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPT-YPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPG------------ATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPK-LTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKI 670          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 223.016 bits (567), Expect = 1.420e-60
Identity = 174/655 (26.56%), Postives = 292/655 (44.58%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPY--------VSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVY-----------DLPDYEPAVLVRGRDFN--WNSEILKVQPQ----------------------KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVH---DKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGY-------IGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            +  ++  SV  P  FW + AK+  W  P           + +GK F   +W  G   N+CYN LD+ + E   GD+ A  +E     +    TY++LL  V   + ++  K GI+ GD V I+MP+IPE ++AMLACARIGA++S  F GF+ + +  RI      L+ T++     ++++N K+  D A++     G  V+ C+V            D     P +     D       +  +VQPQ                      +P    ++ P F++YTSG+TG  KG+V   GG  +    +          + F+C +   WI G S + YGPL +   +++++  PT    +  +  I+  +KV      PT +RL  KF +    ++    L+ +  +GE  N E   W H      +C + +++ QTE G    +P  G             + + PG        +   +  ESG  L    +G  V K P  P   +T+Y NHERF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+   +      K + +E  K +   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   47 YRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFI--EWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQGKLKEKSKRVQPQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPT-YPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPG------------ATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPK-LTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKI 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 189.889 bits (481), Expect = 4.606e-50
Identity = 172/636 (27.04%), Postives = 293/636 (46.07%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSP-----KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTR-KEIINYKKRMDLAIEL-SGLDVKFCVV--------------YDLP--DYEPAVLVRGRDFNWNSEILKVQPQKPRPVK---SDHPSFVIYTSGTTGDSKGLVIETGGLC----VVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCN--IEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMING 3158
            +  +Y SS+ + D FW   + ++ + +     +E  +         K+  G + N+ YNCL++ I+ G+G++ A I+E         +TYNEL   V   + ++    G++ GD V +++P+IPE  +AMLACARIGA++S  F GF+ + ++ R+   + +++ T++ GV R  + I  K   D A  L S  DVK   +               +LP  DY    ++      ++SE+LK       PV+   S+ P F++YTSG+TG  KG+   T G        +K++ +A       + ++C +   WI G S L YGPLM+    I Y+  PT  +    +  +   + V  L   PT  R      N  +E    KT  LK I  +GE  N     W++ +       + +++ QTE G    + CL      +    G  +    G    ++D E  V+   GE G         P   + +Y + +RF+K Y + + GYY T D A  D D  + I  R D++++V+   +    +  A + +  +   ++VA    IKG  P+ F+   N      +++V E  K V   +G +A  +     P +PK+ +GK  +  L  +  G
Sbjct:   40 YHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL-RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTAD-GVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVI------YDSEMLKCAGVD-SPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQE----DDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTP-SRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKT--LKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMIT-CL---PGATPMKPGAAAMPFFGASPVLLDAEGRVIEGPGE-GSLCFDRAW-PGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVT-LNVGERINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEG 652          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 189.889 bits (481), Expect = 4.606e-50
Identity = 172/636 (27.04%), Postives = 293/636 (46.07%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSP-----KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTR-KEIINYKKRMDLAIEL-SGLDVKFCVV--------------YDLP--DYEPAVLVRGRDFNWNSEILKVQPQKPRPVK---SDHPSFVIYTSGTTGDSKGLVIETGGLC----VVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCN--IEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMING 3158
            +  +Y SS+ + D FW   + ++ + +     +E  +         K+  G + N+ YNCL++ I+ G+G++ A I+E         +TYNEL   V   + ++    G++ GD V +++P+IPE  +AMLACARIGA++S  F GF+ + ++ R+   + +++ T++ GV R  + I  K   D A  L S  DVK   +               +LP  DY    ++      ++SE+LK       PV+   S+ P F++YTSG+TG  KG+   T G        +K++ +A       + ++C +   WI G S L YGPLM+    I Y+  PT  +    +  +   + V  L   PT  R      N  +E    KT  LK I  +GE  N     W++ +       + +++ QTE G    + CL      +    G  +    G    ++D E  V+   GE G         P   + +Y + +RF+K Y + + GYY T D A  D D  + I  R D++++V+   +    +  A + +  +   ++VA    IKG  P+ F+   N      +++V E  K V   +G +A  +     P +PK+ +GK  +  L  +  G
Sbjct:   40 YHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL-RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTAD-GVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVI------YDSEMLKCAGVD-SPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQE----DDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTP-SRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKT--LKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMIT-CL---PGATPMKPGAAAMPFFGASPVLLDAEGRVIEGPGE-GSLCFDRAW-PGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVT-LNVGERINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEG 652          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 189.119 bits (479), Expect = 5.609e-50
Identity = 172/636 (27.04%), Postives = 293/636 (46.07%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSP-----KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTR-KEIINYKKRMDLAIEL-SGLDVKFCVV--------------YDLP--DYEPAVLVRGRDFNWNSEILKVQPQKPRPVK---SDHPSFVIYTSGTTGDSKGLVIETGGLC----VVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCN--IEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMING 3158
            +  +Y SS+ + D FW   + ++ + +     +E  +         K+  G + N+ YNCL++ I+ G+G++ A I+E         +TYNEL   V   + ++    G++ GD V +++P+IPE  +AMLACARIGA++S  F GF+ + ++ R+   + +++ T++ GV R  + I  K   D A  L S  DVK   +               +LP  DY    ++      ++SE+LK       PV+   S+ P F++YTSG+TG  KG+   T G        +K++ +A       + ++C +   WI G S L YGPLM+    I Y+  PT  +    +  +   + V  L   PT  R      N  +E    KT  LK I  +GE  N     W++ +       + +++ QTE G    + CL      +    G  +    G    ++D E  V+   GE G         P   + +Y + +RF+K Y + + GYY T D A  D D  + I  R D++++V+   +    +  A + +  +   ++VA    IKG  P+ F+   N      +++V E  K V   +G +A  +     P +PK+ +GK  +  L  +  G
Sbjct:   30 YHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL-RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTAD-GVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVI------YDSEMLKCAGVD-SPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQE----DDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTP-SRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKT--LKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMIT-CL---PGATPMKPGAAAMPFFGASPVLLDAEGRVIEGPGE-GSLCFDRAW-PGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVT-LNVGERINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEG 642          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: W01A8.6 (pep chromosome:WBcel235:I:7070649:7074733:-1 gene:WBGene00012168.1 transcript:W01A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W01A8.6)

HSP 1 Score: 132.109 bits (331), Expect = 8.168e-33
Identity = 85/260 (32.69%), Postives = 135/260 (51.92%), Query Frame = 3
Query:  633 YLTWDEFENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKLGENI----QAPNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLEN--RFWRKNRQ---------LNVDSNCTGVDINRNYPIGFTEN----NDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLY--VSLHCYGQFILLPWAY-KNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVGTPGELL 1346
            Y  W +FE++I+ +     S V++  +G++ E R +  +++G+      +   V LD G+HAREW +    V  I+ ++N      +D + K  +   +IY  PVLNPDG+ +S  S     R WRKNR             D  C GVD+NRNY IGF+      N+PC ++F G  PF+  E++++R  + S +   +LY  VS+H +GQ  +LP+ Y K     D  +L  LAN     +F      ++VGT  ++L
Sbjct:   35 YNDWPQFEDYIKGVAHDNPSFVQLKTIGRTREGRPLLGVRIGKPALPGKRKIAVWLDGGNHAREWPAFHVAVYFIEKLVNGYLS--DDKITK-YVETLDIYVFPVLNPDGFVYSRTSTRAMIRQWRKNRAPENCTGTGPFQTDICCEGVDLNRNYDIGFSHKNYPFNNPCSDEFQGPRPFSEPETRAVRDFIMSSEIYGRLYALVSMHTHGQLWILPYNYQKRTYPQDIKDLEILANRAADRVFAYRETKYRVGTAADML 291          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: Y59C2A.1 (pep chromosome:WBcel235:II:2208112:2212863:1 gene:WBGene00021984.1 transcript:Y59C2A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59C2A.1)

HSP 1 Score: 131.339 bits (329), Expect = 4.218e-32
Identity = 75/262 (28.63%), Postives = 140/262 (53.44%), Query Frame = 3
Query:  591 KKFLRIKRSEDDEKYLTWDEFENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKL----GENIQAPNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSN--CTGVDINRNYPIGFTE---NNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVGTPGELLY 1349
            K+ ++  +  D   Y +++E   ++++L   ++ +V++  +  S E R+IY +K+        + P++++D+G HAREW++ A  +  I+ I+ +    G +      L+K++ Y +P +NPDGY +S  +  +R WRK R  NV  N  C G D NRN+   + E   N  PC   + G  P++  E + L++  +   +N  +Y+SLH YGQ +L PW Y NE+  ++ +    A +  + +      ++  GT  E++Y
Sbjct:  133 KRAMKTWQEFDTNAYHSYNEMVEFMKLLSEQKSDMVEMVKVATSSEGRSIYGVKIHPPGPSPPEKPSIIVDAGVHAREWIAPAVGLFMIRKIVEEY---GRNPQVTANLQKFDWYIMPQVNPDGYEYSRTT--DRLWRKTRSKNVTVNRWCVGADANRNWGYRWGEAGANRTPCSNIYMGSHPYSEPEIRGLKEFFTWQITNPMVYISLHSYGQLLLSPWGYTNERTENYQDQQNAAKEAAQAIKNTTGVSYSYGTISEMMY 389          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0346110)

HSP 1 Score: 377.867 bits (969), Expect = 3.645e-117
Identity = 218/654 (33.33%), Postives = 349/654 (53.36%), Query Frame = 3
Query: 1326 GTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDV-KFCVVYDLPDYEPAV--LVRGRDFNWNSEILKV----QPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF--LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCP--GYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGYQPSYP 3254
            G P E     +   Y  SV NP  FW E    + W +P+  +++    P  KW+VGG LN CYN +D+ I  G G   A+I++SP++  ++  TY EL   + L+AG +  K G+  GD V I+MP+IPE +IAMLA  R+GA++S  FGGFA +E+  RI H +PKLV  SNVGV   +++ Y   +  AI +S     +  +++   +  P    L    D  W S+ILK+    +P    P++++ P +++YTSGTT   KG++   GG  V   +++    G+ P  T++  S   W++G S +CYGPL     +++Y+ +P       +  RI+  ++V ++   PT  R+ R+      +  +     L++I + GE  + ET  W+   F+  V N W QTE G+  T+ CLGF+++ S       ST  P  GY  KI+ +  G      E GR  LKLPL P    TLY+N E F  LYF ++PGYYDTMD+   D    + + +RDD++I+VA  R+   ++ +A L++PD+  V++  + +  KG VP    +P         ++  E +K + + VG +A+F     V  +P++ +GKT++ ++      +   +PA  DD  V+  I   L + GY  + P
Sbjct:   18 GMPVEAHDPLYLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLW-SDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLS---PPTYSTGLPLMGYDVKIL-KADGSEAQTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0084606)

HSP 1 Score: 377.867 bits (969), Expect = 3.645e-117
Identity = 218/654 (33.33%), Postives = 349/654 (53.36%), Query Frame = 3
Query: 1326 GTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDV-KFCVVYDLPDYEPAV--LVRGRDFNWNSEILKV----QPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF--LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCP--GYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGYQPSYP 3254
            G P E     +   Y  SV NP  FW E    + W +P+  +++    P  KW+VGG LN CYN +D+ I  G G   A+I++SP++  ++  TY EL   + L+AG +  K G+  GD V I+MP+IPE +IAMLA  R+GA++S  FGGFA +E+  RI H +PKLV  SNVGV   +++ Y   +  AI +S     +  +++   +  P    L    D  W S+ILK+    +P    P++++ P +++YTSGTT   KG++   GG  V   +++    G+ P  T++  S   W++G S +CYGPL     +++Y+ +P       +  RI+  ++V ++   PT  R+ R+      +  +     L++I + GE  + ET  W+   F+  V N W QTE G+  T+ CLGF+++ S       ST  P  GY  KI+ +  G      E GR  LKLPL P    TLY+N E F  LYF ++PGYYDTMD+   D    + + +RDD++I+VA  R+   ++ +A L++PD+  V++  + +  KG VP    +P         ++  E +K + + VG +A+F     V  +P++ +GKT++ ++      +   +PA  DD  V+  I   L + GY  + P
Sbjct:   18 GMPVEAHDPLYLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLW-SDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLS---PPTYSTGLPLMGYDVKIL-KADGSEAQTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0333126)

HSP 1 Score: 249.21 bits (635), Expect = 2.917e-70
Identity = 185/629 (29.41%), Postives = 297/629 (47.22%), Query Frame = 3
Query: 1347 YLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPY---------VSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKI-KYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRM-DLA---IELSGLDVKFCVVYD--------LPDY--EPAVLVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            + +++  Y  S+ NP  FW+  AKQ  W  P           +I +G    S KW  G   NLCYN LD+ +  G GD+ A  +E        +  TY +LL+ V   A ++ +  GI  GD V I+MP+I E  IAMLACARIGAV+S  F GF+   ++ R+   + KL+ T++ G  R E   Y K + D A   +E  G  V+ C+V           PD+  E       RD+ W+ E+   +P   P  + ++ P F++YTSG+TG  KG++  T G  + +  +        P + ++C     WI G + + YGPL +   ++I++  P    +      ++  +KV      PT +R   KF      ++    LK +  +GE  N E   W +    K QC + +++ QTE G    +P  G     +    G  S    G    ++D E G+ +    +G  V   P  P   +TLY NHERF   YFS++PGYY T D A  D D  + I  R D++++V+   +    V     ++P +   ++V+   P+KG   + F+ P+  +    K ++ +  K V   +G  A  +     P +PK+ +GK ++  L  +
Sbjct:   23 FEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPI--SIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITAD-GAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN-DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPG----ATPMKPGSASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQK-LISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKI 639          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078413)

HSP 1 Score: 249.21 bits (635), Expect = 2.917e-70
Identity = 185/629 (29.41%), Postives = 297/629 (47.22%), Query Frame = 3
Query: 1347 YLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPY---------VSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKI-KYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRM-DLA---IELSGLDVKFCVVYD--------LPDY--EPAVLVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            + +++  Y  S+ NP  FW+  AKQ  W  P           +I +G    S KW  G   NLCYN LD+ +  G GD+ A  +E        +  TY +LL+ V   A ++ +  GI  GD V I+MP+I E  IAMLACARIGAV+S  F GF+   ++ R+   + KL+ T++ G  R E   Y K + D A   +E  G  V+ C+V           PD+  E       RD+ W+ E+   +P   P  + ++ P F++YTSG+TG  KG++  T G  + +  +        P + ++C     WI G + + YGPL +   ++I++  P    +      ++  +KV      PT +R   KF      ++    LK +  +GE  N E   W +    K QC + +++ QTE G    +P  G     +    G  S    G    ++D E G+ +    +G  V   P  P   +TLY NHERF   YFS++PGYY T D A  D D  + I  R D++++V+   +    V     ++P +   ++V+   P+KG   + F+ P+  +    K ++ +  K V   +G  A  +     P +PK+ +GK ++  L  +
Sbjct:   23 FEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPI--SIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITAD-GAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN-DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPG----ATPMKPGSASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQK-LISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKI 639          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078414)

HSP 1 Score: 191.045 bits (484), Expect = 1.468e-51
Identity = 145/506 (28.66%), Postives = 236/506 (46.64%), Query Frame = 3
Query: 1698 MPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRM-DLA---IELSGLDVKFCVVYD--------LPDY--EPAVLVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKR----STSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            MP+I E  IAMLACARIGAV+S  F GF+   ++ R+   + KL+ T++ G  R E   Y K + D A   +E  G  V+ C+V           PD+  E       RD+ W+ E+   +P   P  + ++ P F++YTSG+TG  KG++  T G  + +  +        P + ++C     WI G + + YGPL +   ++I++  P    +      ++  +KV      PT +R   KF      ++    LK +  +GE  N E   W +    K QC + +++ QTE G    +P  G       S S    G + TL           E G+ +    +G  V   P  P   +TLY NHERF   YFS++PGYY T D A  D D  + I  R D++++V+   +    V     ++P +   ++V+   P+KG   + F+ P+  +    K ++ +  K V   +G  A  +     P +PK+ +GK ++  L  +
Sbjct:    1 MPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITAD-GAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN-DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLL---------DECGIEIKGEGEGYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQK-LISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKI 493          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 426.402 bits (1095), Expect = 6.839e-136
Identity = 226/632 (35.76%), Postives = 360/632 (56.96%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSIN------LIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +E  +  +   PD FW+EAA  +TW + +   ++      PKWFVGG+LN+CYN +D+ +E G GD+ AVIY+SPV+   +  TY E+ + V  +AG++V K G++ GD V I+MP++P+ +  MLACARIGA +S  FGGFA KE+S RI+H +PKL+ T++ G+    ++ Y   ++ A+ELS       ++Y+ P  E          +W  E+   +P     V + HP +V+YTSGTTG  KG+V ++GG  V+  ++M+   GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R++  H    +   PT +R  R+    +D + +   L  +N      + GE  + ET++W    F   V + W QTE G+  T+ C+G   S +    G      PGY   ++D +   V P    G  V+KLPL P AA +L++NH  F +LYF+++ GYYDTMD+  +D +  + I++R D++I+VA  R+   A+ E+ L +P +   ++V LED +KG VP    +  N       ++VK  VK V +T+G VA+F +   V  +PK+ +GK  ++SL  ++N KP+KI    +D EV+  I  +L+ S
Sbjct:    2 YEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPKGVVRDSGGYAVMLNWTMSNVYGLAPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQ----QDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLA-PPPGTAGKPVPGYNVTVIDDDMQQVKP-RTLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKMLRES 626          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 393.275 bits (1009), Expect = 1.375e-122
Identity = 216/632 (34.18%), Postives = 343/632 (54.27%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSIN------LIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +E  +  +   PD FW+EAA  +TW + +   ++      PKWFVGG+LN+CYN +D+ +E G GD+ AVIY+SPV+   +  TY E+ + V  +AG++V K G++ GD V I+MP++P+ +  MLACARIGA +S  FGGFA KE+S RI+H +PKL+ T++ G+    ++ Y   ++ A+ELS       ++Y+ P  E          +W  E+   +P     V + HP +V+YTSGTTG  K                            ++  S   W++G S +CYGPL+  N T++Y+ +P          R++  H    +   PT +R  R+    +D + +   L  +N      + GE  + ET++W    F   V + W QTE G+  T+ C+G   S +    G      PGY   ++D +   V P    G  V+KLPL P AA +L++NH  F +LYF+++ GYYDTMD+  +D +  + I++R D++I+VA  R+   A+ E+ L +P +   ++V LED +KG VP    +  N       ++VK  VK V +T+G VA+F +   V  +PK+ +GK  ++SL  ++N KP+KI    +D EV+  I  +L+ S
Sbjct:   84 YEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPK---------------------------VWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQ----QDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAP-PPGTAGKPVPGYNVTVIDDDMQQVKP-RTLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKMLRES 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss1 (acyl-CoA synthetase short chain family member 1 [Source:ZFIN;Acc:ZDB-GENE-050320-139])

HSP 1 Score: 242.662 bits (618), Expect = 1.163e-67
Identity = 170/613 (27.73%), Postives = 295/613 (48.12%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQ-VTWTKPY-----VSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQK--PRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERS-----HLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLE 3143
            ++  +Y  SV +P+ FW   AK+ + WTKP+       I  GK      WF+GG+LN+  NCLD  +        A+I+E       +  TY ELL+    +A  + +  G++ G+ V I+MP+ P  + AMLACARIGAV++  F GF+ + ++ RI   Q K V T N GV    + + K  +D A++ S   V+   V    +   +V +   D     E++  Q  +  P P++S+   F++YTSG+TG  KG+V    G  + +  +        P + F C++   WI G S + YGPL +   +++++  P   +       V+ LRI + +        PT +RL  K+      +     LK++  +GE  N E  DW H+     +C + ++W QTE G    +P      +        +     G   +++  +  ++      G   +  P  P  A+T++ +H+RF+  YF  Y G Y T D A    D   +I  R D++I+++  R+    + +A  ++PD+   +++ +   IKG VPF F++     A   + +V E    V + + + A  +  +VV ++PK+ +GK ++  L 
Sbjct:   61 NYADLYELSVKDPENFWGSIAKERLAWTKPFDQVSDCDISSGKI----NWFLGGQLNVSVNCLDVHVAN-DPSRVALIWEKDEPGTEERITYRELLEMTCRLANTL-KSHGVQRGERVAIYMPVSPMAVAAMLACARIGAVHTVVFAGFSSEALAGRIQDAQCKFVITCNQGVRGGRVFDLKSTVDKAVK-SCPSVRHVFVAKRTNN--SVPMGKLDIPLE-EVMAGQSSECAPEPMESEEMLFMLYTSGSTGKPKGIVHTQAGYLLYASLTHQYVFDYTPGDVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNPGRYWETVQRLRINQFYGA------PTAIRLLLKYEESWVKKYDRSSLKTLASVGEPINHEAWDWFHNVVGDGRCPLVDTWWQTETGGVCIAPLPAEPGAEIRPAMAMRPFF--GIKPELLGEKGQIITGNDVNGALCISQPW-PGMARTIFGDHQRFVDAYFKPYQGQYFTGDGAYRTEDGYYQITGRMDDVINISGHRLGTAEIEDALDEHPDVPETAVIGIPHEIKGEVPFAFVVLKESAAENQQAVVNELRHLVASKIAKYAVPDHFLVVKRLPKTRSGKIMRRILR 654          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 215.698 bits (548), Expect = 1.633e-58
Identity = 173/641 (26.99%), Postives = 294/641 (45.87%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVS--------IIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVYD--------------------LPD----YEPAVLVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPH---NYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            ++ +Y  SV +P+ FW + AK   W   Y          + +G+ +   K   G   N+CYN LD+ + E   GD  A  +E       K  TY ELL+ V   A ++  + G++ GD V I+MP++ E ++AMLACARIGAV+S  F GF+ + +  RI   Q  L+ T++      ++IN K   D A++        V+ C++                       PD    + P V     D  W+S I     + +P    S+ P F++YTSG+TG  KG++    G  + +  +          + ++C +   WI G S + YGPL +   +++++  PT    +  +  I+  + V      PT +RL  K+ +    + K   LK +  +GE  N E   W ++   + +C V +++ QTE G    +P      + +    G  +    G +  I++ ESG  L    +G  V K P  P   +T+Y NH RF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+  +   NY+     E+ K+    V   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   30 YKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYI--KCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQVPWNPEV-----DMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPT-YPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPL----PAATPMKPGSATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLNDGINYNQKLEAELKKQ----VREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKI 651          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 211.075 bits (536), Expect = 6.903e-57
Identity = 173/652 (26.53%), Postives = 294/652 (45.09%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVS--------IIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVY-----------------------DLPDYEPAVLVRGR------------DFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPH---NYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            ++ +Y  SV +P+ FW + AK   W   Y          + +G+ +   K   G   N+CYN LD+ + E   GD  A  +E       K  TY ELL+ V   A ++  + G++ GD V I+MP++ E ++AMLACARIGAV+S  F GF+ + +  RI   Q  L+ T++      ++IN K   D A++        V+ C++                        DL   +    VR              D  W+S I     + +P    S+ P F++YTSG+TG  KG++    G  + +  +          + ++C +   WI G S + YGPL +   +++++  PT    +  +  I+  + V      PT +RL  K+ +    + K   LK +  +GE  N E   W ++   + +C V +++ QTE G    +P      + +    G  +    G +  I++ ESG  L    +G  V K P  P   +T+Y NH RF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+  +   NY+     E+ K+    V   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   30 YKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYI--KCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQQEKQKERVRKVRPPPQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPT-YPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPL----PAATPMKPGSATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLNDGINYNQKLEAELKKQ----VREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKI 667          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 452.21 bits (1162), Expect = 1.568e-144
Identity = 235/632 (37.18%), Postives = 370/632 (58.54%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENK-------TEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILK 3227
            ++E ++ SSV  P+  W EAA  + W KP+  I++    P  KWF+ GELN+CYN +D+ IE G GD+ A+IY+SPV+   +  TY E+ + V  +A ++  K G++ GD V I+MP+IP+   AMLACARIGA++S  FGGFA KE++VRI+H +PKL+ T++ G+     + Y   ++ A+E++    +  V+Y  P+ +   L  GRD +W  EI K  P    PV S+HP +V+YTSGTTG  KG+V  + G  V+  ++M++  GL P + ++  S   W++G S +CYGPL+  N +++Y+ +P          R+L  H V A+   PT +R  R+    +D E +       T+F +++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S      G      PGY  KI+D +     P    G  V+KLPL P A  TL++N   F  LYF+++PGYYDTMD+   D D  + +LSR D++I+VA  R+   A+ E+ L +  +   ++V LEDP+KG VP    +  N      ++I  E V  V   +G VA+F + V+V ++PK+ +GK  +++L A++NGK +KI +  +D +V+  + D +K
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQ----QDPEAELGKPFSLTKF-RTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPA-GQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAVK 709          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 446.817 bits (1148), Expect = 2.362e-142
Identity = 231/620 (37.26%), Postives = 362/620 (58.39%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENK-------TEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDD 3191
            ++E ++ SSV  P+  W EAA  + W KP+  I++    P  KWF+ GELN+CYN +D+ IE G GD+ A+IY+SPV+   +  TY E+ + V  +A ++  K G++ GD V I+MP+IP+   AMLACARIGA++S  FGGFA KE++VRI+H +PKL+ T++ G+     + Y   ++ A+E++    +  V+Y  P+ +   L  GRD +W  EI K  P    PV S+HP +V+YTSGTTG  KG+V  + G  V+  ++M++  GL P + ++  S   W++G S +CYGPL+  N +++Y+ +P          R+L  H V A+   PT +R  R+    +D E +       T+F +++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S      G      PGY  KI+D +     P    G  V+KLPL P A  TL++N   F  LYF+++PGYYDTMD+   D D  + +LSR D++I+VA  R+   A+ E+ L +  +   ++V LEDP+KG VP    +  N      ++I  E V  V   +G VA+F + V+V ++PK+ +GK  +++L A++NGK +K+   +D 
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQ----QDPEAELGKPFSLTKF-RTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPA-GQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKVIQFTDS 697          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 439.884 bits (1130), Expect = 5.098e-140
Identity = 231/621 (37.20%), Postives = 360/621 (57.97%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENK-------TEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDH 3194
            ++E ++ SSV  P+  W EAA  + W KP+  I++    P  KWF+ GELN+CYN +D+ IE G GD+ A+IY+SPV+   +  TY E+ + V  +A ++  K G++ GD V I+MP+IP+   AMLACARIGA++S  FGGFA KE++VRI+H +PKL+ T++ G+     + Y   ++ A+E++    +  V+Y  P+    V   GRD +W  EI K  P    PV S+HP +V+YTSGTTG  KG+V  + G  V+  ++M++  GL P + ++  S   W++G S +CYGPL+  N +++Y+ +P          R+L  H V A+   PT +R  R+    +D E +       T+F +++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S      G      PGY  KI+D +     P    G  V+KLPL P A  TL++N   F  LYF+++PGYYDTMD+   D D  + +LSR D++I+VA  R+   A+ E+ L +  +   ++V LEDP+KG VP    +  N      ++I  E V  V   +G VA+F + V+V ++PK+ +GK  +++L A++NGK +K  +    H
Sbjct:   82 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNM---VCNAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQ----QDPEAELGKPFSLTKF-RTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPA-GQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKAASPQAAH 691          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 439.113 bits (1128), Expect = 1.662e-139
Identity = 229/620 (36.94%), Postives = 362/620 (58.39%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENK-------TEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDD 3191
            ++E ++ SSV  P+  W EAA  + W KP+  I++    P  KWF+ GELN+CYN +D+ IE G GD+ A+IY+SPV+   +  TY E+ + V  +A ++  K G++ GD V I+MP+IP+   AMLACARIGA++S  FGGFA KE++VRI+H +PKL+ T++ G+     + Y   ++ A+E++    +  V+Y  P+ +   L  GRD +W  EI K  P    PV S+HP +V+YTSGTTG  KG+V  + G  V+  ++M++  GL P + ++  S   W++G S +CYGPL+  N +++Y+ +P          R+L  H V A+   PT +R  R+    +D E +       T+F +++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S      G      PGY GK   R+  ++L       + L+LPL P A  TL++N   F  LYF+++PGYYDTMD+   D D  + +LSR D++I+VA  R+   A+ E+ L +  +   ++V LEDP+KG VP    +  N      ++I  E V  V   +G VA+F + V+V ++PK+ +GK  +++L A++NGK +K+   +D 
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQ----QDPEAELGKPFSLTKF-RTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPA-GQAGKPVPGYNGKQNLRK--LLL-----ATYPLRLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKVIQFTDS 691          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 417.542 bits (1072), Expect = 1.266e-131
Identity = 223/620 (35.97%), Postives = 348/620 (56.13%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENK-------TEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDD 3191
            ++E ++ SSV  P+  W EAA  + W KP+  I++    P  KWF+ GELN+CYN +D+ IE G GD+ A+IY+SPV+   +  TY E+ + V  +A ++  K G++ GD V I+MP+IP+   AMLACARIGA++S  FGGFA KE++VRI+H +PKL+ T++ G+     + Y   ++ A+E++    +  V+Y  P+ +   L  GRD +W  EI K  P    PV S+HP +V+YTSGTTG                          +P+  ++  S   W++G S +CYGPL+  N +++Y+ +P          R+L  H V A+   PT +R  R+    +D E +       T+F +++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S      G      PGY  KI+D +     P    G  V+KLPL P A  TL++N   F  LYF+++PGYYDTMD+   D D  + +LSR D++I+VA  R+   A+ E+ L +  +   ++V LEDP+KG VP    +  N      ++I  E V  V   +G VA+F + V+V ++PK+ +GK  +++L A++NGK +K+   +D 
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTG--------------------------LPK-VWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQ----QDPEAELGKPFSLTKF-RTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPA-GQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKVIQFTDS 670          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 464.922 bits (1195), Expect = 6.930e-150
Identity = 241/647 (37.25%), Postives = 387/647 (59.81%), Query Frame = 3
Query: 1305 GNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGF-LMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            G +    G+ GE     ++  + +SV +P+ FW +AA+Q++W KP+   +E +Y PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+      +Y E+L+ V  +AG++V K G++ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+ +        ++Y  P+ E   L+ GRD +W  E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  ++M++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S +    G      PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  + ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    ++  + +AS+ +++++E VK+V  ++G VA+F  AV V ++PK+ +GK  +++L A++NGKP+K+    +D  ++  I ++LK++
Sbjct:   45 GCRALTTGSGGE-----YKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPP-PGQAGKCVPGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASE-EQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 328.176 bits (840), Expect = 1.428e-100
Identity = 168/454 (37.00%), Postives = 263/454 (57.93%), Query Frame = 3
Query: 1305 GNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVL 2657
            G +    G+ GE     ++  + +SV +P+ FW +AA+Q++W KP+   +E +Y PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+      +Y E+L+ V  +AG++V++ G++ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+ +        ++Y  P+ E   L+ GRD +W  E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  ++M++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S +    G      PGY G+ +   S   L
Sbjct:   45 GCRALTTGSGGE-----YKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLVKQ-GVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPP-PGQAGKCVPGYNGRYLLHHSAESL 490          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss1 (acyl-CoA synthetase short-chain family member 1 [Source:MGI Symbol;Acc:MGI:1915988])

HSP 1 Score: 247.669 bits (631), Expect = 1.692e-69
Identity = 169/610 (27.70%), Postives = 298/610 (48.85%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQ-VTWTKPYVSIIEGKYFPSP-KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPT--ERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGK 3161
            + A+   +   P  FW   A+  + W  PY ++ +  +      WF+GG+LN+  NCLD+ +++   +  A+I+E          TY ELL++   +A  + ++ G+  GD V I+MP+ P  + AMLACARIGA+++  F GF+ + ++ RIN  + K V T N G+    ++  KK +D A++ S   V+  +V    D +  V +   D     E+ K  P   P  + S+   F++YTSG+TG  KGLV    G  + +  +        P + F C++   WI G S + YGPL +   T++++  P   +     E ++ LK ++       PT +RL  K+ +    +     L+++  +GE  N E  +W+H      +C + ++W QTE G    +P      +  + G   +     G +  ++D E G VL  G+    +      P  A+T+Y +H+RF+  YF  YPGYY T D A        +I  R D++I+++  R+    + +A   +P +   +++     IKG   F F++  + + S    +V E    V   + + A  +Q +VV ++PK+ +GK ++  L  +I  +
Sbjct:   51 YPALSAQAAQEPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHVQKSP-ETIALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAVK-SCPTVQHVLVAHRTDTK--VPMGSLDIPLEQEMAKEAPVCTPESMSSEDMLFMLYTSGSTGTPKGLVHTQAGYLLYAAMTHKLVFDYQPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYPDAGRYWETVQRLKINQFYG---APTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINHEAWEWLHKVVGDGRCTLVDTWWQTETGGICIAPRPSEDGAEILPGMAMRPFF--GIVPVLMD-EKGNVLEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITGRMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKD-NISDENMVVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSR 648          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 224.172 bits (570), Expect = 3.320e-61
Identity = 170/638 (26.65%), Postives = 291/638 (45.61%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTK----PYVS----IIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVY-----------DLPDYEPAV----------LVRGRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVH---DKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLM---PHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            +  ++  SV  P  FW   AK+  W      P++     + +GK F   +W  G   N+CYN LD+ + E   GD+ A  +E     +    TY ELL  V   + ++  K GI+ GD V I+MP+I E ++AMLACAR+GA++S  F GF+ + +  RI      L+ T++     ++++N K+  D ++E     G  V+ C+V            D P   P V             G D  W+  + +   + +P    ++ P F++YTSG+TG  KG+V   GG  +    +        P + F+C +   WI G S + YGPL +   +++++  PT       +  I+  +KV      PT +R+  KF +    ++    L+ +  +GE  N E   W H      +C + +++ QTE G    +P  G     +    G  S    G    I++     +     +G  V K P  P   +T+Y NH RF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+     H +  +  +E+ K+    +   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   47 YRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFT--EWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDE-GRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPG----ATPMKPGSASFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQ----IREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKI 670          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 219.55 bits (558), Expect = 1.606e-59
Identity = 171/651 (26.27%), Postives = 293/651 (45.01%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTK----PYVS----IIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVY-----------DLPDYEPAV----------------LVR-------GRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVH---DKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLM---PHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            +  ++  SV  P  FW   AK+  W      P++     + +GK F   +W  G   N+CYN LD+ + E   GD+ A  +E     +    TY ELL  V   + ++  K GI+ GD V I+MP+I E ++AMLACAR+GA++S  F GF+ + +  RI      L+ T++     ++++N K+  D ++E     G  V+ C+V            D P   P V                 +R       G D  W+  + +   + +P    ++ P F++YTSG+TG  KG+V   GG  +    +        P + F+C +   WI G S + YGPL +   +++++  PT       +  I+  +KV      PT +R+  KF +    ++    L+ +  +GE  N E   W H      +C + +++ QTE G    +P  G     +    G  S    G    I++     +     +G  V K P  P   +T+Y NH RF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+     H +  +  +E+ K+    +   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   47 YRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFT--EWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQGKLREKSKCIRPQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDE-GRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPG----ATPMKPGSASFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQ----IREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKI 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A0A0G2K047|ACSS3_RAT (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acss3 PE=1 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 7.916e-150
Identity = 236/630 (37.46%), Postives = 379/630 (60.16%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E +Y PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+      +Y E+L+ V  +AG++V K G++ GD V I+MP+IP+ + AMLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+ +        ++Y+ P+ E   L+ GRD +W  E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  ++M++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S +    G      PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  + ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    +      +  +++++E VK+V  ++G VA+F  AV V ++PK+ +GK  +++L A++NGKP+K+    +D  ++  I ++LK++
Sbjct:   57 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYAMLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEALRIGQHKPDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPP-PGQAGKCVPGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVTDCAVVGKEDPLKGHVPLALCVLKKDVNATEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q9H6R3|ACSS3_HUMAN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.027e-149
Identity = 239/631 (37.88%), Postives = 385/631 (61.01%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRS-TSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E K+ PS +WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+     +TY E+L+ V  +AG++V K GI+ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+++        ++Y+ P+ E   L  GRD +W+ E+ K Q     PV S+HP +++YTSGTTG  KG++  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W  + F+  V + W QTE G+  T+ C+G   S T   G+  +S   PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  + ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    +      +  +++++E VK+V   +G VA+F  AV V ++PK+ +GK  +++L A++NGKP+KI +  +D  ++  + ++LK++
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSV--PGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q5REB8|ACSS3_PONAB (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii OX=9601 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.297e-149
Identity = 240/631 (38.03%), Postives = 384/631 (60.86%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRS-TSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E K+ PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+     +TY E+L+ V  +AG++V K GI+ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+++        ++Y+ P+ E   L  GRD +W+ E+ K Q     PV S+HP +++YTSGTTG  KG++  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W  + F+  V + W QTE G+  T+ C+G   S T   G+  +S   PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  V ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    +      +  +++++E VK+V   +G VA+F  AV V ++PK+ +GK  +++L A++NGKP+KI +  +D  ++  + ++LK++
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTSWFVEGMLNVCYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLNWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSV--PGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q14DH7|ACSS3_MOUSE (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus OX=10090 GN=Acss3 PE=1 SV=2)

HSP 1 Score: 464.922 bits (1195), Expect = 4.848e-149
Identity = 241/647 (37.25%), Postives = 387/647 (59.81%), Query Frame = 3
Query: 1305 GNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGF-LMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            G +    G+ GE     ++  + +SV +P+ FW +AA+Q++W KP+   +E +Y PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+      +Y E+L+ V  +AG++V K G++ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+ +        ++Y  P+ E   L+ GRD +W  E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  ++M++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S +    G      PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  + ++SR D++I+VA  RI   A+ E+ L +  +   ++V  EDP+KG VP    ++  + +AS+ +++++E VK+V  ++G VA+F  AV V ++PK+ +GK  +++L A++NGKP+K+    +D  ++  I ++LK++
Sbjct:   45 GCRALTTGSGGE-----YKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPP-PGQAGKCVPGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASE-EQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A7MB45|ACSS3_BOVIN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus OX=9913 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 9.909e-143
Identity = 237/631 (37.56%), Postives = 376/631 (59.59%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRS-TSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E ++ PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+      TY E+L+ V  +AG++V K G++ GD V I+MP+IP+ + AMLACARIGA++S  FGGFA KE+S RI+H +PKLV T++ G+     + Y   ++ A+ +        ++Y+ P  +   L  G   +W+ E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S T   G+  +S   PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  V ++SR D++I+VA  RI   A+ E+ L    +   ++V  ED +KG +P    +      +  + +++E VK+V  T+G VA+F +AV V ++PK+ +GK  +++L A++NGKP+K+    +D  ++  I  +LK++
Sbjct:   60 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENRHSPSTSWFVEGMLNICYNAIDRHIENGKGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLV-KHGVKKGDTVVIYMPMIPQAMYAMLACARIGAIHSLIFGGFASKELSTRIDHAKPKLVITASFGIEPGRKVEYVPLVEEALRIGQHKPDKVLIYNRPHTDMVPLAPGYYLDWDEELSKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKSV--PGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGALEESILSLGIVADCAVVGKEDSLKGHIPLALCVLKKDINTTEEHVLEEIVKHVRQTIGPVAAFRKAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVSPTIEDPGIFEHIEAMLKQA 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: W5NHM2 (Acyl-CoA synthetase short chain family member 3 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 6.450e-151
Identity = 238/628 (37.90%), Postives = 381/628 (60.67%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF--LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            ++  + +S+ +P  FW  AA+++TW KP+ + ++    P PKWFVGG+LN+CYN +D+  E G GD+TA+IY+SPV+   +++TY+E+LK V  +AG++  K G++ GD V I+MP+IP+ + AMLACARIGA +S  FGGFA KE+SVR++H +PK+V T++ G+     + Y   ++ A+EL     +  ++Y+ P+ E   +      NW+ E+    P    PV SDHP +++YTSGTTG  KG+V +TGG  V+  ++M +  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R++  H V A+   PT +R  R+         +     ++++ + GE  + ET+DW    F+  V + W QTE G+  T+ C+G   S S    G      PGY   +VD     V P    G  V+KLPL P +A TL++N + F++LYF+R+PGYYDTMD+  MD +  + I+SR D++I+VA  R+   A+ EA LQ+  +   ++V LED +KG VP    +  N   +K +++V+E V+ V  ++G VA+F + V V ++PK+ +GK  +++L A+++ K +KI    +D  V+  I DILK++
Sbjct:   11 YDEAFRTSLRDPANFWANAAQRITWFKPWSNTLDYSNPPFPKWFVGGKLNICYNAIDRHCESGRGDQTAIIYDSPVTGSKQFFTYSEVLKEVSRLAGVLA-KNGVKKGDLVVIYMPMIPQAMFAMLACARIGATHSLIFGGFASKELSVRVDHAKPKMVVTASFGIEPGRRVEYIPLVEKALELGKHKPERVLIYNRPNMETVSMAPDISLNWDEEMAAANPHDCVPVSSDHPLYILYTSGTTGTPKGVVRDTGGCAVMLNWTMASVYGLSPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAAAYFRLISEHGVTAMFTAPTAIRAIRQQDPQASLGRQYPLTRMRTLFVAGERCDVETLDWAKKIFKVPVLDHWWQTESGSPITASCIGLGNS-STPPAGQAGKAVPGYNVMVVDDNMQEVKP-RTLGNIVVKLPLPPGSASTLWQNDDLFVQLYFTRFPGYYDTMDAGFMDEERFLYIMSRSDDVINVAGHRLSTGALEEAVLQHSAVVDCAVVGLEDSLKGHVPLALCVLRNDLQTKEEDVVEEIVRLVRESIGPVAAFRKVVFVNRLPKTRSGKIPRSTLAALVSRKAYKISPTIEDPVVFKEIEDILKKN 635          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: W5NHL9 (Acyl-CoA synthetase short chain family member 3 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 3.291e-150
Identity = 238/628 (37.90%), Postives = 381/628 (60.67%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF--LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            ++  + +S+ +P  FW  AA+++TW KP+ + ++    P PKWFVGG+LN+CYN +D+  E G GD+TA+IY+SPV+   +++TY+E+LK V  +AG++  K G++ GD V I+MP+IP+ + AMLACARIGA +S  FGGFA KE+SVR++H +PK+V T++ G+     + Y   ++ A+EL     +  ++Y+ P+ E   +      NW+ E+    P    PV SDHP +++YTSGTTG  KG+V +TGG  V+  ++M +  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R++  H V A+   PT +R  R+         +     ++++ + GE  + ET+DW    F+  V + W QTE G+  T+ C+G   S S    G      PGY   +VD     V P    G  V+KLPL P +A TL++N + F++LYF+R+PGYYDTMD+  MD +  + I+SR D++I+VA  R+   A+ EA LQ+  +   ++V LED +KG VP    +  N   +K +++V+E V+ V  ++G VA+F + V V ++PK+ +GK  +++L A+++ K +KI    +D  V+  I DILK++
Sbjct:  100 YDEAFRTSLRDPANFWANAAQRITWFKPWSNTLDYSNPPFPKWFVGGKLNICYNAIDRHCESGRGDQTAIIYDSPVTGSKQFFTYSEVLKEVSRLAGVLA-KNGVKKGDLVVIYMPMIPQAMFAMLACARIGATHSLIFGGFASKELSVRVDHAKPKMVVTASFGIEPGRRVEYIPLVEKALELGKHKPERVLIYNRPNMETVSMAPDISLNWDEEMAAANPHDCVPVSSDHPLYILYTSGTTGTPKGVVRDTGGCAVMLNWTMASVYGLSPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAAAYFRLISEHGVTAMFTAPTAIRAIRQQDPQASLGRQYPLTRMRTLFVAGERCDVETLDWAKKIFKVPVLDHWWQTESGSPITASCIGLGNS-STPPAGQAGKAVPGYNVMVVDDNMQEVKP-RTLGNIVVKLPLPPGSASTLWQNDDLFVQLYFTRFPGYYDTMDAGFMDEERFLYIMSRSDDVINVAGHRLSTGALEEAVLQHSAVVDCAVVGLEDSLKGHVPLALCVLRNDLQTKEEDVVEEIVRLVRESIGPVAAFRKVVFVNRLPKTRSGKIPRSTLAALVSRKAYKISPTIEDPVVFKEIEDILKKN 724          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A4X2JVT5 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=ACSS3 PE=4 SV=1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.392e-150
Identity = 242/630 (38.41%), Postives = 380/630 (60.32%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E  +  +  WFV G LN+CYN LD+ IE G GD+ A+IY+SPV+      TY E+L+ V  +AG++V K G++ GD V I+MP+IP+ +  MLACARIGA++S  FGGFA KE+S RI+H +PK+V T++ G+     + Y   ++ A+ +     +  ++Y+ P+ E   L  GRD +W+ E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H VVAL   PT +R  R+      +    + T F K++ + GE  + ET++W  + F+  V + W QTE G+  T+ CLG   S +    G      PGY   I+D +S   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD D  + ++SR D++I+V+  RI   A+ E+ L +  +   ++V  EDP+KG VP    +      +  ++IV+E VK+V +++G VA+F  AV V ++PK+ +GK  +++L A++NGKP+K+    +D  V+  I ++LKR+
Sbjct:   63 EYKKHFAASVSDPERFWGKAAEQISWYKPWTKTLENSHPTATSWFVEGMLNICYNALDRHIENGQGDKIAIIYDSPVTNTKVTVTYKEVLEQVSKLAGVLV-KHGVQKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRRVEYVPLLEAAMRMGEHKPRRVLIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLSEHGVVALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGEHCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCLGLGNSKTPP-PGQAGKAVPGYNVMILD-DSMQKLKARTLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGFMDEDGYLYVMSRVDDVINVSGHRISASAIEESVLSHGAIADCAVVGKEDPVKGHVPLALCVLRKEVNATEEKIVEEIVKHVRDSIGPVAAFRNAVFVKQLPKTRSGKIPRSALSALVNGKPYKVSPTIEDPRVFSQIEEVLKRT 688          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: G1TA53 (Acyl-CoA synthetase short chain family member 3 OS=Oryctolagus cuniculus OX=9986 GN=ACSS3 PE=4 SV=2)

HSP 1 Score: 474.167 bits (1219), Expect = 5.918e-150
Identity = 244/631 (38.67%), Postives = 383/631 (60.70%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRK---FCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRS-TSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRS 3233
            +++  + +SV +P+ FW +AA+Q++W KP+   +E ++ PS  WFV G LN+CYN +D+ IE G GD+ A+IY+SPV+      TY E+L+ V  +AG++V K GI  GD V I+MP+IP+ + AMLACARIGA++S  FGGFA KE+S RI+H +PK++ T++ G+     + YK  ++ A+ L        ++Y+ P+ E   L  GRD +W+ E+ K Q     PV S+HP +++YTSGTTG  KG+V  TGG  V+  +SM++  GL P E ++  S   W++G S +CYGPL+  N T++Y+ +P          R+L  H V AL   PT +R  R+      +    + T F K++ + GE  + ET++W    F+  V + W QTE G+  T+ C+G   S T   G+  +S   PGY   I+D ++   L     G  V+KLPL P A   L++N E F  LYF ++PGYYDTMD+  MD +  V ++SR D++I+VA  RI   ++ E+ L +  +   ++V  EDP+KG VP    +      +  +++++E VK+V  T+G VA+F  AV V ++PK+ +GK  +N+L A++NGKP+K+  + +D  ++  I ++LKR+
Sbjct:   62 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRHPPSTSWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTDTKATITYKEVLEQVSKLAGVLV-KHGISKGDTVVIYMPMIPQAMYAMLACARIGAIHSLIFGGFASKELSSRIDHAKPKVLVTASFGIEPGRRVEYKPLIEEALRLGHHKPNKVLIYNRPNMETVPLTPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRF-KTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKSV--PGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGSLEESILSHGSVADCAVVGKEDPLKGHVPLALCVLKKDINATEEQVLEEIVKHVRQTIGPVAAFRNAVFVKQLPKTRSGKIPRNTLSALVNGKPYKVSPVIEDPNIFGQIEEVLKRA 687          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: R7U6A9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_173489 PE=4 SV=1)

HSP 1 Score: 474.552 bits (1220), Expect = 8.438e-150
Identity = 237/634 (37.38%), Postives = 377/634 (59.46%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYE---PAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKF--CNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGYQ 3242
            ++  Y  S+ NP+ FW  AA+++ W K +  +++    P  KWFVGG+LN CYN +D+ +E GHG + A+I++SPV+  I+  TY+ELL+ V L AG++  K  I+ GD V I+MP+IPE ++AMLACAR+GA++S  FGGFA KE++ RI+H  PKLV  +N GV    +I+YK+ +D A++L+      C++++   +E   PA L  GRD+++N E+    P     V+S  P++++YTSGTTG  K +V  TGG  VV  +SM    G+  RE +F  S   W++G S + Y PL+  N T++Y+ +P    +     R+L  H++VA+   PT MR  R+     I       + L+ + + GE  + ETM+W+  KF+  V ++W QTE G+  ++ C+G          G      PG+  ++V ++     P GE G  + KLPL P    TL++  +RF  LYF  +PGYYDTMDS   D D N+ +++R D++I+VA  R+    + EA L++ D+   +++ + D +KG +P G ++         +++VKE +  V   VG VASF+ ++VV ++PK+ +GK  ++++ AM+ GKP+KIP   +D  VY  I +  + SGY 
Sbjct:   69 YDDAYQRSIENPEEFWGAAAEEIVWEKKWDRVLDNDNPPFTKWFVGGKLNTCYNAVDRHVEAGHGLQVAIIHDSPVTNTIQKITYSELLEKVSLFAGVLA-KHDIQKGDRVLIYMPMIPEAIVAMLACARLGALHSLVFGGFASKELATRIDHALPKLVVGANCGVEPNRVIDYKELLDRALDLAAHKPSSCIIFNRTSHEQFSPAPLTVGRDYDYNDEMASASPHDCVAVESSDPAYLLYTSGTTGVPKAVVRPTGGHAVVLNWSMYNLYGVHKREAWFAASDLGWVVGHSYIVYAPLIHGNTTLLYEGKPVGTPNASTYYRMLTDHRIVAMFVAPTAMRALRREDPLGIHAKGYTMDDLRYMFVAGEHCDHETMEWIQAKFRTPVLDNWWQTETGSAISATCVGLGNDL-FPTPGVAGKPVPGWNLQVVRKDLSDTDP-GELGAIIAKLPLPPNCFSTLFQGEDRFKDLYFKTFPGYYDTMDSGFRDEDGNIAVMARSDDVINVAGHRLSTGQLEEAILEHDDIAECAVIGMPDKLKGQIPIGLIVLKIGVEKPYRQLVKEVISVVRQHVGPVASFKDSIVVKRLPKTRSGKIARSTIAAMVAGKPYKIPVTIEDASVYPEIEEAFRDSGYS 699          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000043882.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:22941:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000043882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 270.781 bits (691), Expect = 5.400e-79
Identity = 128/325 (39.38%), Postives = 202/325 (62.15%), Query Frame = 3
Query: 1299 RVGNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYD 2273
            R G++ +  G+ G      +E  +  +   P+ FW EAA+ V+W   +   ++  +   P+WFVGGELN+CYN +D+ +E G G++ A+I++SPV+   + +TY E+   V  +AG++V K G+  GD V I+MP++P+ +  MLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV   + + Y   ++ A+ELS       ++Y+ P  E   +  G   +W+ E+   +PQ    V SDHP +V+YTSGTTG  KG+V +TGG  V+  ++MN+  GL P E ++  S   W++G S +CY PL+  N T++Y+
Sbjct:  150 RAGDRRW--GSSGAARAQVYEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMERVAMSSGLGLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 471          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000036840.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:23509:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000036840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.536 bits (667), Expect = 8.077e-77
Identity = 127/325 (39.08%), Postives = 200/325 (61.54%), Query Frame = 3
Query: 1299 RVGNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYD 2273
            R G++ +  G+ G      +E  +  +   P+ FW EAA+ V+W   +   ++  +   P+WFVGGELN+CYN +D+ +E G G++ A+I++SPV+   + +TY E+   V  +AG++V K G+  GD V I+MP++P+ +  MLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV   + + Y   ++ A+ELS       ++Y+ P      L      +W+ E+   +PQ    V SDHP +V+YTSGTTG  KG+V +TGG  V+  ++MN+  GL P E ++  S   W++G S +CY PL+  N T++Y+
Sbjct:   51 RAGDRRW--GSSGAARAQVYEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMVRPCL----GLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 368          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 223.787 bits (569), Expect = 2.552e-61
Identity = 175/646 (27.09%), Postives = 303/646 (46.90%), Query Frame = 3
Query: 1347 YLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVS--------IIEGKYFPSPKWFVGGELNLCYNCLDKQI-EEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVYD-LPDYEPAVLVRGR--------------------DFNWNSEILKVQPQKPRPV--KSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLM---PHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGK 3161
            + +F+ +Y  SV +P+ FW + AK+  W   +          + +G+ F   K   G   N+CYN LD+ + E+  GD  A  +E       K  TY ELL+ V   A ++  + G++ GD V I+MP++ E ++AMLACARIGAV+S  F GF+ + +  RI   +  L+ T++      ++IN K   D A++        V+ C+V   L   E   L  G                     D  W+S +++    +  PV  +S+ P F++YTSG+TG  KG++    G  + +  +        P + ++C +   WI G S + YGPL +   +++++  PT    +  +  I+  + V      PT +RL  K+ N    + K   LK +  +GE  N E   W ++   + +C V +++ QTE G    +P      + +    G  +    G +  I++ ESG  L    +G  V K P  P   +T++ NH+RF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+      NY  +   E+ K+    V   +G +A+ +     P +PK+ +GK ++  L  + + +
Sbjct:   27 FENFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFV--KCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQVPWKPEVDVCWHS-LMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLPT-YPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPL----PAATPLKPGSATFPFFGVVPAILN-ESGEELEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQ----VREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQ 657          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000006142.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:8881:25161:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000006142.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 5.967e-61
Identity = 104/263 (39.54%), Postives = 163/263 (61.98%), Query Frame = 3
Query: 1299 RVGNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTG 2087
            R G++ +  G+ G      +E  +  +   P+ FW EAA+ V+W   +   ++  +   P+WFVGGELN+CYN +D+ +E G G++ A+I++SPV+   + +TY E+   V  +AG++V K G+  GD V I+MP++P+ +  MLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV   + + Y   ++ A+ELS       ++Y+ P  E   +  G   +W+ E+   +PQ    V SDHP +V+YTSGTTG
Sbjct:   29 RAGDRRW--GSSGAARAQVYEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMERVAMSSGLGLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTG 288          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 218.394 bits (555), Expect = 2.141e-59
Identity = 175/662 (26.44%), Postives = 305/662 (46.07%), Query Frame = 3
Query: 1347 YLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVS--------IIEGKYFPSPKWFVGGELNLCYNCLDKQI-EEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVY----------------------DLPDYE--------------PAVLVRGR-DFNWNSEILKVQPQKPRPV--KSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLM---PHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGK 3161
            + +F+ +Y  SV +P+ FW + AK+  W   +          + +G+ F   K   G   N+CYN LD+ + E+  GD  A  +E       K  TY ELL+ V   A ++  + G++ GD V I+MP++ E ++AMLACARIGAV+S  F GF+ + +  RI   +  L+ T++      ++IN K   D A++        V+ C+V                         PD +              P V  +   D  W+S +++    +  PV  +S+ P F++YTSG+TG  KG++    G  + +  +        P + ++C +   WI G S + YGPL +   +++++  PT    +  +  I+  + V      PT +RL  K+ N    + K   LK +  +GE  N E   W ++   + +C V +++ QTE G    +P      + +    G  +    G +  I++ ESG  L    +G  V K P  P   +T++ NH+RF   YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    P+KG   + F+      NY  +   E+ K+    V   +G +A+ +     P +PK+ +GK ++  L  + + +
Sbjct:   27 FENFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFV--KCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQQEKQKGNVRKVRSIPKVPWKPEVDVCWHS-LMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLPT-YPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPL----PAATPLKPGSATFPFFGVVPAILN-ESGEELEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQ----VREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQ 673          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006895.1 (pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-1 gene:ENSPMAG00000006232.1 transcript:ENSPMAT00000006895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 320.087 bits (819), Expect = 9.650e-99
Identity = 176/499 (35.27%), Postives = 274/499 (54.91%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQ------------------------PTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRST-SVHGEGFQSTLCPGYIGKIVD---RESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRY 2768
            ++A +  +   P+ FW EAAK V WTK +  +++    P  +WFV G+LN+CYN LD+ +E G GD+ A+I++SPV+  I+  TY + L  V  +A ++V K G++ GD V I+MP+IP+ + AMLACARIGA++S  FGGFA KE++VRINH +  +V +++ G+     + YK  ++ A++++    +  +VY  P    A L+ GRD  W  E+   +P    PV SDHP +++YTSGTTG  KG+V  TGG  V+  +SM+A  GL P E ++  S   W++G S +CYGPL+  N T++Y+                          P+ RSH + +           +  P  +  L+ K   +  F       +S+ + GEI +KET++W    F   + + W QTE G+  T+ C G   S     G+  +S   PGY  ++VD   +ES      G  G  V+KLPL+P    TL+ N++++   YF  +
Sbjct:    1 YDAAFKLAKSEPERFWAEAAKGVAWTKSWDRVLDDSKSPYTRWFVDGQLNMCYNALDRHVEAGRGDQAAIIHDSPVTGIIQTITYRQALSEVTRLASVLV-KNGVQKGDRVVIYMPMIPQAMFAMLACARIGAIHSLIFGGFASKELAVRINHAKVSMVLSASFGIEPGRQVAYKPLLEAALDIATHKPEKVLVYSRPGMARASLIPGRDMCWQEEVSAAKPHDCVPVSSDHPLYILYTSGTTGAPKGVVRPTGGHAVMLNWSMSAIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEPAPPVSPPPKVFYEVDEKHGLNLCFIPSPRSHYISL----------PMSNPQLLYHLYIKTPCVPRF-------RSMFVAGEICDKETLNWGKATFNVPLLDHWWQTETGSAITATCTGLGGSLYPPAGQCGKSV--PGYDVRVVDSNNQESKR----GNLGNIVVKLPLAPGCMATLWENNQKYEDTYFKSF 475          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 132.109 bits (331), Expect = 4.677e-33
Identity = 100/397 (25.19%), Postives = 179/397 (45.09%), Query Frame = 3
Query: 1977 GRDFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMIN 3155
            GRD  W+  +       +P    ++ P FV+YTSG+TG  KG++  T G  +    +      + P++ ++C +   WI G S + YGPL +   +++++  PT         + ++ + V      PT +RL  K  +    ++    L+ +  +GE  N+E   W+H      +C + +++ QTE G    +P  G   +T +   G  +    G    I+D E G  L    +G  V K P  P   +T++ +HER    YF ++PGYY T D    D D    I  R D++++V+   +    V  A L +  +   ++V     +KG   + F+   N+       +  E  K V   +G +A+ +     P +PK+ +GK ++  L  +  
Sbjct:   11 GRDSWWHELMCGASTTCEPAWCDAEDPLFVLYTSGSTGKPKGVLHTTAGYLLFVATTHKLVFDIRPQDVYWCTADIGWITGHSYIVYGPLANGVTSVLFEGIPT-FPDAGRFWQTVEKYAVSKFYTAPTAVRLLMKHGDAFVLKHSRRSLRVLGTVGEPINREAWHWLHGVVGGGRCPIVDTFWQTETGGHVLTPLPG---ATPLK-PGSATLPFFGVEPAILD-ERGEELRGEAEGFLVFKRPW-PGILRTVFGDHERLEATYFGKFPGYYATGDGCRRDKDGYYWITGRTDDMLNVSGHLLSTAEVESALLSHGSVAEAAVVGRPHALKGESLYCFVT-LNHGLELNPCLAAELKKRVREKIGPIATPDFIQSAPSLPKTRSGKIMRRLLRKIAQ 399          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: cpa5 (carboxypeptidase A5 [Source:ZFIN;Acc:ZDB-GENE-020514-1])

HSP 1 Score: 74.7146 bits (182), Expect = 3.902e-14
Identity = 47/154 (30.52%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  876 GEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTENNDP---CQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVG 1328
            G+D     +L   + YF  V NPDGY ++ +   +R WRK R     ++C G D NRN+  GF         C E + G +  +  E Q++   V +    +K ++ +H Y Q ++ P+ YKNE   DHT L  LA      +  + N  +  G
Sbjct:  209 GQDSAITSLLNTMDWYFEIVANPDGYVYTHE--RDRMWRKTRSQYSGNSCVGTDPNRNFAAGFGGPGSSSSSCTETYRGPSVHSESEVQAIVNFVQA-HPEIKSFLDIHSYSQMLIFPFGYKNELAPDHTEL--LAKSAVTALTSLYNTKYTYG 357          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005866.1 (pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gene:ENSPMAG00000005307.1 transcript:ENSPMAT00000005866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 2.803e-9
Identity = 26/53 (49.06%), Postives = 37/53 (69.81%), Query Frame = 3
Query: 1605 TYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYS 1763
            TY ELL  V   + +++   G+  GD V I+MP+I E ++AMLACAR+GAV+S
Sbjct:   39 TYKELLDQVCKCSNVLLSH-GVGKGDRVAIYMPMITELVVAMLACARVGAVHS 90          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS2 (Acetyl-coA synthetase isoform; along with Acs1p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; mutants affect global transcription; required for growth on glucose; expressed under anaerobic conditions [Source:SGD;Acc:S000004143])

HSP 1 Score: 259.61 bits (662), Expect = 1.334e-74
Identity = 180/636 (28.30%), Postives = 312/636 (49.06%), Query Frame = 3
Query: 1311 KNFKVGTPGELLYLD---FEAVYNSSVLNPDLFWNEAAKQ-VTWTKPYVSIIEGKYFPSP-KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLD-VKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSD--HPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGF--KRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGE-KGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFL------MPHNYDASKAKEIV-----KETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLE 3143
            ++F    PG+    D   ++ +Y  S+  P+ F+++ AK+ + W  PY  +  G        WF+ G+LN  YNC+D+     + D+ A+IYE+      K  T+ ELL+ V  +AG++ +  G++ GD V I++P+IPE +IAMLA ARIGA++S  F GF+   +  R+     K+V T + G    + IN KK +D    L+G+D V   +V+     E   +  GRD+ W+ E  K +   P PV  D   P F++YTSG+TG  KG+V  TGG  + +  +      + P +  F      WI G +   YGPL     +II++  P    +     RI++ HK       PT +RL ++    E  +  T  L+ +  +GE  + +  +W H+K     C++ ++  QTE G+   +P  G    +  S     F    C      I+D  +GV L   + +G   +K P  P+ A++++ +H+R++  Y   YPG+Y T D A  D D    I  R D++++V+  R+    +  +   + ++   ++V + D + G     ++      + +N     A+ I      +E +  V   +G  AS +  ++V  +P++ +GK ++  L 
Sbjct:   22 QHFYNSQPGKGYVTDMQHYQEMYQQSINEPEKFFDKMAKEYLHWDAPYTKVQSGSLNNGDVAWFLNGKLNASYNCVDRH-AFANPDKPALIYEADDESDNKIITFGELLRKVSQIAGVL-KSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEG--LNGVDLVSRILVFQRTGTEGIPMKAGRDYWWHEEAAKQRTYLP-PVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPAYPDY-GRYWRIIQRHKATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGINAC------IIDPVTGVELEGNDVEGVLAVKSPW-PSMARSVWNHHDRYMDTYLKPYPGHYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIEASISNHENVSEAAVVGIPDELTGQTVVAYVSLKDGYLQNNATEGDAEHITPDNLRRELILQVRGEIGPFASPKTIILVRDLPRTRSGKIMRRVLR 644          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS1 (Acetyl-coA synthetase isoform; along with Acs2p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; expressed during growth on nonfermentable carbon sources and under aerobic conditions [Source:SGD;Acc:S000000050])

HSP 1 Score: 258.07 bits (658), Expect = 6.286e-74
Identity = 169/625 (27.04%), Postives = 305/625 (48.80%), Query Frame = 3
Query: 1353 DFEAVYNSSVLNPDLFWNEAAKQ-VTWTKPYVSIIEGKYFPSPK----------WFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAI-ELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKP-RPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDA------SKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGK 3161
            D++ ++  S+ +P  F+   A Q + W+KP+  +    + P PK          WF+ G+LN CYNC+D+   +   ++ A+I+E     +    TY ELL+ V  VA ++    G+  GD V ++MP++PE +I +LA +RIGA++S  F GF+   +  RIN    K+V T++      ++I  K+ +D A+ E  G  V+  +VY   +         RD +W +E  K +   P  PV S+ P F++YTSG+TG  KG+   T G  + +  +M         + FF      WI G + + YGPL+    T++++  P   ++      I+  HKV      PT +RL ++  +     +  + L+ +  +GE    E  +W  +K    +  + +++ QTE G+   +P  G     +    G  S    G    ++D  +G  L        +      P+ A+T+++NH+R++  Y + YPGYY T D A  D D  + IL R D++++V+  R+    +  A +++P +   ++V   D + G     F++  N  +       + ++I K  V  V   +G  A+ +  ++V  +PK+ +GK ++  L  ++ G+
Sbjct:   75 DYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKV----FIPDPKTGRPSFQNNAWFLNGQLNACYNCVDRHALKT-PNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVLTYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTDESNRGGKVIETKRIVDDALRETPG--VRHVLVYRKTNNPSVAFHAPRDLDWATEKKKYKTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNY-SRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVTPLAG---GVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNHDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRILRKILAGE 688          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ECM14 (Putative metalloprotease with similarity to zinc carboxypeptidases; required for normal cell wall assembly [Source:SGD;Acc:S000001174])

HSP 1 Score: 114.775 bits (286), Expect = 1.954e-27
Identity = 66/241 (27.39%), Postives = 124/241 (51.45%), Query Frame = 3
Query:  630 KYLTWDEFENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKLGENIQAPN-----VLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTE-NNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKL--YVSLHCYGQFILLPWAYKNEKV-SDHTNLVKLANDIQKTMFRVGNKNFKV 1325
            +Y   D    W+ +L+ +  SLV +  LG++FE R + ++ +  N    N     +++  G HAREW+S++++   +  +LN      ++  +   L   +   +PV NPDGY ++     +R WRKNRQ      C G+DI+ ++   + + +   C E++ G  PF   E+ +  K ++  + + K+  Y+ +H Y Q IL P+AY  + +  D  NL++L+  + K +     +N+ V
Sbjct:  120 EYRDLDTIYMWLDLLERSFPSLVAVEHLGRTFEGRELKALHISGNKPESNPEKKTIVITGGIHAREWISVSTVCWALYQLLNRYGSSKKETKY---LDDLDFLVIPVFNPDGYAYTWS--HDRLWRKNRQRTHVPQCLGIDIDHSFGFQWEKAHTHACSEEYSGETPFEAWEASAWYKYINETKGDYKIYGYIDMHSYSQEILYPYAYSCDALPRDLENLLELSYGLSKAIRSKSGRNYDV 355          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO49293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH51])

HSP 1 Score: 439.499 bits (1129), Expect = 1.584e-140
Identity = 228/632 (36.08%), Postives = 361/632 (57.12%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF--LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQST--LCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGY 3239
            ++  +  SV +P+ FW++ A+ + W KPY  +++    P  KWF GGELN C+NCLD+ IE G G   A+IY+SPVS KI+ Y+Y  L + V   AG +     +  GD V I+MP++P+ +IAMLACARIGA++S  FGGFA  E++ RI H +P+++ T++ G+    I+ YK  +D AI++S       V+Y   D     ++ GRD  W+  + + +P    PV +  P +++YTSGTTGD KG+V   GG  V   +SM    G+ P E ++  S   W++G S + Y PL +   T++++ +P          R+++ HKV+++   PT +R+ R      +   + +    + + L GE  +K+TM W        VY++W QTE G   T+  +G  R      E  ++T    PGY  KI+ RE       GE G+  +KLP+ P    TL+R  ERF K YF +YPGYYD+ D+ +MD D  V I++R D++I+VA  RI   ++ E  ++   +   + + L+D IKG VP GF++     + K ++++KE  K V   VG VA+F+ AV+VP +PK+ +GKT++  L  +++G+P+K+    D+ +    I D+L   GY
Sbjct:   57 YDEAFKQSVEDPEGFWDDVAQGIDWYKPYTKVVDNATPPFTKWFPGGELNTCFNCLDRHIENGIGGRIALIYDSPVSGKIEMYSYQNLQRLVAKFAGAL-NSLNVGKGDRVVIYMPMVPQAVIAMLACARIGAIHSVVFGGFAAAELARRIEHAEPRVIVTASCGIEPSRIVTYKPLVDEAIKISSFKPSTVVLYQR-DQCTGDIIPGRDITWDQVMERAEPHDCVPVLATDPLYILYTSGTTGDPKGIVRRNGGHAVALNWSMKNIYGVNPGEVWWAASDLGWVVGHSYIVYAPLFNGCTTVLFEGKPVGTPDAGAFFRVIEQHKVISMFTAPTAIRIIRTEDPKAELIRQYDLSHFRDMFLAGEHLDKDTMQWARRAISAPVYDNWWQTESGWAITAHTVGLGRPMD---EKLETTGKAVPGYNVKIL-REDMTEADRGELGQICVKLPMPPGTMGTLWRADERFKKTYFEKYPGYYDSSDAGVMDEDGYVSIMARTDDVINVAGHRISTKSLEEGMMKPSFVVDAACIGLKDGIKGHVPLGFVIVDKTVSMKKEDMIKEVKKSVREFVGPVAAFKTAVIVPALPKTRSGKTVRGILAKIVHGEPYKVTPTMDNPQCLDQIKDVLISEGY 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO39135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAZ3])

HSP 1 Score: 244.588 bits (623), Expect = 1.162e-69
Identity = 175/583 (30.02%), Postives = 288/583 (49.40%), Query Frame = 3
Query: 1479 KWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKC-GIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELS-GLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQK--PRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERS-----HLVEILRILKCHKVVALICPPTIMRLFRKFCN--IEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMS 3185
            +WFVGGE+N+  NC+D  +   H + TA+I+E      +++ +Y +L   V  +A ++  KC G++ GD V ++MP+ P  + AMLACARIGA +S  F GF+   ++ RIN  Q + V T+N  V     I+ K+ +D A+  S G+   F +         A +  G+      E +  QP +  P P+ S+ P F++YTSG+TG  KG+V    G  + +K +          + F C++   WI G S + YGPL +   T++++  PT         +VE LRI + +        PT +RL  K  N  +E ++  +  LK +  +GE  N+E   W +D   + +C V ++W QTE G    SP      S  V  E F      G    +VD +   +      G    +  + P   +T+Y +HERF+  Y+  YPGYY T D A+ D D + +I  R D++++V+  R+    V +A   +  +   ++V    PIKG   + +    +    + ++  +E  K V   +G  A  E   VVP +PK+ +GK ++  L  +   KP ++  +S
Sbjct:   11 RWFVGGEINVSENCVDHHMRS-HPNRTALIWEKDEPGDVEHVSYIQLYGMVNRMANML--KCHGVKKGDIVCLYMPVSPLAVAAMLACARIGAPHSVVFAGFSADALASRINDAQAETVITANQAVRGGRAIDLKRVVDDAVSKSPGVKRVFVM-----KRTGAQVPMGKLDIPLEEAMAEQPDECPPEPMDSEDPLFLLYTSGSTGQPKGIVHTQAGYLLYAKLTHKYCFDYKQGDVFGCVADIGWITGHSYVVYGPLANGATTVLFESTPTYPDPGRYWEMVERLRINQFYGA------PTAIRLLLKSGNSWVEKYDRSS--LKVLGTVGEPINEEAWHWYNDVVGEKRCTVVDTWWQTETGGILISPRPAPDNS-PVKPE-FPMRPFFGVDPVLVDEKGKELTGNNVTGALCFRSSV-PGMCRTIYGHHERFLNTYYRPYPGYYFTGDGALRDKDGHYRITGRMDDVVNVSGKRLGTAEVEDAMDNHSAVAETAVVGFPHPIKGEGIYAYATLKDDAQIEPEQFREEVKKLVRQKIGAFAVPEIIQVVPGLPKTRSGKIMRRILRKVAQDKPDELGDVS 574          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO42084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2B4])

HSP 1 Score: 227.254 bits (578), Expect = 6.087e-63
Identity = 176/635 (27.72%), Postives = 292/635 (45.98%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKY-------FPSPKWFVGGELNLCYNCLDKQI-EEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAI---ELSGLDVKFCVV-------------------YDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPV--KSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKF---QCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVAL--EDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            ++A Y  S+ +P  FW E A    W  P  S    KY           KW  G + N+CYN LD+ + ++G GD  A  +E  V    K  TY ELLK V   A ++  K G++ GD V I+MP+I E +IAMLACAR+GAV+S  FGGF+ + ++ RI     K++ T++      ++IN K+  D AI        +V+ C+V                      P ++           W  E++     +   V   ++ P F++YTSG+TG  KG++   GG  + +  +        P E ++C +   WI G S + YGP+ +  I+++++  P           I+  +KV      PT +R   KF       +  E LK +  +GE  N E   W +      +C + +++ QTE G    +P  G  R+      G  +    G    IVD E G  L    +G  V+K P  P  A+T+Y NH+RF  +YF ++ GYY T D    D +    +  R D+ ++V+   +    +  A +++  +   ++V+   ++  +G   F  LM    +    +++++E  + V   +G  AS +     P +PK+ +GK ++  L  +
Sbjct:   33 YKARYKQSIEDPAGFWGEVASDFFWKVPPKSDHFLKYNFDLDNGSVDIKWMQGAKTNICYNVLDRNVHDKGLGDTVAFYWEGNVPGDTKQITYGELLKQVCKFANVLESK-GVKKGDRVAIYMPMIMELVIAMLACARLGAVHSIVFGGFSAESLAERILDSTCKILITADASYRGLKMINLKEIADHAIIKCRERSFNVEACIVVRHLGPDKRVPTDPSSSPPPKRPCHQLQTSFDSSIDCWWHEVMAEASDEHDTVWVDAEDPLFMLYTSGSTGKPKGVLHTHGGYMLYTALTFRYSFDYHPGEVYWCTADIGWITGHSYITYGPMANGAISVLFEGTPF-YPDCGRFWDIVDKYKVSKFYTAPTAIRSLMKFGKEIVTSHNLESLKVLGTVGEPINPEAWLWYYHVVGHNKCAIVDTYWQTETGGHVITPLPGATRTRP----GAATFPFFGVEPAIVD-EKGNELEGPCEGFLVIKRPW-PGMARTIYGNHKRFENVYFDKFRGYYTTGDGCKRDENGYYWVTGRTDDCMNVSGHLLSTAQIESALVEHDAVSEAAVVSCPHKEKGEGIYCFATLME---NVELDEKLIRELKQKVRLKIGPFASPDVIQSAPALPKTRSGKIMRRVLRQV 656          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO46954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM7])

HSP 1 Score: 125.176 bits (313), Expect = 1.273e-30
Identity = 92/344 (26.74%), Postives = 167/344 (48.55%), Query Frame = 3
Query:  390 VIEIVPKFSSELIVLKSLANDQVLLSD------KPLVNKTLHVSMGTSKWRNTIHNLLTENNIQF--------RLFQEHELKKFLRIKRSEDDEKYLTWDEFENWIRMLKST--RNSLVKISVLGKSFESRNIYSIKL-GENIQ-APNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTE---NNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVG-NKNFKVGTPGELLYLD 1355
            V+ ++P+  +E+ V+  L N + +  D      +P     LHV+    K    +   L+ N I F        RL  + ++    R   S     Y T D+    ++ L +T  RN  V++  +GKS+  ++  +I++ G+  +  P   ++ G HAREW+S A+ +   K +L+     G+D     +L K +   +PVLNPDGY  + +    RFWRK  + N  + C G D NRN+   +     + DPC +D+ G   F+ +E  ++ K +  +   +K Y+ +H Y QF ++PW +      D+  L++++    + +   G N  +KVG    ++Y++
Sbjct:    3 VVRVIPQDEAEIHVINELRNHKDIKVDFWAPPSRPRHPVDLHVTAHAYK---RLARHLSANRIPFTLQIPDVQRLVDQQKMATAGRASASWY-STYHTLDQIYAELKNLYNTYYRNGNVRVFTVGKSYNGKDQKAIEIKGKRARNKPVFFMNCGIHAREWVSPATCMYIAKQLLSRY---GKDANVTSVLDKMDFVIMPVLNPDGYVFTWE--RQRFWRKTLKPNSGTFCVGTDPNRNWDYKWGAEGASTDPCADDYRGPHAFSEIEIVNVAKYLKKLGDRIKGYMDIHAYSQFWMIPWGHTQTPSKDYQELMRVSKAGAEAIRSSGDNTVYKVGPSSTVIYVN 337          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO43305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYY0])

HSP 1 Score: 118.627 bits (296), Expect = 1.692e-28
Identity = 86/339 (25.37%), Postives = 159/339 (46.90%), Query Frame = 3
Query:  390 VIEIVPKFSSELIVLKSLANDQVLL----SDKPLVNKTLHVSMGTSKWRNTIHNLLTENNIQFRL----FQEHELKKFLRIKRSEDD-EKYLTWDEFENWIRMLKSTRN-SLVKISVLGKSFESRN-IYSIKLGENIQAPNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDS-----NCTGVDINRN--YPIGFT-ENNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVGTPGELLY 1349
            VI ++PK   E+ +L  L +D  +     +  P +   +HV    +++   +   L +N ++F +     Q     + L + RSE     Y   D+ E+ +R L   +  + V ++ +G ++E  N ++ IK     + P   ++ G HAREW++ A+    + II   + +   D     +L K +   +PVLN DGY ++     NR WRK R+ N+ S      C G D NRN  Y  G    +++PC + F G    + +E  ++ K +  +   +K Y+ +H Y QF ++PW Y      DH  L++++      + +     ++ G+   ++Y
Sbjct:    7 VIRVIPKTDDEVRILADLEHDPTVSFWKEAHAPGMAADIHVP---ARYYGDVARHLDKNGLKFAIQIIDLQSEVDNEKLTLGRSEGFFSGYKPLDKIEDEMRRLAGVQTLAQVTMNTVGSTYEGPNLVFQIKGRSLPEKPVFFMNCGIHAREWITPATC---MYIITQFITKYRSDKSVTEVLDKMDFIIMPVLNADGYVYTWTG--NRMWRKTRKPNIQSWWGQKTCYGTDPNRNWGYKWGLPGASSNPCSDTFRGKTAQSEVEVDNVAKFLKGLGPRVKGYMDIHAYSQFWMIPWGYTTANAKDHKELMRVSKIGVDAIRQTYGTAYRYGSSSNIIY 337          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 423.705 bits (1088), Expect = 2.624e-134
Identity = 228/631 (36.13%), Postives = 360/631 (57.05%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF----LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSG 3236
            +   ++++   PD+FW E    + W +P+   +  +    P WFVGG LN+CYN +D+ +E G G++ A+I++SPV+   K  TY EL   V  +AG++V K G+  GD V I+MP++PE +IAMLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV     + Y   +  A+E+S       ++Y+ P+ E   L      +W+ E+   +P +   + S+HP +V+YTSGTTG  KG+V +T G  V+ K++M+   GL P + ++  S   W++G S +CY PL+  N TI+Y+ +P          R+L  H   ++   PT +R  R+        N  ++    L+S+ + GE  + ET++W    F   V + W QTE G+  T+  +G   S +    G      PGY   ++D +   V P    G  V++LPL P AA +L+ N   F KLYFS++PGYYDTMD+  +D D  + I+SR D++I+VA  R+   A+ E+ L +  +   ++V LED +KG +P    +  N      +++  E VK V +TVG VA+F+  + V  +PK+ +GK  ++SL  +INGKP+K+    +D EV+    DI ++ G
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQ--QDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPA-GQAGKPVPGYNVTVIDDQMQEVKP-RTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVF---KDIERQVG 677          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 402.905 bits (1034), Expect = 4.554e-126
Identity = 220/591 (37.23%), Postives = 342/591 (57.87%), Query Frame = 3
Query: 1476 PKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF----LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSG 3236
            P+ FVGG LN+CYN +D+ +E G G++ A+I++SPV+   K  TY EL   V  +AG++V K G+  GD V I+MP++PE +IAMLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV     + Y   +  A+E+S       ++Y+ P+ E   L      +W+ E+   +P +   + S+HP +V+YTSGTTG  KG+V +T G  V+ K++M+   GL P + ++  S   W++G S +CY PL+  N TI+Y+ +P          R+L  H   ++   PT +R  R+        N  ++    L+S+ + GE  + ET++W    F   V + W QTE G+  T+  +G   S +    G      PGY   ++D +   V P    G  V++LPL P AA +L+ N   F KLYFS++PGYYDTMD+  +D D  + I+SR D++I+VA  R+   A+ E+ L +  +   ++V LED +KG +P    +  N      +++  E VK V +TVG VA+F+  + V  +PK+ +GK  ++SL  +INGKP+K+    +D EV+    DI ++ G
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQ--QDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPA-GQAGKPVPGYNVTVIDDQMQEVKP-RTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVF---KDIERQVG 702          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 390.193 bits (1001), Expect = 6.811e-122
Identity = 223/631 (35.34%), Postives = 350/631 (55.47%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF----LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSG 3236
            +   ++++   PD+FW E    + W +P+   +  +    P WFVGG LN+CYN +D+ +E G G++ A+I++SPV+   K  TY EL   V  +AG++V K G+  GD V I+MP++PE +IAMLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV     + Y   +  A+E+S       ++Y+ P+ E   L      +W+ E+   +P +   + S+HP +V+YTSGTTG  KG+V +T G  V+ K++M+   GL P + ++  S   W++G S +CY PL+  N TI+Y+ +P          R+L  H   ++   PT +R  R+        N  ++    L+S+ + GE  + ET++W    F   V + W QTE G+  T+  +G   S +    G      PGY   ++D +   V P    G  V++LPL P AA +L+ N   F KLYFS++PGYYDTMD+  +D D  + I+SR D++I+VA  R+   A+ E  ++NP       V + D                     +++  E VK V +TVG VA+F+  + V  +PK+ +GK  ++SL  +INGKP+K+    +D EV+    DI ++ G
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGEL--QVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQ--QDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPA-GQAGKPVPGY--NVIDDQMQEVKP-RTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEE--VRNPAFA----VCVRD-------------------TEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVF---KDIERQVG 648          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 371.318 bits (952), Expect = 1.602e-114
Identity = 210/591 (35.53%), Postives = 325/591 (54.99%), Query Frame = 3
Query: 1476 PKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEF----LKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSG 3236
            P+ FVGG LN+CYN +D+ +E G G++ A+I++SPV+   K  TY EL   V  +AG++V K G+  GD V I+MP++PE +IAMLACARIGA +S  FGGFA KE+SVRI+H +PKL+ T++ GV     + Y   +  A+E+S       ++Y+ P+ E   L      +W+ E+   +P +   + S+HP +V+YTSGTTG  K                            ++  S   W++G S +CY PL+  N TI+Y+ +P          R+L  H   ++   PT +R  R+        N  ++    L+S+ + GE  + ET++W    F   V + W QTE G+  T+  +G   S +    G      PGY   ++D +   V P    G  V++LPL P AA +L+ N   F KLYFS++PGYYDTMD+  +D D  + I+SR D++I+VA  R+   A+ E+ L +  +   ++V LED +KG +P    +  N      +++  E VK V +TVG VA+F+  + V  +PK+ +GK  ++SL  +INGKP+K+    +D EV+    DI ++ G
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPK---------------------------IWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQ--QDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPA-GQAGKPVPGYNVTVIDDQMQEVKP-RTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVF---KDIERQVG 675          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss2 (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101157758])

HSP 1 Score: 234.187 bits (596), Expect = 5.335e-65
Identity = 178/633 (28.12%), Postives = 298/633 (47.08%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTW----TKPYVS----IIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGH-GDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIEL---SGLDVKFCVVYDLPDYEPAVLVRGR-------------------DFNWNSEILKVQPQ-KPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHD---KFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAM 3149
            ++ +Y  S+ NPD FW   AK   W    T P++S    + +G+ F   K   G   N+CYN LD+ + E   GD  A  +           TY ELL+ V   A ++  + G++ GD V I+MP++ E ++AMLAC RIGAV+S  F GF+ + +  RI   Q  L+ T++      ++IN K   D A++     G  VK C+V      EP   V                      D  W++ I +   + +P    S+ P F++YTSG+TG  KG+V    G  + +  +        P + ++C +   WI G S + YGPL +   +++++  PT    +  +  I+  ++V      PT +RL  KF +   F  K E LK +  +GE  N E   W ++   + +C + +++ QTE G    +P      + +    G  +    G +  I++ ESG  L    +G  V K P  P   +T+Y NH+RF  +YF ++PGYY T D    D D    I  R D++++V+   +    V  A +++  +   ++V    PIKG   + F+   +   + ++ +  E  K V   +G +A+ +     P +PK+ +GK ++  L  +
Sbjct:   30 YKELYMKSIDNPDEFWGVIAKDFFWKSKPTGPFLSYNFDVTKGEIFI--KCMEGASTNICYNLLDRNVHERKLGDRIAFFWLGNEPGDESVVTYRELLQRVCRFANVLRSQ-GVKKGDRVSIYMPMVIELVVAMLACVRIGAVHSIVFAGFSAESLCERIMDSQCLLLITADGFYRGDKLINLKHLADEALQKCRDKGFPVKRCIVLKHLSKEPEESVGSHSPPAKRSCPDLQVPWNPEVDLCWHALISEASDECEPEWCNSEDPLFILYTSGSTGKPKGVVHTVSGYMLYTATTFKLVFDHQPDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPT-YPDVSRMWGIVDKYQVTKFYTAPTAIRLLMKFGSEPVF--KRESLKVLGTVGEPINPEAWHWYYNVVGEKRCPIVDTFWQTETGGHVLTPL----PAATPMKPGSATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHQRFESIYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHRAVAEAAVVGRPHPIKGESLYCFVTLKD-GVAYSQMLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKI 649          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043657.1 (SMESG000043657.1)

HSP 1 Score: 1300.8 bits (3365), Expect = 0.000e+0
Identity = 628/640 (98.12%), Postives = 633/640 (98.91%), Query Frame = 3
Query: 1341 LLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGYQPSYPMS 3260
            +L LDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECL+AMLACARIGAVYSTTFGGFAIKEVSVR+NHFQPK+VFTSNVGVTRKEIINYKKRMDLAI+LSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENK EFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGV LPI EKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYD SKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVY VIHDIL RSGYQPSYPMS
Sbjct:    1 MLDLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLVAMLACARIGAVYSTTFGGFAIKEVSVRVNHFQPKIVFTSNVGVTRKEIINYKKRMDLAIDLSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKPEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVELPIREKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDVSKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYSVIHDILTRSGYQPSYPMS 640          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043661.1 (SMESG000043661.1)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 322/324 (99.38%), Postives = 323/324 (99.69%), Query Frame = 3
Query:  378 SSNVVIEIVPKFSSELIVLKSLANDQVLLSDKPLVNKTLHVSMGTSKWRNTIHNLLTENNIQFRLFQEHELKKFLRIKRSEDDEKYLTWDEFENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKLGENIQAPNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTENNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVGTPGELLY 1349
            +SNVVIEIVPKFSSELIVLKSLANDQVLLSDKPLVNKTLHVSMGTSKWRNTIHNLLTENNIQFRLFQEHELKKFLRIKRSEDD KYLTWDEFENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKLGENIQAPNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTENNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVGTPGELLY
Sbjct:   23 NSNVVIEIVPKFSSELIVLKSLANDQVLLSDKPLVNKTLHVSMGTSKWRNTIHNLLTENNIQFRLFQEHELKKFLRIKRSEDDGKYLTWDEFENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKLGENIQAPNVLLDSGSHAREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGYFHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTENNDPCQEDFPGGAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDHTNLVKLANDIQKTMFRVGNKNFKVGTPGELLY 346          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043645.1 (SMESG000043645.1)

HSP 1 Score: 506.523 bits (1303), Expect = 1.217e-166
Identity = 256/635 (40.31%), Postives = 386/635 (60.79%), Query Frame = 3
Query: 1350 LDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGYQPSYP 3254
            L+F  +Y  S+  P+  W+E   +V W+KPY S+I+ K  P PKWF GGE+N+ YNCLDK + +G+GD+ AVIYE PV    +  +Y +LL  VE +AG+MV KC ++ GD V +++P+  + + A+LAC RIGAVY  TFGGFA   ++ RI H +PKL+ T+N G   +  +NYK+ +D AI  S     +C+VY+ P+ + A ++  RD +W +EI K  P  P  ++S  P F+IYTSGT G+ KGLV+  GG  V +K+ M    GL  ++ ++    + WI GQ+ + +GPL+    TI+Y+ +     HL  I +I+  + V      PT  R  +   + +D +     L+ + + GE++N +  +WV + F C VY+ WGQTELG   T P LGFK  +S +G     ++ P    K+V+  +G  LP    GR +LK+PL P+AA ++Y++H+RF+K YFS+Y GYYDTMD  ++  D  ++IL+R D++I V++ RI G A+ E CL N DL + + VALEDPI G VPF FL          + ++ E+VK V   +G    F Q VVV  +PK+  GK L+ +L  M+NG+ +K PA  ++ +V+  I+ IL  +GY+ S P
Sbjct:    4 LNFADLYELSISQPEKVWDELGNEVVWSKPYTSVIKDKDSPIPKWFDGGEINMSYNCLDKHVLDGYGDDVAVIYECPVINATEKVSYKQLLTLVENLAGVMVNKCHLQKGDRVLLYVPVTVQGIAAILACTRIGAVYVVTFGGFAPDLIAARIKHTEPKLIITTNFGYEPERTVNYKEIVDEAINKSQFCPDYCIVYNRPNTKCATMIDSRDLDWETEIGKATPYAPVALESGDPIFIIYTSGTLGEPKGLVMTVGGFIVSNKYFMKYVLGLNRQDCWWMFGDYGWISGQTTMTFGPLLIGCSTILYEGKELSSHHLTGIGKIIDQNNVTGFSAAPTYFRFLKNKDSEKDIKPSKAQLRFVCIGGELSNTKLKEWVSNVFLCPVYDLWGQTELGIIATGPGLGFKNISS-NGLSPMLSVHP----KVVNSATGEHLPNETIGRMLLKIPLCPSAASSMYKDHDRFLKTYFSKYDGYYDTMDYGMIKNDGTLQILARADDVISVSAGRICGGALEEVCLMNEDLANAAFVALEDPINGQVPFAFLEKKKDRNINNEALIIESVKLVKKEIGSFTLFHQGVVVHDLPKTKTGKILRKTLYNMLNGQDWKTPATVENPKVFEEIYSILIEAGYKASLP 633          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043650.1 (SMESG000043650.1)

HSP 1 Score: 501.13 bits (1289), Expect = 1.325e-164
Identity = 256/639 (40.06%), Postives = 381/639 (59.62%), Query Frame = 3
Query: 1341 LLYLDFEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMIN-GKPFKIPAMSDDHEVYCVIHDILKRSGYQPSYP 3254
            +L LD+E +Y  S+ +P+  W+E  K+V W KPY S+IE    P   WFVGG++N+ YNCLD  ++ G GD+ AVIYE+P     +  ++ ELL SVEL+AG+M  KCGI   D V ++ P+IP+CLI MLAC RIGA+YS  FGG   + ++ RI H +PKL+ T NVG  R +  NYK+RMD+AIE+S      C+VY+ P  +PA++    D +W +E+    P  P  ++S++P +VIYTSGTTG  KGLV+ TG   V+ K+ M     + P++ ++ +S F ++ GQ  + +GPL+ RN T++Y+  P     L ++   +  HKVV+     T MR      +   F+ +   L SIN  G+ ++K+   W+   F+C +Y  WGQTELG  G S CLGF+R+   H     S + P     IV+ +SG +LP+G +GR +LK PL P+AA T Y+N ERF + YF  YPG+YDTMD  I   +   K++SR D+++ + S RI G A+ E CL+   + +  IV +E   +G  P  F+   N      +EI K+ +  V N +GE A      +VP  P+++NGK  ++SL AM N  + + +P   ++ E+Y  I  ILK +G+ P+ P
Sbjct:    1 MLKLDYEKLYELSIEHPEKVWDELGKEVVWDKPYESVIEDVTSPISNWFVGGKINMSYNCLDIHVKNGFGDDIAVIYENPSMDISEKISFKELLNSVELLAGVMANKCGIGKDDRVVLYFPVIPQCLIGMLACTRIGALYSVIFGGIPPQTIANRIEHLEPKLLITCNVGAERDQTRNYKERMDIAIEISEFKPDLCLVYNRPKTKPALMKEFVDLDWETEMETSIPVGPVSLESNYPMYVIYTSGTTGQPKGLVMATGNSVVICKYMMKYIKNIGPQKCWWMLSDFGYLTGQLFMAFGPLIQRNSTLLYEGTP----DLHQLFEFMNKHKVVSFYSAITFMRQLHYESSDSIFQPEYGGLHSINAGGDKSDKKLEKWITKTFKCPIYIQWGQTELGGHGMSGCLGFQRNDDPHSIPLLS-INPF----IVNNDSGEILPLGSQGRLLLKTPLPPSAALTYYKNKERFFETYFKSYPGFYDTMDYGIKFKNGAFKVISRADDVMKINSMRISGGAIEEVCLKCQSITNAIIVPIECLNEGQNPVAFVTKRNGQELSNEEIRKDLISLVNNHIGEFARLRHVFIVPDFPRTINGKISRSSLAAMTNENRVYTMPPTIENPEIYREIFYILKEAGFDPTLP 630          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043630.1 (SMESG000043630.1)

HSP 1 Score: 499.204 bits (1284), Expect = 2.055e-163
Identity = 250/636 (39.31%), Postives = 378/636 (59.43%), Query Frame = 3
Query: 1356 FEAVYNSSVLNPDLFWNEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGDETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMPIIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGVTRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSEILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNAYTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLVEILRILKCHKVVALICPPTIMRLFRKF--CNIEDFENKTEFLKSINLIGEITNKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFK-RSTSVHGEGFQSTLCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKLYFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACLQNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNTVGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVYCVIHDILKRSGYQPSYP 3254
            ++  +  S+   + FW +AA  + W K    +++     SPKWF G E+N+ YNC+D+ ++EG GD+ AVIY+SP++  I+  TY +LL++V  +AG+M  K G+  GD V I++P++P+ LI MLACAR+GAV+S  FGGFA KE++VRI H +PK + T+NVGV    +INY   ++ AI LSG   K C++Y+ P ++ A L   RD +W+ E+    P  P  V  +HP +++YTSGTTG  KG+V  T G  V  K+SM     +   ET++  S F W++G S +CY PL+ R  TIIY+ +P       +  R+L  H  VAL   PT +R  R+     I     +    +S+ L GE  + +T++W  + F+  V + W QTE G   T P  G + R   V   G      PGY  KI+D  +G  L     GR V+KLP+ P  A TLY N E F K++FS++PGYYDTMD+       ++ +L+RDD++++VA  R+   A+ EACL+NP +   ++V L+DP+KG VP   L+P +     +++IV +T+K V + +G VA    A+VV ++PK+ +GK  ++++ AM NGKPFK P   +D  V+  I+    + G +PS P
Sbjct:   33 YQLEFKQSLEQKEEFWGKAANDIVWGKQCSRVLDASELHSPKWFEGSEMNMSYNCVDRHVDEGFGDQLAVIYDSPITGAIQKITYRQLLENVSKLAGVMA-KYGVTKGDRVLIYLPMVPQTLITMLACARLGAVHSLVFGGFAAKELAVRIRHCEPKFIVTTNVGVEPNRLINYTNYVNEAISLSGFQPKHCLIYNRPGHKRADLKPERDLDWDHELYSAAPHDPVIVDGNHPLYILYTSGTTGLPKGVVRPTAGYAVALKWSMKNLYDVNSGETWWAASDFGWVVGHSYICYAPLLHRCTTIIYEGKPVGTPDTSQYFRVLNWHNPVALFVAPTALRAIRREDPQAIHGARYRHPRFRSLFLAGEHCDVDTLNWAKETFKVPVLDHWWQTETGWAITCPAAGLETREDLVPPPGSAGRPVPGYDVKILDTNTGAELGPNRLGRIVVKLPMPPGMASTLYNNDEMFSKIFFSKFPGYYDTMDAGTSTEFGHIMVLARDDDVLNVAGHRLSSGALEEACLENPCVVECAVVGLDDPLKGQVPLALLVPDSNTEKSSEDIVSDTIKIVRDRIGAVAGMRTAIVVHRLPKTRSGKISRSAIAAMANGKPFKAPVTLEDPTVFDPIYHAFIKIGLKPSQP 667          
The following BLAST results are available for this feature:
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS32.139e-15037.88acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS34.053e-14737.72acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS15.980e-6626.92acyl-CoA synthetase short chain family member 1 [S... [more]
ACSS28.100e-6226.79acyl-CoA synthetase short chain family member 2 [S... [more]
ACSS21.420e-6026.56acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-194.606e-5027.04Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-194.606e-5027.04Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-195.609e-5027.04Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
W01A8.68.168e-3332.69pep chromosome:WBcel235:I:7070649:7074733:-1 gene:... [more]
Y59C2A.14.218e-3228.63pep chromosome:WBcel235:II:2208112:2212863:1 gene:... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64323.645e-11733.33gene:FBgn0039184 transcript:FBtr0346110[more]
CG64323.645e-11733.33gene:FBgn0039184 transcript:FBtr0084606[more]
AcCoAS2.917e-7029.41gene:FBgn0012034 transcript:FBtr0333126[more]
AcCoAS2.917e-7029.41gene:FBgn0012034 transcript:FBtr0078413[more]
AcCoAS1.468e-5128.66gene:FBgn0012034 transcript:FBtr0078414[more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss36.839e-13635.76acyl-CoA synthetase short chain family member 3 [S... [more]
acss31.375e-12234.18acyl-CoA synthetase short chain family member 3 [S... [more]
acss11.163e-6727.73acyl-CoA synthetase short chain family member 1 [S... [more]
acss21.633e-5826.99acyl-CoA synthetase short chain family member 2 [S... [more]
acss26.903e-5726.53acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS31.568e-14437.18acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS32.362e-14237.26acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS35.098e-14037.20acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS31.662e-13936.94acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS31.266e-13135.97acyl-CoA synthetase short chain family member 3 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acss36.930e-15037.25acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss31.428e-10037.00acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss11.692e-6927.70acyl-CoA synthetase short-chain family member 1 [S... [more]
Acss23.320e-6126.65acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss21.606e-5926.27acyl-CoA synthetase short-chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0G2K047|ACSS3_RAT7.916e-15037.46Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q9H6R3|ACSS3_HUMAN1.027e-14937.88Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q5REB8|ACSS3_PONAB1.297e-14938.03Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q14DH7|ACSS3_MOUSE4.848e-14937.25Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|A7MB45|ACSS3_BOVIN9.909e-14337.56Acyl-CoA synthetase short-chain family member 3, m... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5NHM26.450e-15137.90Acyl-CoA synthetase short chain family member 3 OS... [more]
W5NHL93.291e-15037.90Acyl-CoA synthetase short chain family member 3 OS... [more]
A0A4X2JVT54.392e-15038.41Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
G1TA535.918e-15038.67Acyl-CoA synthetase short chain family member 3 OS... [more]
R7U6A98.438e-15037.38Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000043882.15.400e-7939.38pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036840.18.077e-7739.08pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
acss22.552e-6127.09acyl-CoA synthetase short chain family member 2 [S... [more]
ENSAMXT00000006142.25.967e-6139.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
acss22.141e-5926.44acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000006895.19.650e-9935.27pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-... [more]
acss24.677e-3325.19acyl-CoA synthetase short chain family member 2 [S... [more]
cpa53.902e-1430.52carboxypeptidase A5 [Source:ZFIN;Acc:ZDB-GENE-0205... [more]
ENSPMAT00000005866.12.803e-949.06pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gen... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ACS21.334e-7428.30Acetyl-coA synthetase isoform; along with Acs1p, a... [more]
ACS16.286e-7427.04Acetyl-coA synthetase isoform; along with Acs2p, a... [more]
ECM141.954e-2727.39Putative metalloprotease with similarity to zinc c... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492931.584e-14036.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391351.162e-6930.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420846.087e-6327.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469541.273e-3026.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433051.692e-2825.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss32.624e-13436.13acyl-CoA synthetase short chain family member 3 [S... [more]
acss34.554e-12637.23acyl-CoA synthetase short chain family member 3 [S... [more]
acss36.811e-12235.34acyl-CoA synthetase short chain family member 3 [S... [more]
acss31.602e-11435.53acyl-CoA synthetase short chain family member 3 [S... [more]
acss25.335e-6528.12acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043657.10.000e+098.13SMESG000043657.1[more]
SMESG000043661.10.000e+099.38SMESG000043661.1[more]
SMESG000043645.11.217e-16640.31SMESG000043645.1[more]
SMESG000043650.11.325e-16440.06SMESG000043650.1[more]
SMESG000043630.12.055e-16339.31SMESG000043630.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002393 ID=SMED30002393|Name=Acyl-CoA synthetase short chain family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3336bp
ATGAAACTAAGTGAAAACGTTTTGGGAATAATATTTGCAGGCTTATTCAA
TACATTTTGCACCGTAAAGTAAGCTGGACCCAGTGATTTGGTTTTTTGCT
CCGCAATAAATTGAATTGGATTAATTTATTTTTCAATTTCCGTTTTTGCC
TTTTTGAATCAAAACAAGTTGTTTAAGCTGTCACATTTTGGTTGATTTAT
CTAAGAAAACAAATGGTCAGTCAGTGTTATTAAAACAAAAAACTGACATA
GCCTTCCTGTTGAATCAATCGGTTCCGGTTAAAGAAATTCTAATTTTCGA
ATTCATTAAAATATTTTTACTTATTTTTTTAAATTTAATTAATTGAAATT
GTTTTGATTATTTAAAAATGTATTTTCAGTTCCAATGTGGTCATCGAAAT
TGTTCCAAAGTTTTCATCAGAATTAATTGTCCTAAAGTCACTAGCAAATG
ATCAAGTTCTGCTGTCAGACAAACCACTTGTGAACAAAACCCTTCATGTC
TCAATGGGAACTAGTAAATGGAGAAATACTATTCATAATTTATTAACAGA
AAATAATATTCAATTTCGTCTTTTTCAAGAACACGAGTTAAAAAAATTTT
TACGTATTAAAAGATCAGAAGATGATGAAAAATATTTAACATGGGACGAG
TTCGAAAACTGGATTAGAATGCTAAAATCAACTCGGAATTCACTAGTAAA
AATCAGTGTTTTGGGAAAGTCTTTTGAAAGTCGAAACATTTACTCAATAA
AATTAGGAGAAAATATTCAGGCTCCAAATGTTCTGCTTGATTCTGGCAGT
CATGCAAGAGAATGGCTTTCAATAGCCTCGCTAGTTGGAACAATTAAAAT
AATTTTAAACGACCTTAACCAACCGGGAGAAGATGGATTATGGAAAGGCA
TTCTCAGGAAGTGGAATATCTATTTTGTTCCGGTTCTAAATCCTGACGGA
TATTTTCATTCAATGAAGAGTTTAGAAAACAGATTCTGGAGGAAAAATAG
ACAATTGAATGTAGACAGTAATTGTACAGGAGTGGATATTAACAGAAATT
ACCCGATTGGATTTACAGAAAACAATGACCCATGCCAAGAGGATTTTCCT
GGTGGAGCACCTTTCACAACTTTAGAATCGCAAAGTTTGCGAAAAATTGT
TTCATCTATTCAATCAAATCTGAAACTTTACGTTTCCCTTCATTGCTATG
GACAATTTATCCTTCTTCCTTGGGCATATAAAAATGAAAAAGTGTCAGAT
CACACAAACTTGGTGAAGCTAGCAAATGATATTCAAAAAACCATGTTCAG
GGTTGGTAATAAAAATTTCAAGGTCGGAACCCCTGGTGAGCTATTGTATC
TAGATTTTGAAGCAGTTTATAATTCATCTGTTCTTAATCCGGATTTGTTC
TGGAACGAAGCTGCGAAGCAGGTGACCTGGACCAAACCATATGTTTCTAT
TATAGAAGGCAAATATTTTCCTTCACCAAAATGGTTTGTCGGTGGAGAAC
TAAACCTTTGTTACAATTGTTTGGATAAGCAGATTGAAGAAGGTCACGGA
GACGAAACGGCAGTAATATATGAGAGTCCAGTGTCGAAGAAGATAAAATA
TTATACATACAATGAATTATTGAAATCGGTGGAATTAGTTGCGGGAATAA
TGGTTGAAAAATGTGGAATTGAAACTGGGGATAATGTCTTCATTTTCATG
CCCATCATTCCGGAATGTCTGATTGCAATGCTTGCCTGTGCAAGGATCGG
TGCTGTTTATAGTACAACGTTTGGGGGGTTCGCAATAAAAGAGGTCAGCG
TGAGAATTAACCATTTTCAGCCTAAACTAGTTTTTACCTCAAACGTTGGG
GTAACTCGAAAAGAAATAATTAACTATAAAAAGAGAATGGACCTAGCAAT
TGAGCTTAGTGGGCTGGATGTAAAATTTTGTGTTGTATATGATCTACCGG
ATTACGAACCAGCAGTTTTGGTTAGAGGTAGAGATTTCAATTGGAATTCG
GAAATTTTGAAAGTTCAACCCCAAAAACCAAGACCAGTAAAATCAGACCA
CCCTTCATTTGTCATCTACACCTCTGGGACAACAGGAGATTCGAAGGGGT
TGGTAATTGAAACCGGAGGATTATGTGTTGTTAGCAAGTTTTCTATGAAC
GCGTACACAGGATTGATACCGAGAGAAACATTCTTTTGTATGAGTGGTTT
CTCATGGATACTCGGGCAATCTATCCTTTGTTATGGGCCTTTGATGAGTC
GAAATATCACAATTATTTATGATGACCAACCAACGGAAAGATCTCACTTG
GTCGAAATTCTAAGAATCCTTAAATGTCATAAAGTTGTAGCACTAATTTG
CCCTCCTACCATCATGAGACTTTTCCGGAAATTCTGTAATATTGAAGATT
TTGAGAACAAAACTGAGTTCTTAAAATCTATAAACTTAATAGGAGAAATC
ACTAATAAAGAAACAATGGATTGGGTACATGACAAGTTCCAGTGTCTTGT
TTATAATTCATGGGGTCAAACGGAACTGGGAAATTTTGGAACTTCGCCTT
GTTTGGGATTCAAGAGATCAACGAGTGTTCATGGAGAAGGATTCCAAAGT
ACACTCTGCCCGGGATATATTGGTAAAATAGTTGATCGAGAATCAGGAGT
TGTATTGCCAATTGGAGAAAAGGGGAGATTTGTTCTTAAATTGCCTCTCA
GTCCGACAGCTGCTAAAACTTTATATAGGAATCATGAAAGATTTATTAAA
TTGTATTTTAGCAGATATCCTGGATACTACGACACAATGGATAGCGCCAT
AATGGATGTGGATAATAATGTAAAGATTTTGTCGAGGGATGATAATATAA
TACATGTGGCGTCTGCTCGAATAGATGGGTGGGCTGTTGGAGAAGCCTGC
TTACAAAATCCTGACCTCGAGCATGTTTCAATCGTGGCCTTAGAAGACCC
AATAAAAGGATTTGTACCATTCGGATTTTTGATGCCTCACAATTATGATG
CTTCAAAAGCAAAAGAAATTGTTAAAGAGACTGTTAAATATGTTTATAAT
ACTGTTGGAGAGGTAGCTTCATTTGAACAAGCTGTGGTCGTTCCAAAAAT
CCCGAAAAGTGTAAATGGGAAAACGCTAAAAAATTCATTGGAAGCTATGA
TTAATGGAAAGCCATTTAAAATTCCTGCCATGAGTGATGACCACGAAGTG
TATTGCGTTATACACGACATTCTTAAAAGATCAGGTTATCAACCCAGTTA
TCCGATGTCATAGGTCTTCAAATTTACGAAAGGAATAACTCTAAATTGTT
TGGGAAATATTTTCTTTGGAAATAATTATTAATGCT
back to top

protein sequence of SMED30002393-orf-1

>SMED30002393-orf-1 ID=SMED30002393-orf-1|Name=SMED30002393-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=920bp
MGTSKWRNTIHNLLTENNIQFRLFQEHELKKFLRIKRSEDDEKYLTWDEF
ENWIRMLKSTRNSLVKISVLGKSFESRNIYSIKLGENIQAPNVLLDSGSH
AREWLSIASLVGTIKIILNDLNQPGEDGLWKGILRKWNIYFVPVLNPDGY
FHSMKSLENRFWRKNRQLNVDSNCTGVDINRNYPIGFTENNDPCQEDFPG
GAPFTTLESQSLRKIVSSIQSNLKLYVSLHCYGQFILLPWAYKNEKVSDH
TNLVKLANDIQKTMFRVGNKNFKVGTPGELLYLDFEAVYNSSVLNPDLFW
NEAAKQVTWTKPYVSIIEGKYFPSPKWFVGGELNLCYNCLDKQIEEGHGD
ETAVIYESPVSKKIKYYTYNELLKSVELVAGIMVEKCGIETGDNVFIFMP
IIPECLIAMLACARIGAVYSTTFGGFAIKEVSVRINHFQPKLVFTSNVGV
TRKEIINYKKRMDLAIELSGLDVKFCVVYDLPDYEPAVLVRGRDFNWNSE
ILKVQPQKPRPVKSDHPSFVIYTSGTTGDSKGLVIETGGLCVVSKFSMNA
YTGLIPRETFFCMSGFSWILGQSILCYGPLMSRNITIIYDDQPTERSHLV
EILRILKCHKVVALICPPTIMRLFRKFCNIEDFENKTEFLKSINLIGEIT
NKETMDWVHDKFQCLVYNSWGQTELGNFGTSPCLGFKRSTSVHGEGFQST
LCPGYIGKIVDRESGVVLPIGEKGRFVLKLPLSPTAAKTLYRNHERFIKL
YFSRYPGYYDTMDSAIMDVDNNVKILSRDDNIIHVASARIDGWAVGEACL
QNPDLEHVSIVALEDPIKGFVPFGFLMPHNYDASKAKEIVKETVKYVYNT
VGEVASFEQAVVVPKIPKSVNGKTLKNSLEAMINGKPFKIPAMSDDHEVY
CVIHDILKRSGYQPSYPMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR000834Peptidase_M14
IPR000873AMP-dep_Synth/Lig
IPR032387ACAS_N
IPR025110AMP-bd_C
IPR020845AMP-binding_CS
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0003987acetate-CoA ligase activity
GO:0005524ATP binding
GO:0016208AMP binding
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0008152metabolic process
GO:0019427acetyl-CoA biosynthetic process from acetate
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000834Peptidase M14, carboxypeptidase APRINTSPR00765CRBOXYPTASEAcoord: 227..240
score: 29.26
coord: 91..105
score: 37.18
coord: 176..184
score: 62.82
coord: 70..82
score: 33.73
IPR000834Peptidase M14, carboxypeptidase ASMARTSM00631zn_carbcoord: 44..323
e-value: 2.3E-43
score: 160.1
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 51..266
e-value: 2.6E-43
score: 148.9
IPR000834Peptidase M14, carboxypeptidase APROSITEPS00132CARBOXYPEPT_ZN_1coord: 91..113
IPR025110AMP-binding enzyme, C-terminal domainPFAMPF13193AMP-binding_Ccoord: 798..873
e-value: 2.4E-5
score: 25.2
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 317..778
e-value: 4.3E-60
score: 205.6
IPR032387Acetyl-coenzyme A synthetase, N-terminal domainPFAMPF16177ACAS_Ncoord: 286..339
e-value: 1.0E-17
score: 63.7
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 346..785
e-value: 1.2E-56
score: 192.2
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 782..908
e-value: 1.8E-6
score: 30.0
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 34..291
e-value: 2.7E-64
score: 219.3
NoneNo IPR availablePANTHERPTHR43347FAMILY NOT NAMEDcoord: 284..907
NoneNo IPR availableCDDcd05967PrpEcoord: 285..903
e-value: 0.0
score: 571.952
NoneNo IPR availableCDDcd03860M14_CP_A-B_likecoord: 44..283
e-value: 4.05656E-65
score: 218.935
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 275..886
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 40..285
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 520..531