ADP-ribosylation factor-like protein 15

Overview
NameADP-ribosylation factor-like protein 15
Smed IDSMED30002379
Length (bp)794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor-like protein 15 (SMED30002379) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 15 (SMED30002379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor-like protein 15 (SMED30002379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 15 (SMED30002379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002379SMESG000061183.1 SmedASXL_009093SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002379SMESG000061183.1 dd_Smed_v4_15424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002379SMESG000061183.1 dd_Smed_v6_15424_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002379SMESG000061183.1 dd_Smed_v4_15424_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Human
Match: ARL15 (ADP ribosylation factor like GTPase 15 [Source:HGNC Symbol;Acc:HGNC:25945])

HSP 1 Score: 78.1814 bits (191), Expect = 2.567e-17
Identity = 43/151 (28.48%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS---LENFEESDESFSIINEV 565
            Y  ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N IL++KELGG DN+R++WS Y+   + +I V+         D  S++         LH+   +P L  +    L N ++   + S+  ++
Sbjct:   15 YLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVL---------DSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEKI 156          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Human
Match: ARL15 (ADP ribosylation factor like GTPase 15 [Source:HGNC Symbol;Acc:HGNC:25945])

HSP 1 Score: 77.7962 bits (190), Expect = 1.036e-16
Identity = 40/132 (30.30%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISL 517
            Y  ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N IL++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +  
Sbjct:   15 YLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLEAARNE------LHSALQHPQLCTLPF 137          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Human
Match: ARL15 (ADP ribosylation factor like GTPase 15 [Source:HGNC Symbol;Acc:HGNC:25945])

HSP 1 Score: 77.7962 bits (190), Expect = 1.090e-16
Identity = 40/130 (30.77%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVII 511
            Y  ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N IL++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +
Sbjct:   15 YLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLEAARNE------LHSALQHPQLCTL 135          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Human
Match: ARF4 (ADP ribosylation factor 4 [Source:HGNC Symbol;Acc:HGNC:655])

HSP 1 Score: 72.4034 bits (176), Expect = 1.589e-15
Identity = 38/99 (38.38%), Postives = 60/99 (60.61%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHN 481
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI  EV+++ +KM+ +  L +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQ-EVADELQKMLLVDELRD 118          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Human
Match: ARF4 (ADP ribosylation factor 4 [Source:HGNC Symbol;Acc:HGNC:655])

HSP 1 Score: 72.4034 bits (176), Expect = 5.752e-15
Identity = 38/99 (38.38%), Postives = 60/99 (60.61%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHN 481
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI  EV+++ +KM+ +  L +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQ-EVADELQKMLLVDELRD 118          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Celegans
Match: arf-1.1 (ADP-ribosylation factor 1-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94231])

HSP 1 Score: 70.8626 bits (172), Expect = 8.655e-15
Identity = 32/85 (37.65%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  179 CNALCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            C  L +GL   GK+ +L  L   E +NT PTIGFNV+ +      L++ ++GG+  +R  W +YF N  +L+ V+  SD  RI +
Sbjct:   18 CRTLMLGLDGAGKTTILYKLKLNETVNTIPTIGFNVETVTFQKITLTVWDVGGQKKIRALWKYYFPNTTTLVFVVDSSDIERIPE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 70.0922 bits (170), Expect = 1.465e-14
Identity = 37/93 (39.78%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI +E   +  KM+N
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERI-EESREELHKMLN 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 67.0106 bits (162), Expect = 1.981e-13
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+ +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 67.0106 bits (162), Expect = 1.981e-13
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+ +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 67.0106 bits (162), Expect = 1.981e-13
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+ +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Fly
Match: Arf102F (gene:FBgn0013749 transcript:FBtr0333699)

HSP 1 Score: 68.5514 bits (166), Expect = 8.060e-14
Identity = 37/110 (33.64%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS 514
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI++     +R++ N+    +E    +L++ +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEA----ERELQNMLQ-EDELRDAVLLVFA 125          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Fly
Match: Arf102F (gene:FBgn0013749 transcript:FBtr0089192)

HSP 1 Score: 68.5514 bits (166), Expect = 8.060e-14
Identity = 37/110 (33.64%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS 514
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI++     +R++ N+    +E    +L++ +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEA----ERELQNMLQ-EDELRDAVLLVFA 125          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 67.3958 bits (163), Expect = 1.932e-13
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 67.3958 bits (163), Expect = 1.932e-13
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 67.3958 bits (163), Expect = 1.932e-13
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Zebrafish
Match: arl15a (ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:ZDB-GENE-070209-3])

HSP 1 Score: 87.8113 bits (216), Expect = 1.444e-20
Identity = 47/161 (29.19%), Postives = 87/161 (54.04%), Query Frame = 2
Query:   77 MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAAL-NKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEF-NYPLLVIISLENFEESDESFSI 553
            M ++   +  +CRI  Y   + +CC       P  + +C+GL+  GK+ +L+ L N+ +  T PT GF++KA+  +N IL++KELGG + ++++WS Y+   + ++ V+  +     SDE     R  +++   H +    P LV   L N ++S  + S+
Sbjct:    1 MSEHIQLSVALCRIGFYTCLQKLCCKAPPPPRPEYDVVCIGLSGAGKTSLLSRLCNEISDGTVPTTGFSIKAVPFENAILNVKELGGAETIKKYWSRYYQGSQGVVFVLNSA----ASDEEMEASRSELHLALQHPQLCTLPFLV---LANHQDSPAARSV 154          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Zebrafish
Match: arl15a (ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:ZDB-GENE-070209-3])

HSP 1 Score: 87.8113 bits (216), Expect = 1.444e-20
Identity = 47/161 (29.19%), Postives = 87/161 (54.04%), Query Frame = 2
Query:   77 MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAAL-NKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEF-NYPLLVIISLENFEESDESFSI 553
            M ++   +  +CRI  Y   + +CC       P  + +C+GL+  GK+ +L+ L N+ +  T PT GF++KA+  +N IL++KELGG + ++++WS Y+   + ++ V+  +     SDE     R  +++   H +    P LV   L N ++S  + S+
Sbjct:    1 MSEHIQLSVALCRIGFYTCLQKLCCKAPPPPRPEYDVVCIGLSGAGKTSLLSRLCNEISDGTVPTTGFSIKAVPFENAILNVKELGGAETIKKYWSRYYQGSQGVVFVLNSA----ASDEEMEASRSELHLALQHPQLCTLPFLV---LANHQDSPAARSV 154          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Zebrafish
Match: arl15b (ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:ZDB-GENE-080813-2])

HSP 1 Score: 80.1073 bits (196), Expect = 2.161e-18
Identity = 41/144 (28.47%), Postives = 76/144 (52.78%), Query Frame = 2
Query:  134 YKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS---LENFEESDESFSI 553
            ++T+CC       P  + +C+GL   GK+ +L+ L  E   N  PT GF++KA+   N IL++KELGG D+++++WS Y+   + ++ V+         D  S+++   +    LH+   +P L  +    L N ++   + S+
Sbjct:    6 FRTLCCKGPPPPRPEYDVVCIGLTGSGKTSLLSRLCSEATDNIVPTTGFSIKAVPFQNAILNVKELGGADSIKKYWSRYYQGSQGVVFVL---------DSASSEEDLEVARTELHSALQHPQLCTLPFLILANHQDKPAARSV 140          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Zebrafish
Match: arl15a (ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:ZDB-GENE-070209-3])

HSP 1 Score: 78.5666 bits (192), Expect = 1.896e-17
Identity = 42/141 (29.79%), Postives = 78/141 (55.32%), Query Frame = 2
Query:  137 KTICCVPDIKYLPVCNALCVGLANVGKSRMLAAL-NKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEF-NYPLLVIISLENFEESDESFSI 553
            + +CC       P  + +C+GL+  GK+ +L+ L N+ +  T PT GF++KA+  +N IL++KELGG + ++++WS Y+   + ++ V+  +     SDE     R  +++   H +    P LV   L N ++S  + S+
Sbjct:   18 QKLCCKAPPPPRPEYDVVCIGLSGAGKTSLLSRLCNEISDGTVPTTGFSIKAVPFENAILNVKELGGAETIKKYWSRYYQGSQGVVFVLNSA----ASDEEMEASRSELHLALQHPQLCTLPFLV---LANHQDSPAARSV 151          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Zebrafish
Match: arl15b (ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:ZDB-GENE-080813-2])

HSP 1 Score: 80.1073 bits (196), Expect = 3.255e-17
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLL 502
            Y  ++T+CC       P  + +C+GL   GK+ +L+ L  E   N  PT GF++KA+   N IL++KELGG D+++++WS Y+   + ++ V+         D  S+++   +    LH+   +P L
Sbjct:   98 YLCFRTLCCKGPPPPRPEYDVVCIGLTGSGKTSLLSRLCSEATDNIVPTTGFSIKAVPFQNAILNVKELGGADSIKKYWSRYYQGSQGVVFVL---------DSASSEEDLEVARTELHSALQHPQL 215          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Xenopus
Match: arl15 (ADP ribosylation factor like GTPase 15 [Source:NCBI gene;Acc:493266])

HSP 1 Score: 85.1149 bits (209), Expect = 1.785e-19
Identity = 47/154 (30.52%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  104 GICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS---LENFEESDESFSI 553
             +CRI  Y  ++ +CC       P  + +C+GL   GK+ +L  L  E+  N  PT GF++KAI   + IL++KELGG  N+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +    L N ++   + SI
Sbjct:   15 AVCRIGIYTCFRALCCKGPPPPRPEYDIVCIGLTGSGKTSLLTQLCSESQENIVPTTGFSIKAIPFQSAILNVKELGGATNIRKYWSRYYQGSQGVIFVL---DSASSEDDLETARNE------LHSALQHPQLCTLPFLILANHQDKPAARSI 159          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Xenopus
Match: arl15 (ADP ribosylation factor like GTPase 15 [Source:NCBI gene;Acc:493266])

HSP 1 Score: 78.1814 bits (191), Expect = 4.631e-17
Identity = 44/147 (29.93%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS---LENFEESDESFSI 553
            Y  ++ +CC       P  + +C+GL   GK+ +L  L  E+  N  PT GF++KAI   + IL++KELGG  N+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +    L N ++   + SI
Sbjct:    3 YMCFRALCCKGPPPPRPEYDIVCIGLTGSGKTSLLTQLCSESQENIVPTTGFSIKAIPFQSAILNVKELGGATNIRKYWSRYYQGSQGVIFVL---DSASSEDDLETARNE------LHSALQHPQLCTLPFLILANHQDKPAARSI 140          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Xenopus
Match: arl15 (ADP ribosylation factor like GTPase 15 [Source:NCBI gene;Acc:493266])

HSP 1 Score: 76.6406 bits (187), Expect = 1.881e-16
Identity = 43/144 (29.86%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  134 YKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS---LENFEESDESFSI 553
            ++ +CC       P  + +C+GL   GK+ +L  L  E+  N  PT GF++KAI   + IL++KELGG  N+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +    L N ++   + SI
Sbjct:    8 FRALCCKGPPPPRPEYDIVCIGLTGSGKTSLLTQLCSESQENIVPTTGFSIKAIPFQSAILNVKELGGATNIRKYWSRYYQGSQGVIFVL---DSASSEDDLETARNE------LHSALQHPQLCTLPFLILANHQDKPAARSI 142          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:NCBI gene;Acc:595036])

HSP 1 Score: 69.707 bits (169), Expect = 4.817e-14
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI  E + + +KM+ 
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQ-EAAEELQKMLQ 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Xenopus
Match: fibp (fibroblast growth factor (acidic) intracellular binding protein [Source:Xenbase;Acc:XB-GENE-481175])

HSP 1 Score: 66.6254 bits (161), Expect = 6.177e-13
Identity = 32/82 (39.02%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+++
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Mouse
Match: Arl15 (ADP-ribosylation factor-like 15 [Source:MGI Symbol;Acc:MGI:2442308])

HSP 1 Score: 77.7962 bits (190), Expect = 7.562e-17
Identity = 39/132 (29.55%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISL 517
            Y  ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N +L++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +  
Sbjct:   15 YLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVPFQNAVLNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLETARNE------LHSALQHPQLCTLPF 137          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Mouse
Match: Arf5 (ADP-ribosylation factor 5 [Source:MGI Symbol;Acc:MGI:99434])

HSP 1 Score: 69.707 bits (169), Expect = 4.651e-14
Identity = 35/93 (37.63%), Postives = 56/93 (60.22%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+  E +++ +KM+ 
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQ-ESADELQKMLQ 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Mouse
Match: Arf5 (ADP-ribosylation factor 5 [Source:MGI Symbol;Acc:MGI:99434])

HSP 1 Score: 69.707 bits (169), Expect = 4.651e-14
Identity = 35/93 (37.63%), Postives = 56/93 (60.22%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+  E +++ +KM+ 
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQ-ESADELQKMLQ 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Mouse
Match: Arf4 (ADP-ribosylation factor 4 [Source:MGI Symbol;Acc:MGI:99433])

HSP 1 Score: 67.781 bits (164), Expect = 2.137e-13
Identity = 33/85 (38.82%), Postives = 50/85 (58.82%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVS 439
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI +  +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAA 105          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Mouse
Match: Arf4 (ADP-ribosylation factor 4 [Source:MGI Symbol;Acc:MGI:99433])

HSP 1 Score: 67.781 bits (164), Expect = 2.137e-13
Identity = 33/85 (38.82%), Postives = 50/85 (58.82%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVS 439
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI +  +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAA 105          
BLAST of ADP-ribosylation factor-like protein 15 vs. UniProt/SwissProt
Match: sp|Q5RFN0|ARL15_PONAB (ADP-ribosylation factor-like protein 15 OS=Pongo abelii OX=9601 GN=ARL15 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.650e-16
Identity = 44/149 (29.53%), Postives = 76/149 (51.01%), Query Frame = 2
Query:   68 DLYMGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVII 511
            DL M + F +   +C       ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N IL++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +
Sbjct:    3 DLRMTEAFLYMDYLC-------FRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLEAARNE------LHSALQHPQLCTL 135          
BLAST of ADP-ribosylation factor-like protein 15 vs. UniProt/SwissProt
Match: sp|Q5EA19|ARL15_BOVIN (ADP-ribosylation factor-like protein 15 OS=Bos taurus OX=9913 GN=ARL15 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.108e-16
Identity = 42/149 (28.19%), Postives = 77/149 (51.68%), Query Frame = 2
Query:   68 DLYMGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNTE-PTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVII 511
            DL + + F +   +C       ++ +CC       P  + +C+GL   GK+ +L+ L  E+ ++   T GF++KA+   N IL++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +
Sbjct:    3 DLRISEAFLYMDYLC-------FRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDSVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLETARNE------LHSALQHPQLCTL 135          
BLAST of ADP-ribosylation factor-like protein 15 vs. UniProt/SwissProt
Match: sp|Q9NXU5|ARL15_HUMAN (ADP-ribosylation factor-like protein 15 OS=Homo sapiens OX=9606 GN=ARL15 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.975e-16
Identity = 40/132 (30.30%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISL 517
            Y  ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N IL++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +  
Sbjct:   15 YLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLEAARNE------LHSALQHPQLCTLPF 137          
BLAST of ADP-ribosylation factor-like protein 15 vs. UniProt/SwissProt
Match: sp|Q8BGR6|ARL15_MOUSE (ADP-ribosylation factor-like protein 15 OS=Mus musculus OX=10090 GN=Arl15 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.290e-16
Identity = 39/132 (29.55%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  125 YKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENL-NTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISL 517
            Y  ++ +CC       P  + +C+GL   GK+ +L+ L  E+  N   T GF++KA+   N +L++KELGG DN+R++WS Y+   + +I V+   D     D++   + +      LH+   +P L  +  
Sbjct:   15 YLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVPFQNAVLNVKELGGADNIRKYWSRYYQGSQGVIFVL---DSASSEDDLETARNE------LHSALQHPQLCTLPF 137          
BLAST of ADP-ribosylation factor-like protein 15 vs. UniProt/SwissProt
Match: sp|Q5RCF1|ARF4_PONAB (ADP-ribosylation factor 4 OS=Pongo abelii OX=9601 GN=ARF4 PE=2 SV=3)

HSP 1 Score: 72.4034 bits (176), Expect = 2.762e-14
Identity = 38/99 (38.38%), Postives = 60/99 (60.61%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHN 481
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  RI  EV+++ +KM+ +  L +
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQ-EVADELQKMLLVDELRD 118          
BLAST of ADP-ribosylation factor-like protein 15 vs. TrEMBL
Match: A0A1W2WEZ8 (ADP-ribosylation factor-like protein 15 OS=Ciona intestinalis OX=7719 GN=LOC100185439 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.237e-27
Identity = 60/178 (33.71%), Postives = 98/178 (55.06%), Query Frame = 2
Query:   77 MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNTE-PTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEV-LGESLNHDKSILL 604
            M ++ S   G CR  C   +  ICC      LPV N +C+G+ N GKS +L  L  EN +T  PT+GFNVK I+L N +L +KELGG DN+R +W  Y+  ++ ++ V+     H   D++   + ++M   N     + P L++ + ++ E +    S+I E+ L   +  ++SIL+
Sbjct:    1 MAEHGSVCCGACRFLCCSMFHCICCKDSPPELPVYNVICIGITNSGKSTLLKVLTHENSDTVVPTVGFNVKDIRLPNAVLKVKELGGGDNIRPYWGRYYTGVQGVVFVIDGMSTH---DKLEELRPELMKALNSPELRSKPWLILCNKQDLEGASTDESVIEELQLRSRMKENESILV 175          
BLAST of ADP-ribosylation factor-like protein 15 vs. TrEMBL
Match: A0A0B6YVP5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF36561 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.959e-26
Identity = 59/160 (36.88%), Postives = 92/160 (57.50%), Query Frame = 2
Query:   77 MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSI 553
            M ++F   G +CR+  Y  Y+ ICC       P    LC+GL N GKS +LA L++++L+  EPTIGF++KAI  D+CIL +KELGG D VR +W  Y+   + +I V+   D     +++   K ++ N        + PLL+   L NF++ +E+ S+
Sbjct:    1 MCESFRIVGALCRVGLYALYRRICCKGPSPVRPNFAVLCIGLENAGKSSLLAILSEDDLHKIEPTIGFSIKAILFDDCILEVKELGGGDKVRPYWDRYYQVFQGIIFVI---DSSSSEEKLQIAKTELFNAVKHQQLKSLPLLI---LANFQDKEEARSV 154          
BLAST of ADP-ribosylation factor-like protein 15 vs. TrEMBL
Match: A0A2C9JWP1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106070969 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.310e-23
Identity = 55/166 (33.13%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  104 GICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENF------EESDESFSIINEVLGESL 580
             +CR+  Y  Y+ +CC       P    LC+GL N GKS +LA L+ ++L+  EPTIGF++KAI  ++CIL +KELGG D VR +W  Y+   + +I V+  S    +   +   K ++ N    H   + PLL++ + ++       EE  +   I  E+ G  +
Sbjct:   10 ALCRVGLYALYRRLCCKGPSPTRPNFTVLCIGLENAGKSSILATLSGDDLHKIEPTIGFSIKAILFEDCILDVKELGGGDKVRPYWERYYQVFQGIIFVIDSSSSEEL---LQTAKSELHNAARHHQLKSLPLLILATFQDVKGARTPEELSQFLEIETELTGRQV 172          
BLAST of ADP-ribosylation factor-like protein 15 vs. TrEMBL
Match: A0A3M6U8G7 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00013952 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.992e-23
Identity = 53/148 (35.81%), Postives = 90/148 (60.81%), Query Frame = 2
Query:   83 QNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKE-NLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLEN 523
            Q  S A  ICRI C++ Y+T+CC       P  + + +GL+  GKS + A L+ + +   EPT+GF+VKA++L + IL++KELGG DNVR++W HYF   + ++ V+  S C+   D+V     ++  + +  +  + PLLV+ + ++
Sbjct:    6 QWCSLAYAICRIGCFRCYQTVCCKEPSTPRPSYSVIAIGLSQAGKSMLFAKLSGDASEKLEPTVGFSVKAVQLPSAILNVKELGGGDNVRKYWPHYFGGAQGIVFVVD-SCCN--DDDVDLAAAELQEVLSHSSLESLPLLVLANKQD 150          
BLAST of ADP-ribosylation factor-like protein 15 vs. TrEMBL
Match: F7AZ78 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 6.448e-23
Identity = 56/165 (33.94%), Postives = 93/165 (56.36%), Query Frame = 2
Query:  116 IFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNTE-PTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEV-LGESLNHDKSILL 604
            +F    +  ICC      LPV N +C+G+ N GKS +L  L  EN +T  PT+GFNVK I+L N +L +KELGG DN+R +W  Y+  ++ ++ V+     H   +E+  +  K +N   L ++   P L++ + ++ E +    S+I E+ L   +  ++SIL+
Sbjct:   13 LFSCSMFHCICCKDSPPELPVYNVICIGITNSGKSTLLKVLTHENSDTVVPTVGFNVKDIRLPNAVLKVKELGGGDNIRPYWGRYYTGVQGVVFVIDGMSTHDKLEELRPELMKALNSPELRSK---PWLILCNKQDLEGASTDESVIEELQLRSRMKENESILV 174          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Cavefish
Match: arl15a (ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:ZDB-GENE-070209-3])

HSP 1 Score: 91.2781 bits (225), Expect = 4.244e-22
Identity = 47/161 (29.19%), Postives = 88/161 (54.66%), Query Frame = 2
Query:   77 MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEF-NYPLLVIISLENFEESDESFSI 553
            M ++      +CRI  Y   +T+CC       P  + +C+GL+  GK+ +L+ L  E ++   PT GF++KA+   N +L++KELGG DN++++WS Y+   + ++ V+  +    +SDE     R  +++   H +    P L+   L N ++S ++ S+
Sbjct:    1 MSEHIQLTIALCRIGFYTCLRTLCCKGPPTPRPEYDVVCIGLSGAGKTALLSRLCSEGIDGIVPTTGFSIKAVPFPNAVLNVKELGGSDNIKKYWSRYYQGTQGVVFVLDST----VSDEEMAACRSELHLALQHPQLCTLPFLI---LANHQDSPDARSV 154          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Cavefish
Match: arl15b (ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:ZDB-GENE-080813-2])

HSP 1 Score: 79.337 bits (194), Expect = 1.585e-17
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 2
Query:  116 IFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLL 502
            I+C++T   +CC       P  + +C+GL   GK+ +L+ L  E  ++  PT GF++KA+   N IL++KELGG D+++++WS Y+   + ++ V+         D  S+ +   +    LH+   +P L
Sbjct:   17 IYCFRT---LCCKGPPPPRPEYDVVCIGLTGSGKTSLLSKLCSEATDSIVPTTGFSIKAVPFQNAILNVKELGGADSIKKYWSRYYQGSQGVVFVL---------DSASSDEDLEVARTELHSALQHPQL 134          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Cavefish
Match: arf4a (ADP-ribosylation factor 4-like [Source:NCBI gene;Acc:103029097])

HSP 1 Score: 69.707 bits (169), Expect = 3.689e-14
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R + E + + +KM+ 
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER-AQEAAEELQKMLQ 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Cavefish
Match: ARF5 (ADP-ribosylation factor 4 [Source:NCBI gene;Acc:103041847])

HSP 1 Score: 68.1662 bits (165), Expect = 9.933e-14
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R++ E + +  KM+ 
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVA-ESAEELSKMLQ 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Cavefish
Match: ENSAMXT00000046201.1 (ADP-ribosylation factor 4-like [Source:NCBI gene;Acc:107197496])

HSP 1 Score: 68.1662 bits (165), Expect = 1.167e-13
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R++ E + +  KM+ 
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVA-ESAEELAKMLQ 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Sea Lamprey
Match: arl15b (ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:ZDB-GENE-080813-2])

HSP 1 Score: 95.9005 bits (237), Expect = 7.088e-25
Identity = 49/150 (32.67%), Postives = 81/150 (54.00%), Query Frame = 2
Query:   77 MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLEN 523
            M +    A  +CRI  Y  Y+ +CC       P  + +CVG+   GKS +LA L  E+++   PT GF++KAI L N IL++KELGG D +R++WS Y+   + LI V+   D   + D++   + ++    +       P L++ S ++
Sbjct:    6 MSECVQLACAVCRIGLYSCYRVLCCKGPPPARPEFDVVCVGMTGAGKSTLLAQLCGESIDDILPTAGFSIKAIPLQNVILNVKELGGGDAIRKYWSRYYQGSQGLIFVL---DSAAMEDDLEVARSELHAALHHPQLCTLPFLILASHQD 152          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006167.1 (pep scaffold:Pmarinus_7.0:GL487177:1661:9088:1 gene:ENSPMAG00000005571.1 transcript:ENSPMAT00000006167.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 2.509e-15
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R + E + + +KM+ 
Sbjct:   23 LTVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER-TQEAAEELQKMLQ 114          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 67.0106 bits (162), Expect = 5.633e-14
Identity = 32/82 (39.02%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+++
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 67.0106 bits (162), Expect = 6.888e-14
Identity = 32/82 (39.02%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+++
Sbjct:   20 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNE 101          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 67.0106 bits (162), Expect = 7.016e-14
Identity = 32/82 (39.02%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+++
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 69.707 bits (169), Expect = 4.586e-15
Identity = 45/129 (34.88%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEVLG 571
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HY+ N E +I V+  +D  RI  E     ++M+N   L N      LV  + ++  E+  S + I E LG
Sbjct:   21 LMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIG-EAREVMQRMLNEDELRNA---AWLVFANKQDLPEA-MSAAEITEKLG 144          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 69.3218 bits (168), Expect = 5.558e-15
Identity = 37/99 (37.37%), Postives = 56/99 (56.57%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHN 481
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HY+ N E +I V+  +D  RI  E     ++M+N   L N
Sbjct:   21 LMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIG-EAREVMQRMLNEDELRN 118          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 60.077 bits (144), Expect = 1.349e-11
Identity = 29/81 (35.80%), Postives = 50/81 (61.73%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRIS 427
            L +GL   GK+ +L  L   E + T+PTIGFNV+ +   N  L++ +LGG+ ++R +W  Y+ +  ++I V+  +D  R+S
Sbjct:   22 LILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMS 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 55.0694 bits (131), Expect = 7.243e-10
Identity = 27/82 (32.93%), Postives = 45/82 (54.88%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALNKENLNTE-PTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L +GL   GK+ +L  L    + T  PT+GFNV+ +   N   ++ ++GG+  +R  W HYF    +LI V+  S  +R+ +
Sbjct:   21 LMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Yeast
Match: CIN4 (GTP-binding protein involved in beta-tubulin (Tub2p) folding; isolated as mutant with increased chromosome loss and sensitivity to benomyl; regulated by the GTPase-activating protein, Cin2p, the human retinitis pigmentosa 2 (RP2) homolog [Source:SGD;Acc:S000004746])

HSP 1 Score: 54.299 bits (129), Expect = 1.742e-9
Identity = 32/114 (28.07%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  188 LCVGLANVGKS----RMLAALNKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISL 517
            L +GL N GKS    ++L    + N    PT+GF + ++ + +  +S+ ++GG+  +R FW +YF   +++I  + +S   R  DE   + ++++N     N   Y   VI+ L
Sbjct:   20 LILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIKDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRF-DETLQELKELIN--RDENRIGYECAVIVVL 130          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Nematostella
Match: EDO31167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP3])

HSP 1 Score: 82.0333 bits (201), Expect = 7.188e-19
Identity = 52/154 (33.77%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  107 ICRIFCYKTYKTICCV------PDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPL---LVIISLENFEESD 538
            + RI C++     CC       PD    P  + L +GL+  GKS MLA L+ E  +  +PT GF+VK ++L   IL++KELGG DNVR++W HYF   + +I V+         D  S+++   +    L     +P    L ++ L N E+ D
Sbjct:   14 VLRIGCFR-----CCQKLRGKKPDAPR-PEYSVLMIGLSGAGKSVMLAKLDSEPTDDIKPTQGFSVKPVQLPTAILNVKELGGGDNVRKYWQHYFEGAQGVIFVV---------DSTSSEEDLELAASELQTALCHPALDGLPLLVLANQEDKD 152          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Nematostella
Match: EDO32994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STE6])

HSP 1 Score: 70.0922 bits (170), Expect = 8.419e-15
Identity = 32/82 (39.02%), Postives = 56/82 (68.29%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L +GL N GK+ +L   N E++NT EPT+GFN+K ++  +  L+I ++GG+ ++R +W +YF + + LI V+  +D  R++D
Sbjct:   20 LMLGLDNAGKTTILKKFNGEDINTIEPTLGFNIKTLEHRDFKLNIWDVGGQRSLRSYWRNYFESTDGLIWVVDSADQRRLAD 101          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 68.1662 bits (165), Expect = 4.213e-14
Identity = 35/93 (37.63%), Postives = 54/93 (58.06%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+  E   +  +M+N
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVG-EAREELNRMLN 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 67.781 bits (164), Expect = 5.776e-14
Identity = 41/129 (31.78%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEVLG 571
            L VGL   GK+ +L  L   E + T PTIGFNV++++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+     N+ ++ +N     +E    ++++++ +    +  S S I E LG
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERV-----NESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLG 144          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Nematostella
Match: EDO38139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDV1])

HSP 1 Score: 67.781 bits (164), Expect = 7.038e-14
Identity = 39/111 (35.14%), Postives = 63/111 (56.76%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKL-DNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS 514
            L +GL   GK+ +L  L  KE +NT PT+ FNV+ I    N   S+ ++GG+D +R+ W HYF   E +I V+  +D  RI  EV  +  +++     H+E N   +V+++
Sbjct:   21 LMLGLDAAGKTTILYKLKLKETVNTVPTVAFNVETISPCKNITFSVWDIGGQDKIRRLWRHYFQGAEGIIFVVDSADKERIF-EVREELTRVLQ----HSELNGVPVVVVA 126          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Medaka
Match: arl15a (ADP ribosylation factor like GTPase 15 [Source:NCBI gene;Acc:101167124])

HSP 1 Score: 78.5666 bits (192), Expect = 2.499e-17
Identity = 39/129 (30.23%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  134 YKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNT-EPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISL 517
            ++ +CC       P  + +C+GL   GKS +L+ L  E+ +   PT GFN+KA+   N IL++KELGG DN++++W  Y+   + +I V+         D  S+ +   +    LH+   +P L  +  
Sbjct:   19 FRALCCKGPPPPRPEYDVVCIGLTGAGKSSLLSRLCSESSDDIGPTTGFNIKAVPFPNAILNVKELGGADNIKKYWCRYYQGSQGVIFVL---------DSASSNEDLEVARNELHSALQHPQLCTLPF 138          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Medaka
Match: ENSORLT00000030860.1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101167961])

HSP 1 Score: 68.1662 bits (165), Expect = 1.148e-13
Identity = 41/134 (30.60%), Postives = 70/134 (52.24%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEVLGESLNH 586
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+ +     K ++M +       +  LLV  + ++   +  +  I +++   SL H
Sbjct:   20 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGE----AKEELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLCLHSLRH 149          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Medaka
Match: ENSORLT00000042909.1 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 66.6254 bits (161), Expect = 4.288e-13
Identity = 32/82 (39.02%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+++
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Medaka
Match: arf3b (ADP-ribosylation factor 3 [Source:NCBI gene;Acc:101174416])

HSP 1 Score: 66.6254 bits (161), Expect = 4.288e-13
Identity = 32/82 (39.02%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISD 430
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+++
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNE 102          
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Medaka
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101155726])

HSP 1 Score: 67.0106 bits (162), Expect = 5.154e-13
Identity = 36/110 (32.73%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIIS 514
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+     N+ R+ ++     +E    +L++ +
Sbjct:   49 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV-----NEAREELSRMLAEDELRDAVLLVFA 153          
BLAST of ADP-ribosylation factor-like protein 15 vs. Planmine SMEST
Match: SMESG000061183.1 (SMESG000061183.1)

HSP 1 Score: 358.992 bits (920), Expect = 6.422e-127
Identity = 179/186 (96.24%), Postives = 180/186 (96.77%), Query Frame = 2
Query:  101 GGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEVLGESLNHDKSILLVVSDLIKDSERIKETMNI 658
              I  I  +KTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEVLGESLNHDKSILLVVSDLIKDSERIKETMNI
Sbjct:    9 SSIYFIITFKTYKTICCVPDIKYLPVCNALCVGLANVGKSRMLAALNKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENFEESDESFSIINEVLGESLNHDKSILLVVSDLIKDSERIKETMNI 194          
BLAST of ADP-ribosylation factor-like protein 15 vs. Planmine SMEST
Match: SMESG000070321.1 (SMESG000070321.1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.989e-14
Identity = 35/92 (38.04%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMM 460
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + +I V+  +D  RI  E +++  KM+
Sbjct:   17 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVIDSNDRERIG-EAADELHKML 107          
BLAST of ADP-ribosylation factor-like protein 15 vs. Planmine SMEST
Match: SMESG000070321.1 (SMESG000070321.1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.781e-14
Identity = 35/92 (38.04%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMM 460
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + +I V+  +D  RI  E +++  KM+
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVIDSNDRERIG-EAADELHKML 111          
BLAST of ADP-ribosylation factor-like protein 15 vs. Planmine SMEST
Match: SMESG000067743.1 (SMESG000067743.1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.533e-14
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + LI V+  +D  R+ +E   +  +M+N
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV-NEAREELMRMLN 112          
BLAST of ADP-ribosylation factor-like protein 15 vs. Planmine SMEST
Match: SMESG000000945.1 (SMESG000000945.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.780e-13
Identity = 34/93 (36.56%), Postives = 54/93 (58.06%), Query Frame = 2
Query:  188 LCVGLANVGKSRMLAALN-KENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVNLESLIIVMKISDCHRISDEVSNQKRKMMN 463
            L VGL   GK+ +L  L   E + T PTIGFNV+ ++  N   ++ ++GG+D +R  W HYF N + +I V+  +D  R+  E   +  +M+N
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQ-EAKEELSRMLN 112          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL152.567e-1728.48ADP ribosylation factor like GTPase 15 [Source:HGN... [more]
ARL151.036e-1630.30ADP ribosylation factor like GTPase 15 [Source:HGN... [more]
ARL151.090e-1630.77ADP ribosylation factor like GTPase 15 [Source:HGN... [more]
ARF41.589e-1538.38ADP ribosylation factor 4 [Source:HGNC Symbol;Acc:... [more]
ARF45.752e-1538.38ADP ribosylation factor 4 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf-1.18.655e-1537.65ADP-ribosylation factor 1-like 1 [Source:UniProtK... [more]
arf-31.465e-1439.78ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
arf-1.21.981e-1339.02ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.21.981e-1339.02ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.21.981e-1339.02ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf102F8.060e-1433.64gene:FBgn0013749 transcript:FBtr0333699[more]
Arf102F8.060e-1433.64gene:FBgn0013749 transcript:FBtr0089192[more]
Arf79F1.932e-1340.24gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F1.932e-1340.24gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F1.932e-1340.24gene:FBgn0010348 transcript:FBtr0299906[more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl15a1.444e-2029.19ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:... [more]
arl15a1.444e-2029.19ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:... [more]
arl15b2.161e-1828.47ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:... [more]
arl15a1.896e-1729.79ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:... [more]
arl15b3.255e-1730.71ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl151.785e-1930.52ADP ribosylation factor like GTPase 15 [Source:NCB... [more]
arl154.631e-1729.93ADP ribosylation factor like GTPase 15 [Source:NCB... [more]
arl151.881e-1629.86ADP ribosylation factor like GTPase 15 [Source:NCB... [more]
arf44.817e-1438.71ADP ribosylation factor 4 [Source:NCBI gene;Acc:59... [more]
fibp6.177e-1339.02fibroblast growth factor (acidic) intracellular bi... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl157.562e-1729.55ADP-ribosylation factor-like 15 [Source:MGI Symbol... [more]
Arf54.651e-1437.63ADP-ribosylation factor 5 [Source:MGI Symbol;Acc:M... [more]
Arf54.651e-1437.63ADP-ribosylation factor 5 [Source:MGI Symbol;Acc:M... [more]
Arf42.137e-1338.82ADP-ribosylation factor 4 [Source:MGI Symbol;Acc:M... [more]
Arf42.137e-1338.82ADP-ribosylation factor 4 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RFN0|ARL15_PONAB1.650e-1629.53ADP-ribosylation factor-like protein 15 OS=Pongo a... [more]
sp|Q5EA19|ARL15_BOVIN4.108e-1628.19ADP-ribosylation factor-like protein 15 OS=Bos tau... [more]
sp|Q9NXU5|ARL15_HUMAN4.975e-1630.30ADP-ribosylation factor-like protein 15 OS=Homo sa... [more]
sp|Q8BGR6|ARL15_MOUSE5.290e-1629.55ADP-ribosylation factor-like protein 15 OS=Mus mus... [more]
sp|Q5RCF1|ARF4_PONAB2.762e-1438.38ADP-ribosylation factor 4 OS=Pongo abelii OX=9601 ... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W2WEZ85.237e-2733.71ADP-ribosylation factor-like protein 15 OS=Ciona i... [more]
A0A0B6YVP51.959e-2636.88Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2C9JWP12.310e-2333.13Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3M6U8G75.992e-2335.81Uncharacterized protein OS=Pocillopora damicornis ... [more]
F7AZ786.448e-2333.94Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl15a4.244e-2229.19ADP-ribosylation factor-like 15a [Source:ZFIN;Acc:... [more]
arl15b1.585e-1730.00ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:... [more]
arf4a3.689e-1437.63ADP-ribosylation factor 4-like [Source:NCBI gene;A... [more]
ARF59.933e-1437.63ADP-ribosylation factor 4 [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000046201.11.167e-1337.63ADP-ribosylation factor 4-like [Source:NCBI gene;A... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl15b7.088e-2532.67ADP-ribosylation factor-like 15b [Source:ZFIN;Acc:... [more]
ENSPMAT00000006167.12.509e-1537.63pep scaffold:Pmarinus_7.0:GL487177:1661:9088:1 gen... [more]
arf2a5.633e-1439.02ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf16.888e-1439.02ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2a7.016e-1439.02ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF14.586e-1534.88ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF25.558e-1537.37ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARL11.349e-1135.80Soluble GTPase with a role in regulation of membra... [more]
ARF37.243e-1032.93Glucose-repressible ADP-ribosylation factor; GTPas... [more]
CIN41.742e-928.07GTP-binding protein involved in beta-tubulin (Tub2... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311677.188e-1933.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329948.419e-1539.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421564.213e-1437.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483595.776e-1431.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381397.038e-1435.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl15a2.499e-1730.23ADP ribosylation factor like GTPase 15 [Source:NCB... [more]
ENSORLT00000030860.11.148e-1330.60ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000042909.14.288e-1339.02ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf3b4.288e-1339.02ADP-ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf2b5.154e-1332.73ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061183.16.422e-12796.24SMESG000061183.1[more]
SMESG000070321.14.989e-1438.04SMESG000070321.1[more]
SMESG000070321.15.781e-1438.04SMESG000070321.1[more]
SMESG000067743.18.533e-1437.63SMESG000067743.1[more]
SMESG000000945.11.780e-1336.56SMESG000000945.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002379 ID=SMED30002379|Name=ADP-ribosylation factor-like protein 15|organism=Schmidtea mediterranea sexual|type=transcript|length=794bp
GTAACAGTGGCTTTTTAAATTGTCTATTAATAGCTAATGAATTATAATTG
TAATTTCTACATAATTTGATTTATATATGGGTCAAAATTTTTCGTTTGCT
GGAGGAATTTGTAGAATATTTTGTTATAAGACTTATAAAACTATTTGCTG
TGTGCCAGATATAAAGTATTTACCAGTTTGTAATGCATTATGTGTTGGAC
TGGCCAACGTTGGAAAGTCTCGAATGTTAGCTGCTTTAAATAAAGAAAAT
TTGAACACTGAACCAACTATTGGATTCAATGTAAAAGCCATTAAATTAGA
CAATTGTATTCTCAGTATCAAAGAGTTAGGAGGCGAAGACAATGTTCGAC
AATTTTGGTCTCATTATTTTGTGAATTTGGAATCTTTAATCATTGTCATG
AAGATATCAGACTGCCATCGGATCTCTGACGAAGTTTCAAATCAAAAACG
TAAAATGATGAACATTTTTAATTTACACAATGAATTCAATTATCCTTTAT
TGGTCATAATTTCGTTAGAAAACTTTGAGGAGTCCGACGAATCCTTCTCG
ATAATCAACGAAGTGCTTGGTGAATCTCTCAACCATGATAAGTCAATATT
ACTCGTCGTTTCTGACTTAATAAAGGACTCTGAGAGAATTAAAGAAACTA
TGAACATATTCTGTTTTAAATTTTTGTTGTTTTAATTGTGCTTTAATAGA
ACTGTAACTAGTCTACATGTGAATACTGGGTTGGCAATCAAATGTCCGAT
CAGATGTAATAAATGCCCAAGAAGCAGATTAATTCCCTTGTTTC
back to top

protein sequence of SMED30002379-orf-1

>SMED30002379-orf-1 ID=SMED30002379-orf-1|Name=SMED30002379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=203bp
MGQNFSFAGGICRIFCYKTYKTICCVPDIKYLPVCNALCVGLANVGKSRM
LAALNKENLNTEPTIGFNVKAIKLDNCILSIKELGGEDNVRQFWSHYFVN
LESLIIVMKISDCHRISDEVSNQKRKMMNIFNLHNEFNYPLLVIISLENF
EESDESFSIINEVLGESLNHDKSILLVVSDLIKDSERIKETMNIFCFKFL
LF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042292ARL15
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 12..192
e-value: 0.0014
score: 5.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 36..195
e-value: 5.5E-19
score: 70.3
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 37..183
e-value: 5.9E-20
score: 71.4
IPR042292ADP-ribosylation factor-like protein 15PANTHERPTHR46693FAMILY NOT NAMEDcoord: 10..193
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 35..145