Kinesin motor domain protein

Overview
NameKinesin motor domain protein
Smed IDSMED30002362
Length (bp)2710
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin motor domain protein (SMED30002362) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin motor domain protein (SMED30002362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002362

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30002362SMESG000069914.1 Contig224_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 171.4 bits (433), Expect = 7.463e-44
Identity = 125/421 (29.69%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + LV S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DWEY I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +L+F +  R V LG   R+  + +
Sbjct:  241 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGS 642          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 171.4 bits (433), Expect = 7.463e-44
Identity = 125/421 (29.69%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + LV S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DWEY I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +L+F +  R V LG   R+  + +
Sbjct:  241 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGS 642          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 171.4 bits (433), Expect = 7.463e-44
Identity = 125/421 (29.69%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + LV S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DWEY I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +L+F +  R V LG   R+  + +
Sbjct:  241 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGS 642          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 171.4 bits (433), Expect = 1.172e-43
Identity = 125/421 (29.69%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + LV S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DWEY I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +L+F +  R V LG   R+  + +
Sbjct:  278 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGS 679          
BLAST of Kinesin motor domain protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 171.4 bits (433), Expect = 2.741e-43
Identity = 125/421 (29.69%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + LV S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DWEY I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + +++  +EA +IN+SL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +L+F +  R V LG   R+  + +
Sbjct:  380 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP---GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRL--REAQHINKSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRRAELGS 781          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-17 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q23124])

HSP 1 Score: 155.606 bits (392), Expect = 3.124e-40
Identity = 111/339 (32.74%), Postives = 173/339 (51.03%), Query Frame = 1
Query: 1555 RQVYNRMQEQMGNIRVCCRCRHLS-DEENILDYAGEDTLIL--TTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSA-QQGIMQRSLVTILTEER--LRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKA 2553
            R++ + + +  G IRV  R R    D  +      ++ + L  TT  +  + F+ VF P  +QS ++ E + L+M  + G NVC I YG   SGKT+T+ G+  DSA  +G++ R++  +L + +  L    W YK  A  +E+YN+   D+L G+  +++ ++ G +T    LK + I N +D DV++ +   +R VA TA N  SSRSH I  I + G     GE +   L L DLAG E     ETQ       E   IN+SL+   +  +  +    + V YRD+KLT +L+ +L  +G    +     + R +  T  TL F  E R   LGKA
Sbjct:  133 RELNDEVVDLRGQIRVAIRVRDFERDGSSNFSIISQNEVQLQQTTGQSNTYSFEHVFFPPTAQSGVFGEIKELIMCALHGKNVCLIAYGPTGSGKTFTMRGE--DSADSEGVIPRAIRFMLEQSKRDLAMIGWNYKFQASFIEVYNEEVYDLLDGKQKLEVKIN-GSKTNVVGLKKIEIGNISDVDVILNLADSQRSVASTASNEHSSRSHAIFQIFVDG-QNASGEMVQCCLNLVDLAGSERA--KETQARGKQFTELTNINQSLSTLKKC-IRAQMTKMSHVPYRDSKLTMVLREYL-GAGSSKTMFIAHANPRDVAETKRTLEFTSELRSTNLGKA 463          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-3 (Kinesin-like protein klp-3 [Source:UniProtKB/Swiss-Prot;Acc:P45962])

HSP 1 Score: 136.732 bits (343), Expect = 2.874e-33
Identity = 98/336 (29.17%), Postives = 166/336 (49.40%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCR-HLSDEEN------ILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL-SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKE 2526
            R+Q++N++ E  GNIRV  R R  L+ E +      ++D      + ++ +   R      DKV     SQ  ++ E  P++ S IDGYNVC   YG   SGKTYT+ G        GI QR+++ +    + R  D +Y I   ++EIYN+   D+L +  + + I       ++   L+ V + +  +    +      + VA T  N  SSRSH+I+ + +   + I        L L DLAG E +  ++T     L KEA  IN+SL+    V ++L RQ+   + +R+ +LT +L+  L    K  +IV +  D +S+  + +++ F ++
Sbjct:  232 RKQLHNQLVELNGNIRVFYRIRPQLASETDNQKPVVVIDEMDNGVVHVSNTTGTRKTSAGADKVIPTDFSQDQIFNEVSPIITSCIDGYNVCIFAYGHTGSGKTYTMDG---PVTMPGINQRAIMQLFETAKERTGDIKYDIKVAMMEIYNEKIRDLLNTSNTNLAIRQTEEGRSSIPGLEEVSVNSAEEVTETLARGRKNKAVAATEANIESSRSHVIVRVLVSATNLITKATTVGRLNLVDLAGSERV--SQTNATGQLLKEAQAINKSLSELGNVVLAL-RQNQKHIPFRNCQLTRILEDSLNGDSKTLVIVHLSPDAKSLNESISSVNFAEK 561          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-16 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECC0])

HSP 1 Score: 129.028 bits (323), Expect = 8.417e-31
Identity = 98/345 (28.41%), Postives = 168/345 (48.70%), Query Frame = 1
Query: 1555 RQVYNRMQEQMGNIRVCCRCRHLSDEE-----NILDYAGEDTLILT--TSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTE-ERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLT-NSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQ 2562
            R+++N + +  G IRV  R R L   E     + ++Y   D + +   +      +F+ VF P  SQ +++      + S + GYNV  I YG   SGKT+T+ G N +  ++GI+ R+   +  E ++L    W++  S   +E+YN+   D+LSG   VQ+ ++     +   L    I+N +D   L++V    RK A T  N +SSRSH + + +++      G +    L L DLAG E   ++    ++   KE   IN+SL+   ++ +S +R     V YRD+KLT +L   L   S K  ++V +         +  ++ F  + R   +G A +Q
Sbjct:  236 RKLHNDVVDLRGQIRVAVRVRPLIKSEVDTSSSAIEYPAVDAIKINEGSKPGNVVKFENVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGNGE--EEGIIPRAAAFLFAESKKLESLGWKFDFSLSFLEVYNNVAYDLLSGRDVVQLRLND-QTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNGSSSRSHAVYMWKIKAHQPSTGISTTCQLKLVDLAGSERAKESGVSGDQF--KEMTNINQSLSIL-QMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGSSKTMVVVNLNPCNEQATESKRSIEFASKMRSTHIGSAVQQ 574          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-16 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECC0])

HSP 1 Score: 129.028 bits (323), Expect = 8.417e-31
Identity = 98/345 (28.41%), Postives = 168/345 (48.70%), Query Frame = 1
Query: 1555 RQVYNRMQEQMGNIRVCCRCRHLSDEE-----NILDYAGEDTLILT--TSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTE-ERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLT-NSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQ 2562
            R+++N + +  G IRV  R R L   E     + ++Y   D + +   +      +F+ VF P  SQ +++      + S + GYNV  I YG   SGKT+T+ G N +  ++GI+ R+   +  E ++L    W++  S   +E+YN+   D+LSG   VQ+ ++     +   L    I+N +D   L++V    RK A T  N +SSRSH + + +++      G +    L L DLAG E   ++    ++   KE   IN+SL+   ++ +S +R     V YRD+KLT +L   L   S K  ++V +         +  ++ F  + R   +G A +Q
Sbjct:  236 RKLHNDVVDLRGQIRVAVRVRPLIKSEVDTSSSAIEYPAVDAIKINEGSKPGNVVKFENVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGNGE--EEGIIPRAAAFLFAESKKLESLGWKFDFSLSFLEVYNNVAYDLLSGRDVVQLRLND-QTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNGSSSRSHAVYMWKIKAHQPSTGISTTCQLKLVDLAGSERAKESGVSGDQF--KEMTNINQSLSIL-QMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGSSKTMVVVNLNPCNEQATESKRSIEFASKMRSTHIGSAVQQ 574          
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Match: klp-15 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:P91400])

HSP 1 Score: 129.028 bits (323), Expect = 8.804e-31
Identity = 99/345 (28.70%), Postives = 167/345 (48.41%), Query Frame = 1
Query: 1555 RQVYNRMQEQMGNIRVCCRCRHLSDEE-----NILDYAGEDTLILTTSFNERF--EFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEER-LRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLT-NSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQ 2562
            R+++N + +  G IRV  R R L   E     + ++Y   DT+ +          +F+KVF P  SQ +++      + S + GYNV  I YG   SGKT+T+ G N +  ++GI+ R+   +  E R L    W++  S   +E+YN+   D+LS  + VQ+ ++     +   L    I+N +D   L++V    RK A T  N +SSRSH + + ++       G +    L L DLAG E   ++    ++   KE   IN+SL+   ++ +S +R     V YRD+KLT +L   L   + K  ++V +         +  ++ F  + R   +G A +Q
Sbjct:  236 RKLHNDVVDLRGQIRVAVRVRPLIKSEADASSSAIEYPAIDTIRINEGSKPGIVVKFEKVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGNGE--EEGIIPRAAAFLFAESRKLESLGWKFDFSLSFLEVYNNVAYDLLSDRAVVQLRLND-QTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNESSSRSHAVYMWKITAHQPSTGISTSCQLKLVDLAGSERAKESGVSGDQF--KEMTNINQSLSIL-QMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGNSKTMVVVNLNPCNEQATESKRSIEFASKMRSTNIGSAVQQ 574          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0344976)

HSP 1 Score: 153.68 bits (387), Expect = 2.742e-38
Identity = 117/365 (32.05%), Postives = 173/365 (47.40%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRH-LSDEENIL----DYAGEDTLILTT--------SFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEER-LRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADV--------LIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVS-LKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            R++++N + +  GNIRV CR R  L  EEN +     Y  E T+ L +           + F FD+VF P  SQSD++E   PL+ S +DGYN+C   YG   SGKTYT+ G        G++ R++  +    R  R   WEY+I A  +EIYN+   D+LS E       D  +  A      + ++N  +  V        L+    + R  A TA N  SSRSH +  + L G      E     + L DLAG E    +   T      E   INRSL+    V ++ L++QD   + YR++KLTHLL P L  + K  + + V   +     +  +LRF        + KA+R  +++N
Sbjct:  335 RKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESV---GVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQK-----DMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTSTRMT------ETKNINRSLSELTNVILALLQKQD--HIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNN 683          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0085534)

HSP 1 Score: 153.68 bits (387), Expect = 2.742e-38
Identity = 117/365 (32.05%), Postives = 173/365 (47.40%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRH-LSDEENIL----DYAGEDTLILTT--------SFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEER-LRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADV--------LIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVS-LKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            R++++N + +  GNIRV CR R  L  EEN +     Y  E T+ L +           + F FD+VF P  SQSD++E   PL+ S +DGYN+C   YG   SGKTYT+ G        G++ R++  +    R  R   WEY+I A  +EIYN+   D+LS E       D  +  A      + ++N  +  V        L+    + R  A TA N  SSRSH +  + L G      E     + L DLAG E    +   T      E   INRSL+    V ++ L++QD   + YR++KLTHLL P L  + K  + + V   +     +  +LRF        + KA+R  +++N
Sbjct:  335 RKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESV---GVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQK-----DMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTSTRMT------ETKNINRSLSELTNVILALLQKQD--HIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNN 683          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: Klp61F (gene:FBgn0004378 transcript:FBtr0072733)

HSP 1 Score: 139.813 bits (351), Expect = 2.226e-33
Identity = 102/345 (29.57%), Postives = 173/345 (50.14%), Query Frame = 1
Query: 1591 NIRVCCRCRHLSDEE------NILDYAGEDTLI----LTTSFNERFEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIGDN--------RDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGE--SGVQIYVDHGMETA--FQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSH----LIILIRLQGCSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
            NI+V  R R L+  E       ++D  G   ++    L +   ++F FD+ F P   Q D+Y     PL+   ++GYN     YG   +GKT+T++G+          D +  GI+ R+L  +  E  LR  + EY +    +E+YN+   D+LS +  + ++I+ D   + +   Q L+ +P+ ++ D   L++    +RK A T +N  SSRSH    +++ IR  G   I GE++     L L DLAG E++ KA  +   +  +E   IN+SL    RV  +L  + P+ V YR++KLT LL+  L    K ++I T+    + +  T +TL +    + +
Sbjct:   19 NIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDE--LRMMEVEYTMRISYLELYNEELCDLLSTDDTTKIRIFDDSTKKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENG---IEGEDMLKIGKLNLVDLAGSENVSKAGNEKG-IRVRETVNINQSLLTLGRVITALVDRAPH-VPYRESKLTRLLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNI 356          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: Khc (gene:FBgn0001308 transcript:FBtr0087184)

HSP 1 Score: 122.865 bits (307), Expect = 3.804e-28
Identity = 99/339 (29.20%), Postives = 157/339 (46.31%), Query Frame = 1
Query: 1591 NIRVCCRCRHLSD-----------------EENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS-GESGVQIYVDHG----METAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
            +I+V CR R L+D                 EEN +  AG+  L           FDKVF+P  SQ  +Y E  + +V   + GYN     YG  +SGKT+T+ G   DS +QGI+ R +  I       + + E+ I     EIY D   D+L   +  + ++ D      ++ A ++  S P     D   +I+     R +A T +N  SSRSH + LI ++  +  + + +   L L DLAG E + K  T     +  EA  IN+SL+A   V  +L   +   + YRD+KLT +L+  L  + +  +++       +   T +TL FG+  + V
Sbjct:   12 SIKVVCRFRPLNDSEEKAGSKFVVKFPNNVEENCISIAGKVYL-----------FDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSSP----EDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSK--TGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETKSTLDFGRRAKTV 333          
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 114.39 bits (285), Expect = 1.295e-25
Identity = 91/329 (27.66%), Postives = 145/329 (44.07%), Query Frame = 1
Query: 1594 IRVCCRCRHLSDEE---------NILDYAGEDTLILTTSFNER----FEFDKVFQPGVSQSDLYEEFR-PLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
            ++V  RCR +S+ E         N+    G   L      N+     F +D  +    +Q+ LY E   PLV S ++G+N C   YG   +GKT+T+ G   +    GI+ R+   I      R  ++++ +    +EIY +   D+L   S      + G       L ++   +  D   ++QV    R V  T +N  SSRSH I +I+++ C           L L DLAG E   K      ++  KEA  IN +L++   V  +L    P+ V YRD+KLT LL+  L  + K  +I  +     +   T  TLR+    + +
Sbjct:   20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHIN-RTENFQFLVDVSYLEIYMEELRDLLKPNSKHLEVRERGSGVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAGSERQSKTGASAERL--KEASKINLALSSLGNVISALAESSPH-VPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSI 344          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: si:ch211-257p13.3 (si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914-108])

HSP 1 Score: 173.326 bits (438), Expect = 2.915e-44
Identity = 116/360 (32.22%), Postives = 181/360 (50.28%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNE------------RFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS--GES-GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQ 2586
            RR+ + ++ E  GNIRV CR + +  E+      G+  ++ T   NE             FE DKVF P  +Q ++++E  PL+ S IDGY+VC   YG   SGKTYT+ G   +    GI QR+L  +  E   R+  W Y +S   VEIYN+   D+LS  GE   ++I  D   +     L+ + + N      ++ +    R    T +N  SSRSH ++ + + G     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +LK    + + +R+++LT+LL+  L    K A++V V + + ++G T  +L+F +    V LG A R++     N+
Sbjct:  444 RRKYHEQLVELKGNIRVLCRVKPVLKEDQ--HEEGQAVVVTTDPNNESALIVLSKGKVKNFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGTVENP---GINQRALKHLFNEIEERKDMWTYTVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVLEVKNFQHIKKILAIARKNRITFGTQMNQHSSRSHALLTVTVLGTDLASGAKTTGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALKAHQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQVSSLESNVGETLCSLKFAQRVCKVELGPAARKIETGGHNE 795          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: si:ch211-257p13.3 (si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914-108])

HSP 1 Score: 173.326 bits (438), Expect = 6.262e-44
Identity = 116/360 (32.22%), Postives = 181/360 (50.28%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNE------------RFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS--GES-GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQ 2586
            RR+ + ++ E  GNIRV CR + +  E+      G+  ++ T   NE             FE DKVF P  +Q ++++E  PL+ S IDGY+VC   YG   SGKTYT+ G   +    GI QR+L  +  E   R+  W Y +S   VEIYN+   D+LS  GE   ++I  D   +     L+ + + N      ++ +    R    T +N  SSRSH ++ + + G     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +LK    + + +R+++LT+LL+  L    K A++V V + + ++G T  +L+F +    V LG A R++     N+
Sbjct:  576 RRKYHEQLVELKGNIRVLCRVKPVLKEDQ--HEEGQAVVVTTDPNNESALIVLSKGKVKNFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGTVENP---GINQRALKHLFNEIEERKDMWTYTVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVLEVKNFQHIKKILAIARKNRITFGTQMNQHSSRSHALLTVTVLGTDLASGAKTTGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALKAHQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQVSSLESNVGETLCSLKFAQRVCKVELGPAARKIETGGHNE 927          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 169.474 bits (428), Expect = 2.082e-43
Identity = 116/366 (31.69%), Postives = 191/366 (52.19%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL-------SDEENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLG----KARRQVHISNPNQRTT 2595
            R++ +N +    GNIRV CR R +       +D +N++ +  ED  +L  S   +   FE DKVF    +Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  + +E   ++ DW+YKI+  +VEIYN+   ++L      ++ +    D   +     L    + +  D + +  +  + R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  SL R   + V +R+++LT+LL+  L+   K  ++V V   + ++  +  +L+F +  R V +G     +RRQ   S+ +   T
Sbjct:  311 RKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDP---GINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINSL-RSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSRRQAENSSTSSSPT 670          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 170.244 bits (430), Expect = 2.793e-43
Identity = 116/366 (31.69%), Postives = 191/366 (52.19%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL-------SDEENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG----VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLG----KARRQVHISNPNQRTT 2595
            R++ +N +    GNIRV CR R +       +D +N++ +  ED  +L  S   +   FE DKVF    +Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  + +E   ++ DW+YKI+  +VEIYN+   ++L         +++  D   +     L    + +  D + +  +  + R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  SL R   + V +R+++LT+LL+  L+   K  ++V V   + ++  +  +L+F +  R V +G     +RRQ   S+ +   T
Sbjct:  364 RKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDP---GINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINSL-RSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSRRQAENSSTSSSPT 723          
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 169.474 bits (428), Expect = 3.933e-43
Identity = 116/366 (31.69%), Postives = 191/366 (52.19%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL-------SDEENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLG----KARRQVHISNPNQRTT 2595
            R++ +N +    GNIRV CR R +       +D +N++ +  ED  +L  S   +   FE DKVF    +Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  + +E   ++ DW+YKI+  +VEIYN+   ++L      ++ +    D   +     L    + +  D + +  +  + R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  SL R   + V +R+++LT+LL+  L+   K  ++V V   + ++  +  +L+F +  R V +G     +RRQ   S+ +   T
Sbjct:  340 RKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDP---GINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINSL-RSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSRRQAENSSTSSSPT 699          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 184.882 bits (468), Expect = 1.220e-49
Identity = 116/354 (32.77%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDE-------ENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG----VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R++ +N++    GNIRV  R R ++ E       EN++++  +D  +L  +   +   FE DKVF+P  +Q +++ E  PL+ S +DGY+VC + YG   SGKTY++ G   D    GI QR+L  +L+E + R   WE+++S  +VEIYN+   D+L  +      ++I      E     L    + +  D + ++++   +R    T LN  SSRSH ++++  +G     G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +L+ Q  + + YR++KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  137 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDP---GINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 482          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 185.652 bits (470), Expect = 6.386e-48
Identity = 116/354 (32.77%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDE-------ENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG----VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R++ +N++    GNIRV  R R ++ E       EN++++  +D  +L  +   +   FE DKVF+P  +Q +++ E  PL+ S +DGY+VC + YG   SGKTY++ G   D    GI QR+L  +L+E + R   WE+++S  +VEIYN+   D+L  +      ++I      E     L    + +  D + ++++   +R    T LN  SSRSH ++++  +G     G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +L+ Q  + + YR++KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  472 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDP---GINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 817          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 185.267 bits (469), Expect = 9.117e-48
Identity = 116/354 (32.77%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDE-------ENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG----VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R++ +N++    GNIRV  R R ++ E       EN++++  +D  +L  +   +   FE DKVF+P  +Q +++ E  PL+ S +DGY+VC + YG   SGKTY++ G   D    GI QR+L  +L+E + R   WE+++S  +VEIYN+   D+L  +      ++I      E     L    + +  D + ++++   +R    T LN  SSRSH ++++  +G     G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +L+ Q  + + YR++KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  465 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDP---GINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 810          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 185.267 bits (469), Expect = 1.045e-47
Identity = 116/354 (32.77%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDE-------ENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG----VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R++ +N++    GNIRV  R R ++ E       EN++++  +D  +L  +   +   FE DKVF+P  +Q +++ E  PL+ S +DGY+VC + YG   SGKTY++ G   D    GI QR+L  +L+E + R   WE+++S  +VEIYN+   D+L  +      ++I      E     L    + +  D + ++++   +R    T LN  SSRSH ++++  +G     G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +L+ Q  + + YR++KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  539 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDP---GINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 884          
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 185.652 bits (470), Expect = 1.188e-47
Identity = 116/354 (32.77%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDE-------ENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG----VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSF--LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R++ +N++    GNIRV  R R ++ E       EN++++  +D  +L  +   +   FE DKVF+P  +Q +++ E  PL+ S +DGY+VC + YG   SGKTY++ G   D    GI QR+L  +L+E + R   WE+++S  +VEIYN+   D+L  +      ++I      E     L    + +  D + ++++   +R    T LN  SSRSH ++++  +G     G  ICS   L L DLAG E + ++     ++  +EA  INRSL+A   VF +L+ Q  + + YR++KLT+LL+  L+  GK  L++ V   ++++  +  +LRFG   R V LG   R++
Sbjct:  636 RKECHNQLVRLRGNIRVLTRVRPITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDP---GINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTG--ICSTGKLYLVDLAGSERVSRSGAAGERL--REAQCINRSLSALGDVFSALRSQQGH-IPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAPTRKI 981          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 173.326 bits (438), Expect = 1.365e-44
Identity = 126/421 (29.93%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + L+ S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DW+Y I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + N++  +EA +INRSL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +LRF +  R V LG   R+  + +
Sbjct:  241 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP---GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRL--REAQHINRSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGPGSRRTELGS 642          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 173.326 bits (438), Expect = 1.780e-44
Identity = 126/421 (29.93%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + L+ S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DW+Y I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + N++  +EA +INRSL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +LRF +  R V LG   R+  + +
Sbjct:  263 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP---GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRL--REAQHINRSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGPGSRRTELGS 664          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 172.555 bits (436), Expect = 6.996e-44
Identity = 126/421 (29.93%), Postives = 210/421 (49.88%), Query Frame = 1
Query: 1369 NDVKYLSRQLNK----VFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV----DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISN 2577
            ND   L RQ+      + ++LRS +   I Q  E + +N+Q++ L  + R+++            R++ +N +    GNIRV  R R ++ E+       N + +  +D  I+      +   FE DKVF P  SQ D+++E + L+ S IDG+NVC   YG   +GKTYT+ G   +    GI QR+L  + +E + +  DW+Y I+    EIYN+   D+L  E   ++ +    D   +     L    + +  D + + +     R    T LN  SSRSH ++++ ++G     G      L L DLAG E + K+  + N++  +EA +INRSL+A   V  +L R     V +R++KLT+LL+  L+   K  ++V V   +++   T  +LRF +  R V LG   R+  + +
Sbjct:  378 NDYNGLKRQVRGFPLLLQEALRS-VKAEIGQAIEEVNSNNQEL-LRKYRRELQL-----------RKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP---GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRL--REAQHINRSLSALGDVIAAL-RSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGPGSRRTELGS 779          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc1 (kinesin family member C1 [Source:MGI Symbol;Acc:MGI:109596])

HSP 1 Score: 156.377 bits (394), Expect = 2.659e-39
Identity = 110/376 (29.26%), Postives = 178/376 (47.34%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL---------------------SDEENILDYAGED------TLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQ-QGIMQRSLVTILT-EERLRQRDWEYKISACVVEIYNDNCTDILS--------GESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIK----AETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKAR 2556
            RR+++N++QE  GNIRV CR R +                     SD    L  +  D      T     +    F FD+VF PG  Q +++EE   LV S +DGY VC   YG   SGKT+T+ G  R   Q +G++ R++  + +  + +  + W Y   A  VEIYN+   D+L+        GE  ++       E      + VP++ E + + L+ +    R VA TA N  SSRSH +  +++ G     G    + L L DLAG E +         + +++  +E   IN SL+    V ++L  ++ + V YR++KLT+LL+  L  S K  + V +   + ++  + N+LRF  +     +G A+
Sbjct:  235 RRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDPPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLEGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLHLGPGERDRL--RETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQ 607          
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Match: Kifc1 (kinesin family member C1 [Source:MGI Symbol;Acc:MGI:109596])

HSP 1 Score: 155.992 bits (393), Expect = 5.168e-39
Identity = 110/376 (29.26%), Postives = 178/376 (47.34%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL---------------------SDEENILDYAGED------TLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQ-QGIMQRSLVTILT-EERLRQRDWEYKISACVVEIYNDNCTDILS--------GESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIK----AETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKAR 2556
            RR+++N++QE  GNIRV CR R +                     SD    L  +  D      T     +    F FD+VF PG  Q +++EE   LV S +DGY VC   YG   SGKT+T+ G  R   Q +G++ R++  + +  + +  + W Y   A  VEIYN+   D+L+        GE  ++       E      + VP++ E + + L+ +    R VA TA N  SSRSH +  +++ G     G    + L L DLAG E +         + +++  +E   IN SL+    V ++L  ++ + V YR++KLT+LL+  L  S K  + V +   + ++  + N+LRF  +     +G A+
Sbjct:  298 RRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDPPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLEGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLHLGPGERDRL--RETQAINSSLSTLGLVIMALSNKE-SHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQ 670          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|Q0WN69|KN14P_ARATH (Kinesin-like protein KIN-14P OS=Arabidopsis thaliana OX=3702 GN=KIN14P PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 5.910e-49
Identity = 117/353 (33.14%), Postives = 189/353 (53.54%), Query Frame = 1
Query: 1555 RQVYNRMQEQMGNIRVCCRCRHLSDEEN----ILDYAGEDTLILTTSFNE-------RFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQ-GIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG-------VQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKAR 2556
            R+++N +QE  GNIRV CR R     +     +++Y GED  ++ T+          +F+F+KV+ P  SQ+D++ + RPLV S +DGYNVC   YG   SGKTYT+ G +  S +  G+  R+L  +    + R+ +  Y++   +VEIYN+   D+LS ++        +     +G+  A       P+T+ +D   L+ +    R V  TALN  SSRSH I+ + ++G     G  +   L L DLAG E + ++E   +++  +EA +IN+SL++   V  SL  +  + V YR++KLT LL+  L    K  + V +  D  S   + +TL+F +   GV LG A+
Sbjct:  497 RKLFNELQELKGNIRVFCRVRPFLPAQGAANTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPTASQADVFSDIRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGSSEEDWGVNYRALNDLFKISQSRKGNISYEVGVQMVEIYNEQVLDLLSDDNSQKKTLGILSTTQQNGL--AVPDASMYPVTSTSDVITLMDIGLQNRAVGSTALNERSSRSHSIVTVHVRGKDLKTGSVLYGNLHLVDLAGSERVDRSEVTGDRL--REAQHINKSLSSLGDVIFSLASKSSH-VPYRNSKLTQLLQTSLGGRAKTLMFVQLNPDATSYSESMSTLKFAERVSGVELGAAK 844          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|Q0J9V3|KN14H_ORYSJ (Kinesin-like protein KIN-14H OS=Oryza sativa subsp. japonica OX=39947 GN=KIN14H PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.990e-48
Identity = 123/371 (33.15%), Postives = 190/371 (51.21%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL-------SDEENILDY------AGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIG-DNRDSAQQGIMQRSLVTIL-TEERLRQRDWEYKISACVVEIYNDNCTDILS-GES-------GVQIYVDHGME--TAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQR 2589
            R++++N + E  GNIRV CR R L         EE ++ Y      AG    ++       F +DKVF  G SQ D++ E   LV S +DGY VC   YG   SGKTYT++G   RD  Q+GI+ RSL  I  T + L  + W+Y + A ++EIYN+   D+L+ G S         Q  + H  +  T    L    + + AD   L+   +  R V RT +N  SSRSH +  +++ G ++  G+ +   L L DLAG E + K+ +  +++  KE   IN+SL+A + V  ++ + D + V +R++KLT+LL+P L    K  + V +  +  S+G T  +LRF        +G  RR     + + R
Sbjct:  419 RKKLHNTILELKGNIRVFCRVRPLLQDNDSSGAEEALISYPTSVESAGRGIDLMNQGQRFSFSYDKVFDHGASQEDVFVEMSQLVQSALDGYKVCIFAYGQTGSGKTYTMMGPPGRD--QKGIIPRSLEQIFKTSQSLESQGWKYSMQASMLEIYNETIRDLLAPGRSNNFDLSTSKQYTIKHDPQGNTTVTDLTVADVFSSADVTSLLAKASQSRSVGRTQMNEQSSRSHFVFTLKISGSNENTGQQVQGVLNLIDLAGSERLAKSGSTGDRL--KETQAINKSLSALSDVIFAIAKGDDH-VPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVGETICSLRFASRVNACEIGIPRRHTQARSFDSR 784          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|P46875|KN14N_ARATH (Kinesin-like protein KIN-14N OS=Arabidopsis thaliana OX=3702 GN=KIN14N PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.457e-48
Identity = 126/391 (32.23%), Postives = 200/391 (51.15%), Query Frame = 1
Query: 1474 DQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHL------SDEENILDYA------GEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTIL-TEERLRQRDWEYKISACVVEIYNDNCTDILS-------GESGVQ-----IYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            DQK  ++    +VEE +LKL   E  R++++N + E  GNIRV CR R L       DE   + Y       G    ++  +    F FDKVF P  SQ D++ E   LV S +DGY VC   YG   SGKTYT++G   +  ++G++ R L  I  T + LR + W+Y++   ++EIYN+   D+LS        +SGV      I  D    T   +L  + + +  +   L+      R V +T +N  SSRSH +  +R+ G ++   + +   L L DLAG E + K+ +  +++  KE   IN+SL++   V  +L +++ + V +R++KLT+LL+P L    K  + V +  +  S G +  +LRF        +G  RRQ +I
Sbjct:  357 DQKQSIIDLKSRVEEAELKLVEGEKLRKKLHNTILELKGNIRVFCRVRPLLPGENNGDEGKTISYPTSLEALGRGIDLMQNAQKHAFTFDKVFAPTASQEDVFTEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRPGNVEEKGLIPRCLEQIFETRQSLRSQGWKYELQVSMLEIYNETIRDLLSTNKEAVRTDSGVSPQKHAIKHDASGNTHVAELTILDVKSSREVSFLLDHAARNRSVGKTQMNEQSSRSHFVFTLRISGVNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRL--KETQAINKSLSSLGDVIFALAKKE-DHVPFRNSKLTYLLQPCLGGDAKTLMFVNIAPESSSTGESLCSLRFAARVNACEIGTPRRQTNI 744          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|F4IJK6|KN14R_ARATH (Kinesin-like protein KIN-14R OS=Arabidopsis thaliana OX=3702 GN=KIN14R PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.716e-47
Identity = 119/355 (33.52%), Postives = 191/355 (53.80%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEEN------ILDYAG----EDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGV-QIYVDHGMETAFQKLKSVPITNEADADVLIQVCTV------KRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R+++YN +QE  GNIRV CRCR L+ EE       I+D+ G    E  +I   +  + F+FD+V+ P   Q D++ +  P+V+S +DGYNVC   YG   +GKT+T+ G  ++   +G+  R++  +    R R+    Y IS  V+E+YN+   D+L+   G  ++ +    + +      VP   EA+ + + +V  V       R V    +N  SSRSH ++ I ++  + ++G+   S L L DLAG E + K + Q  ++  KEA  INRSL+A   V  +L  +  + + YR++KLTHLL+  L    K  + V +   +  +  T ++L F    RGV LG AR+QV
Sbjct:  404 RKELYNHIQETKGNIRVFCRCRPLNTEETSTKSATIVDFDGAKDGELGVITGNNSKKSFKFDRVYTPKDGQVDVFADASPMVVSVLDGYNVCIFAYGQTGTGKTFTMEGTPQN---RGVNYRTVEQLFEVARERRETISYNISVSVLEVYNEQIRDLLATSPGSKKLEIKQSSDGSHH----VPGLVEANVENINEVWNVLQAGSNARSVGSNNVNEHSSRSHCMLSIMVKAKNLMNGDCTKSKLWLVDLAGSERLAKTDVQGERL--KEAQNINRSLSALGDVIYALATKSSH-IPYRNSKLTHLLQDSLGGDSKTLMFVQISPSEHDVSETLSSLNFATRVRGVELGPARKQV 748          
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Match: sp|P46864|KN14M_ARATH (Kinesin-like protein KIN-14M OS=Arabidopsis thaliana OX=3702 GN=KIN14M PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 5.269e-47
Identity = 118/364 (32.42%), Postives = 188/364 (51.65%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL------SDEENILDYA------GEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTIL-TEERLRQRDWEYKISACVVEIYNDNCTDILS-------GESGV--QIYV---DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVH 2568
            R++++N +QE  GNIRV CR R L      S+E   + Y       G    +L    +  F FDKVF P  SQ D++ E   LV S +DGY VC   YG   SGKTYT++G   +  ++G++ R L  I  T + LR + W+Y++   ++EIYN+   D+LS        ++GV  Q Y    D    T   +L  V + +      L+      R V +TA+N  SSRSH +  +++ G ++   + +   L L DLAG E + K+ +  +++  KE   IN+SL++   V  +L +++ + V +R++KLT+LL+P L    K  + V +  +  S G +  +LRF        +G A R V+
Sbjct:  374 RKKLHNTIQELKGNIRVFCRVRPLLSGENSSEEAKTISYPTSLEALGRGIDLLQNGQSHCFTFDKVFVPSASQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRPGNPDEKGLIPRCLEQIFQTRQSLRSQGWKYELQVSMLEIYNETIRDLLSTNKEAVRADNGVSPQKYAIKHDASGNTHVVELTVVDVRSSKQVSFLLDHAARNRSVGKTAMNEQSSRSHFVFTLKISGFNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRL--KETQAINKSLSSLGDVIFALAKKE-DHVPFRNSKLTYLLQPCLGGDSKTLMFVNITPEPSSTGESLCSLRFAARVNACEIGTAHRHVN 734          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A5J4P111 (Kinesin family member C2/C3 OS=Paragonimus westermani OX=34504 GN=DEA37_0008584 PE=3 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 4.165e-141
Identity = 255/583 (43.74%), Postives = 351/583 (60.21%), Query Frame = 1
Query:  880 TIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLR-----YLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLV---VINQCSERLVTND-------QKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLIL---TTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQ-QGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            TI++PIALEL+LPK+Q  I  I+  C +LCDPLEV AELR  NYD   CI YF K++ LR     +L   H T      K++  Q  +S P  +++  + S                   T       F+K   N   Q                 LR A++  +  LN ++  S  +N   +      LV    I+   E++++N+       Q  KL+  +R ++      +     R+ ++N MQE +GNIRV CRCR +    + ++    DT++    T +  E+++FD+VF    SQ+++Y E  P+V SF+DGYNVCF+TYGGEASGKTYTL+G    S++  GI+ R+L   L E   RQ DW Y +S  V+EIYNDN TD+L  E+GV ++VD G+E     L ++PI  E D + L+ +C  KR++  TALN  SSRSHLIIL RL   S++H    CS L LCDLAGFEDIIKA+T  +  L+KEAGYINRSLTA NRVF+SL+ QDPNTV YRD+KLT+LLKPF T+SGKC LIVT+RNDK ++ ST ++LRFG+E+RGVTLG+ARRQ+++
Sbjct:  381 TIRLPIALELVLPKMQRQIKNIMCSCQYLCDPLEVAAELRQMNYDTEACIAYFHKTRPLREVIHEFLPKTHIT------KTDANQYPHSQP--LATWGLQS-------------------TLHLGRNTFQKFLMNLRTQL--------------TALRTAQQDATRHLNRLRQFSLGMNVQLEQALKETLVSQLCISPQVEKIISNNRTDLPFSQLSKLVQENRSLKMTLRMEENR---RKTMFNMMQEYLGNIRVYCRCRAIPHARSCIEVPSLDTVLFANGTEAGIEQYKFDRVFDCHASQAEVYTELAPIVCSFLDGYNVCFLTYGGEASGKTYTLLGAGGFSSEANGIVYRALCNALAERDTRQHDWNYCLSVAVIEIYNDNVTDLLGNETGVNVHVDSGLERMMDALSTLPIEMETDIEDLLNLCRAKRRIGHTALNSQSSRSHLIILTRLNAQSRVHETKFCSILALCDLAGFEDIIKADTLGDPTLAKEAGYINRSLTALNRVFMSLRTQDPNTVSYRDSKLTYLLKPFFTSSGKCILIVTIRNDKGNLASTQSSLRFGRESRGVTLGRARRQLNL 919          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: H2KNY9 (Kinesin family member C2/C3 OS=Clonorchis sinensis OX=79923 GN=CLF_101012 PE=3 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 1.148e-136
Identity = 242/615 (39.35%), Postives = 371/615 (60.33%), Query Frame = 1
Query:  784 KNIEVFEFEHYNCKKVVHKISLIKSDTS--------KKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQL-NKVFDSLRSHMLVVINQCS------ERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLIL---TTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRD-SAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            K++ +F+   +  + + H+  L    T         K+ + I++PIALEL+LP++Q  I+T++  C  + DPLEV +ELR  NYD   CI YF+K++ LR +  +  ++   + +     +++S    I  T  NS+   +     C   L  AK                       Q+ +H+L       R+   +   T +  + L  +L N +FD+ +   ++ +           +LV  +Q +K              L+MEE++R+ ++N MQE  GN+RV CRCR +   ++ L+    DT++L   + +  E+++FD+VF    SQ+++Y+E  P V SF+DGYNVCF+TYG EASGKTYTL+G   D  + +GI QR+L T+L+E+  R+ +WEY++   VVE+YND  TDIL+ E+G+ ++++ G +     +    I  ++D D L+ +C  +R+V RTALN  SSRSHLII  +L   S+IH  ++ S L LCDLAGFED+IKA+T  + +L+KEAGYINRSLTA NRVF+SL+ QDP TV YRD+KLT+LLKPF ++SGKC LIVTVR D+ ++ ST +TLRFG+E+RGV+LG+ARRQ+++
Sbjct:   17 KSLAIFQVASHQWR-IEHRTQLSSKSTGSQTQHVANKRMEFIRLPIALELILPRMQKQIETVMISCQHVYDPLEVASELRQMNYDTEACIAYFQKTRPLRDIIHEFLSDKDPYDR-KAQHIRSSRQPRIEQTIPNSLLTFLLEIQSCVVDLKQAK-----------------------QDAAHKL------CRLRAFVNDTTASVERALREKLENYLFDAPKYDKIIPLRNGDLALSELSKLVQENQSLK------------QTLQMEEDRRKNMFNMMQEYFGNVRVYCRCRGIPKTKSCLEVHSLDTVVLMPGSDAAAEQYKFDRVFDINTSQTEVYKELSPFVSSFLDGYNVCFLTYGSEASGKTYTLLGGPDDKPSTEGIAQRALRTVLSEKTARRSEWEYQLLVSVVEVYNDTLTDILTNENGIHLHIESGPDHMMDDIHRQQIEKDSDIDDLLALCRTRRRVGRTALNLCSSRSHLIIFAQLNARSRIHDTSLSSILALCDLAGFEDVIKADTLGDPILAKEAGYINRSLTALNRVFMSLRSQDPTTVSYRDSKLTYLLKPFFSSSGKCILIVTVRTDRVNLASTQSTLRFGRESRGVSLGRARRQLNL 588          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A183AKL3 (Kinesin motor domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7498 PE=3 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 1.974e-134
Identity = 252/612 (41.18%), Postives = 359/612 (58.66%), Query Frame = 1
Query:  853 KSDTSKKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELG-KFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHM--------------------------------LVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAG-EDTLILTT----SFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSA-QQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            ++ T  K  T+++PIALEL+LPK+Q  I+ ++  C  +CDPLEV AELR  NYD   CI YF++   LR + ++   + G KF   +  Q K+         P++S    I+  +                      TN+      +++ Y + L I+ D++   + + ++    +  L   + ++   LR+ +                                +  +N C+     +    +L    ++   LKL L+ EEN+RR V+N MQE +GNIR+ CRCR + +  + +D     DT++L T    S  E ++FD+VF P  +QSD+Y E  P V SF+DGYNVCF+TYGGEASGKTYTL+G   DS  +QGI  R+L T+L+E      +W Y + + VVEIYND   D+LS E G+ I VD G +   + L+++ I  E+D + L+ +C  +R    TALN  SSRSHLII  RL   S+IH  ++CS L LCDLAGFEDIIKAET  + VL+KEAGYINRSLTA NRVF+SL+ QDPN V YRD+KLT+LLKPF T+SGKC LIVTVR D+ ++GST +TLRF +++RGV+LG+ARRQ ++
Sbjct:  416 EAGTGSKLTTVRLPIALELILPKMQCQIERVMKHCENICDPLEVAAELRQSNYDTEACIAYFRQISELRDVINEFLPQTGNKFGHKDAYQGKH---------PVSSTGYEITSGT--------------------SSTNSRSGLPTNRENYVNTLLILRDQIITVRRLHTDVTKRLSRLRNSVTEIITKLRTDLEEKLVTKLWTFLNADKTNHVDCSLLGKPMGSSVSSVNGCAGSGNGDVPLAQLAKLVQENRSLKLTLRTEENRRRAVFNMMQEYLGNIRIYCRCRGILNVSSCVDARPLTDTVLLHTTADNSSTETYKFDRVFDPYATQSDVYTELAPSVCSFLDGYNVCFLTYGGEASGKTYTLLGGEPDSVDKQGIAHRALRTVLSEREAHVHEWNYHLISAVVEIYNDTLIDLLSCEKGISIRVDSGPDHMLENLQTMDIEQESDVEQLLALCRERRHTGCTALNNKSSRSHLIIFARLSARSRIHDAHVCSLLALCDLAGFEDIIKAETLMDPVLAKEAGYINRSLTALNRVFMSLRTQDPNNVSYRDSKLTYLLKPFFTHSGKCILIVTVRTDRNNIGSTQSTLRFARDSRGVSLGRARRQFNL 998          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A1S8XAP8 (Kinesin motor domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_00288 PE=3 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 2.550e-134
Identity = 294/873 (33.68%), Postives = 463/873 (53.04%), Query Frame = 1
Query:  229 SKKSPVHFIAAQDCKTYMQFMHDISLI--NYE-NDVFIENLWKENEKNDQT--MRLLFSFYKLYQEYSELYEILSNY------------ATYYSG-DNVQKFQEFPEKTAILVKEN-----GENVSLK--AETSNA------ENQTDHQLLKCNFVLTPIENEITIFPDNRSLIY----------------GLKTLFKPP-FKF-----GK------------CLKTGKFSKSTENFLN-----------FRSLLYDRVAEKNIEVFEFEHYNCKKVVHKISLIKSDTS--------KKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQL----GIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFN---ERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGD-NRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            ++K P  F+ + D   Y++    +  I  NY   ++  + L +   +  Q   +RL+F+F  LY EYS +   L+N             +  YSG       Q+        V +N     G++  L+   E   A      E Q    ++     LT +    T  P N SL+                 GL     P  F++     GK             LK  +  ++++NF N           +   +  R   K++++F+   +  + + H+  L   +T         K+ + I++PIALEL+LP++Q  I+T++  C  + DPLEV +ELR  NYD   CI YF K++ LR +  +  ++   F + N   +++S   +   T  +S+   +     C   L  AK                       Q+ SH+L      + D     +      L +  + +++ +K+   LR+  L  +++ S +LV  +Q +K              L++EE++R+ ++N MQE  GN+RV CRCR +   ++ L+    DT++L T  +   E+++FD+VF    SQ+++Y+E  P V SF+DGYNVCF+TYG EASGKTYTL+G  +   + +GI QR+L T+L+E+  R+ +WEY++   VVE+YND  TDIL+ E+G+ ++++ G +     +    I  ++D D L+ +C  +R+V RTALN  SSRSHLII  +L   S+IH  ++ S L LCDLAGFED+IKA+T  + +L+KEAGYINRSLTA NRVF+SL+ QDP TV YRD+KLT+LLKPF ++SGKC LIVTVR D+ ++ ST +TLRFG+E+RGV+LG+ARRQ+++
Sbjct:   24 TRKPPTAFVHSDDWSLYLRVCCQLRQIRSNYGCTELEAQKLIRTGRRRSQACILRLIFAFNHLYSEYSRVVFTLNNLQNQDHCLLNTALSRSYSGLSTSHTVQDSTNHGDTNVCKNNPVFKGQDSKLQDVLEKDRAFYPEQHEEQRSGTVVPVTHSLTAVNTTSTSLPTNYSLMSHTVQEFTETPLQSTQSGLSQTSTPACFQWCRKHSGKRRPLMSRNRSYEALKVSRAIETSKNFSNKHRPSELDSYDYFDQIKRRPTNKSLDIFQVASHQWR-IEHRTQLSSKNTGSQTQHVSNKRTEFIRLPIALELILPRMQKQIETVMISCQHVYDPLEVASELRQMNYDTEACIAYFHKTRPLRDIIHEFLSDKDPFDR-NAQHIRSSRQPKTEQTIPSSLQTFLLGIQSCVVELKQAK-----------------------QDVSHKLCRLRAFVYDTTASVERALKEKLVNYLFEAQKFDKII-PLRNGDLA-LSELS-KLVQENQSLK------------QTLQIEEDRRKNMFNMMQEYFGNVRVYCRCRGIPKAKSCLEVHSLDTVVLMTGSDAAAEQYKFDRVFDTNASQTEVYKELSPFVSSFLDGYNVCFLTYGSEASGKTYTLLGGPDYKPSTEGIAQRALRTVLSEKTTRRSEWEYQLLVSVVEVYNDTLTDILTNENGIHLHIESGPDHMMDDIHRQLIEKDSDIDDLLALCRTRRRVGRTALNLCSSRSHLIIFAQLNARSRIHDTSLSSILALCDLAGFEDVIKADTLGDPILAKEAGYINRSLTALNRVFMSLRSQDPTTVSYRDSKLTYLLKPFFSSSGKCILIVTVRTDRVNLASTQSTLRFGRESRGVSLGRARRQLNL 856          
BLAST of Kinesin motor domain protein vs. TrEMBL
Match: A0A074Z3N1 (Kinesin motor domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10075 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 4.134e-134
Identity = 294/873 (33.68%), Postives = 463/873 (53.04%), Query Frame = 1
Query:  229 SKKSPVHFIAAQDCKTYMQFMHDISLI--NYE-NDVFIENLWKENEKNDQT--MRLLFSFYKLYQEYSELYEILSNY------------ATYYSG-DNVQKFQEFPEKTAILVKEN-----GENVSLK--AETSNA------ENQTDHQLLKCNFVLTPIENEITIFPDNRSLIY----------------GLKTLFKPP-FKF-----GK------------CLKTGKFSKSTENFLN-----------FRSLLYDRVAEKNIEVFEFEHYNCKKVVHKISLIKSDTS--------KKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQL----GIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFN---ERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGD-NRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            ++K P  F+ + D   Y++    +  I  NY   ++  + L +   +  Q   +RL+F+F  LY EYS +   L+N             +  YSG       Q+        V +N     G++  L+   E   A      E Q    ++     LT +    T  P N SL+                 GL     P  F++     GK             LK  +  ++++NF N           +   +  R   K++++F+   +  + + H+  L   +T         K+ + I++PIALEL+LP++Q  I+T++  C  + DPLEV +ELR  NYD   CI YF K++ LR +  +  ++   F + N   +++S   +   T  +S+   +     C   L  AK                       Q+ SH+L      + D     +      L +  + +++ +K+   LR+  L  +++ S +LV  +Q +K              L++EE++R+ ++N MQE  GN+RV CRCR +   ++ L+    DT++L T  +   E+++FD+VF    SQ+++Y+E  P V SF+DGYNVCF+TYG EASGKTYTL+G  +   + +GI QR+L T+L+E+  R+ +WEY++   VVE+YND  TDIL+ E+G+ ++++ G +     +    I  ++D D L+ +C  +R+V RTALN  SSRSHLII  +L   S+IH  ++ S L LCDLAGFED+IKA+T  + +L+KEAGYINRSLTA NRVF+SL+ QDP TV YRD+KLT+LLKPF ++SGKC LIVTVR D+ ++ ST +TLRFG+E+RGV+LG+ARRQ+++
Sbjct:   59 TRKPPTAFVHSDDWSLYLRVCCQLRQIRSNYGCTELEAQKLIRTGRRRSQACILRLIFAFNHLYSEYSRVVFTLNNLQNQDHCLLNTALSRSYSGLSTSHTVQDSTNHGDTNVCKNNPVFKGQDSKLQDVLEKDRAFYPEQHEEQRSGTVVPVTHSLTAVNTTSTSLPTNYSLMSHTVQEFTETPLQSTQSGLSQTSTPACFQWCRKHSGKRRPLMSRNRSYEALKVSRAIETSKNFSNKHRPSELDSYDYFDQIKRRPTNKSLDIFQVASHQWR-IEHRTQLSSKNTGSQTQHVSNKRTEFIRLPIALELILPRMQKQIETVMISCQHVYDPLEVASELRQMNYDTEACIAYFHKTRPLRDIIHEFLSDKDPFDR-NAQHIRSSRQPKTEQTIPSSLQTFLLGIQSCVVELKQAK-----------------------QDVSHKLCRLRAFVYDTTASVERALKEKLVNYLFEAQKFDKII-PLRNGDLA-LSELS-KLVQENQSLK------------QTLQIEEDRRKNMFNMMQEYFGNVRVYCRCRGIPKAKSCLEVHSLDTVVLMTGSDAAAEQYKFDRVFDTNASQTEVYKELSPFVSSFLDGYNVCFLTYGSEASGKTYTLLGGPDYKPSTEGIAQRALRTVLSEKTTRRSEWEYQLLVSVVEVYNDTLTDILTNENGIHLHIESGPDHMMDDIHRQLIEKDSDIDDLLALCRTRRRVGRTALNLCSSRSHLIIFAQLNARSRIHDTSLSSILALCDLAGFEDVIKADTLGDPILAKEAGYINRSLTALNRVFMSLRSQDPTTVSYRDSKLTYLLKPFFSSSGKCILIVTVRTDRVNLASTQSTLRFGRESRGVSLGRARRQLNL 891          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 172.17 bits (435), Expect = 8.760e-44
Identity = 110/347 (31.70%), Postives = 188/347 (54.18%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL------SDEENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL----SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKA 2553
            R++ +N +    GNIRV CR R +      SD + ++ +  +D  +L  S   +   FE DKVF P ++Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  + +E   ++ DW+Y I+  +VEIYN+   ++L    S +  +++  D   +     L    + +  D + + ++  + R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +L+ +  + V +R+++LT+LL+  L+   K  ++V V   + ++  +  +L+F +  R V LG +
Sbjct:  426 RKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDP---GINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINALRSRHSH-VPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPS 766          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:103045287])

HSP 1 Score: 171.785 bits (434), Expect = 1.222e-43
Identity = 113/353 (32.01%), Postives = 180/353 (50.99%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNER------------FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS--GES-GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            RR+ + ++ E  GNIRV CR + +  E+      G+   + T   NE             FE DKVF P  +Q ++++E  PL+ S IDGY+VC   YG   SGKTYT+ G   +    GI QR+L  +  E   R+  W Y ++   VEIYN+   D+LS  GE   ++I  D   +     L+ + + +      ++      R    T +N  SSRSH ++ + +QG     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +L+ +  + + +R+++LT+LL+  L    K A++V + + +R++G T  +L+F +    V LG A R++
Sbjct:  544 RRKYHEQLVELKGNIRVLCRVKPVLKEDE--HEEGQTVAVTTDPHNESALTVLSKGKAKTFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGPTENP---GINQRALKHLFNEIEERKDMWTYTVTVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVKSFQHIKKILATARRNRITFGTQMNQHSSRSHALLTVTVQGVDLATGSKSSGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALRGRQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQISSLERNVGETLCSLKFAQRVCKVELGPAARKI 888          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:103045287])

HSP 1 Score: 172.17 bits (435), Expect = 1.246e-43
Identity = 113/353 (32.01%), Postives = 180/353 (50.99%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNER------------FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS--GES-GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            RR+ + ++ E  GNIRV CR + +  E+      G+   + T   NE             FE DKVF P  +Q ++++E  PL+ S IDGY+VC   YG   SGKTYT+ G   +    GI QR+L  +  E   R+  W Y ++   VEIYN+   D+LS  GE   ++I  D   +     L+ + + +      ++      R    T +N  SSRSH ++ + +QG     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +L+ +  + + +R+++LT+LL+  L    K A++V + + +R++G T  +L+F +    V LG A R++
Sbjct:  566 RRKYHEQLVELKGNIRVLCRVKPVLKEDE--HEEGQTVAVTTDPHNESALTVLSKGKAKTFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGPTENP---GINQRALKHLFNEIEERKDMWTYTVTVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVKSFQHIKKILATARRNRITFGTQMNQHSSRSHALLTVTVQGVDLATGSKSSGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALRGRQTH-IPFRNSRLTYLLQDSLGKGNKTAMVVQISSLERNVGETLCSLKFAQRVCKVELGPAARKI 910          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 171.785 bits (434), Expect = 1.319e-43
Identity = 110/347 (31.70%), Postives = 188/347 (54.18%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL------SDEENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL----SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKA 2553
            R++ +N +    GNIRV CR R +      SD + ++ +  +D  +L  S   +   FE DKVF P ++Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  + +E   ++ DW+Y I+  +VEIYN+   ++L    S +  +++  D   +     L    + +  D + + ++  + R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +L+ +  + V +R+++LT+LL+  L+   K  ++V V   + ++  +  +L+F +  R V LG +
Sbjct:  486 RKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDP---GINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINALRSRHSH-VPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPS 826          
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 171.785 bits (434), Expect = 2.246e-43
Identity = 110/347 (31.70%), Postives = 188/347 (54.18%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL------SDEENILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL----SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKA 2553
            R++ +N +    GNIRV CR R +      SD + ++ +  +D  +L  S   +   FE DKVF P ++Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  + +E   ++ DW+Y I+  +VEIYN+   ++L    S +  +++  D   +     L    + +  D + + ++  + R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +L+ +  + V +R+++LT+LL+  L+   K  ++V V   + ++  +  +L+F +  R V LG +
Sbjct:  659 RKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDP---GINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRL--REAQCINKSLSALGDVINALRSRHSH-VPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPS 999          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.882 bits (468), Expect = 1.238e-51
Identity = 119/342 (34.80%), Postives = 183/342 (53.51%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEENI--LDY---AGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILT--EERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYV-DHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKA 2553
            RR +++++ E  GNIRV CR R  + +  +  L++   AGE  ++ +      F FD+VF P  +Q  ++ +  PL+ S +DGYNVC + YG   SGKT+T++G    S   G+  RS+  +L   +ER    + +Y +   ++EIYN+   D+L       + V           L +  +T+E D   +++     R VA T +N  SSRSHL+  + L+G   + G      L L DLAG E I + E    +++  EA  IN+SLT+  +VF++L R     V YR++KLTHLL+P L  + K  + VTV  D  + G T +TL+FG   R V LG A
Sbjct:   49 RRLLHDQLTELRGNIRVFCRGRPGAPDGGVPGLEFSPSAGEVLVMQSEGKTTSFAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMG---TSNAPGVNVRSVKELLNICKER---HNVKYTLKISMLEIYNETVRDLLGKPGSGPLEVRGQARSVTVPGLTTTIVTSEEDIVRVMETAHKHRTVASTKMNIHSSRSHLLTTLSLEGLDVVSGSASHGSLILGDLAGSERISRTEATGQRLV--EAAAINKSLTSLGQVFLAL-RNGSLHVPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQVALGAA 381          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 182.185 bits (461), Expect = 2.184e-50
Identity = 115/352 (32.67%), Postives = 181/352 (51.42%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEE-------NILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGES----GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            R++ +N++ E  GNIRV CR R   +E+       +++    ED   +  +   R   F+ D+VF P  SQ +++ E + LV S +DGYN+C   YG   SGKTYT+      +   GI QR+L  +  E   RQ +W Y +S  ++EIYN+   D+L  E      +++  D   E     L+  P+T+  D   L+ +    R    T +N  SSRSH +IL+ +   + I G +    L L DLAG E + K+  + +++  +EA  INRSL A   V  +L+ +  + V +R++KLT+LL+  L    K  +++ V    R    T  +L F +  R V LG A R+V
Sbjct:   69 RKKYHNQLVELRGNIRVLCRVRPAIEEDGEGTLAHSVVQVDTEDDGAVHVAQRGRQHSFQLDRVFPPHASQEEVFREVQDLVTSCVDGYNICIFAYGQTGSGKTYTMERAQGTAKAPGINQRALQHLFQEMEERQDEWRYTLSLSMLEIYNETLRDLLGSEGHGRLDIRLCPDGSGELCVPGLRQEPVTSLGDVHRLVSLGHSNRATHCTNMNEHSSRSHALILVTVSATNSITGTSTRGRLNLVDLAGSERLAKSRAEGDRL--REAQNINRSLAALGDVIQALRAKQAH-VPFRNSKLTYLLQDSLARESKTLMVIQVAPAARHAAETICSLHFAQRARAVELGPATRRV 417          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 121.709 bits (304), Expect = 6.176e-29
Identity = 97/334 (29.04%), Postives = 152/334 (45.51%), Query Frame = 1
Query: 1594 IRVCCRCRHLSDEENILDYAGEDTLILTTS----FNER--------FEFDKVFQPGVSQSDLYEE-FRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAF--QKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSF----LCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
            +RV  RCR ++  E+   Y    T+ +        N R        F FD V+     Q D+YEE FRPLV S + G+N     YG   +GKTYT+ G   D  ++G++  S   I T     Q     ++ A  +EIY +   D+LS +   ++ +    +T    + L S    +  + + ++ +    R V  T +N  SSRSH I +I ++ CS++  +         L L DLAG E   K   Q  ++  KEA  IN SL+A   V  +L       V YRD+KLT LL+  L  + +  ++  V     +   +  TLR+    + +
Sbjct:   20 VRVVVRCRPMNPRESAASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVE-CSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERL--KEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNI 350          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: kif15 (kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE-050622-16])

HSP 1 Score: 117.857 bits (294), Expect = 3.694e-27
Identity = 105/344 (30.52%), Postives = 171/344 (49.71%), Query Frame = 1
Query: 1594 IRVCCRCRHLSDEENILDYAGE-------------DTL-ILTTSFNERFEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIG-----DNRDSAQQGIMQRSLVTILT----EERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAF--QKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGE-NI-CSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNT---VCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETR 2532
            IRVC R R  +  E I    GE             DT+ +L+      F FD V     +Q +++    + ++ S ++GYN     YG   SGKT+T++G     D  +   +G++ RSL  I +    E+++     E+      +EIYN+   D+L   S   +++   ++     + +  + +++ A+A  ++ +    R+VA T++N  SSRSH +  + +Q   K +G  NI  S L L DLAG E   + +TQ++ +  KEAG INRSL++   V  +L          V YRD+KLT LL+  L  + K A+IV V    R  G T +TL+F + T+
Sbjct:    3 IRVCVRVRPPT--EGIAANEGESMEQGMCVTVVSPDTVRVLSRPEPRTFTFDYVASISATQEEIFSVVAKNIIESCMNGYNGTIFAYGQTGSGKTFTMLGAMDHVDIFNHNLRGVIPRSLEFIFSLISREKQMTGDAKEFLCKCSFLEIYNEQVFDLLDPAS-TSLFIRENIQKGVFVEGVMEMSLSSAAEAYQVLSLGWRNRRVASTSMNRESSRSHAVFTLTIQSKEKRNGMVNIRSSQLNLVDLAGSER--QRDTQSDGMRLKEAGSINRSLSSLGNVINALAEIAHGKGRFVPYRDSKLTFLLRDSLGGNAKTAVIVNVHPGGRYFGETLSTLQFARRTK 341          
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001811.1 (pep scaffold:Pmarinus_7.0:GL477555:33781:61877:1 gene:ENSPMAG00000001600.1 transcript:ENSPMAT00000001811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 6.636e-27
Identity = 91/324 (28.09%), Postives = 150/324 (46.30%), Query Frame = 1
Query: 1591 NIRVCCRCRHLSDEEN------ILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEE-FRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS-GESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
            NI+V CR R +++ E       I  + G DT+I++   N+ + +D VF P  +Q  +Y    R +    ++GYN     YG  ASGKT+T+ G   D    G++ R +  I         + E+ I     EIY D   D+L   ++ + ++ D       +      +++  +   +I      R VA T +N  SSRSH I LI ++  +    + +   L L DLAG E + K  T     +  EA  IN+SL+A   V  +L       V YRD+K+T +L+  L  + +  +I+       +   T +TL FG+  + +
Sbjct:    8 NIKVMCRVRPINNSEEARGDKFIAKFQGNDTVIVS---NKPYVYDGVFHPETTQEQVYNACARQITKDVLEGYNGTIFAYGQTASGKTHTMEGVLHDPEHMGVIPRIVKDIFHYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINVKQENVETEQKLSGKLYLVDLAGSEKVSK--TGAEGSVLDEAKNINKSLSALGNVIAALAEGTRTHVPYRDSKMTRILQDSLGGNCRTTVIICCSPSIYNEAETKSTLLFGQRAKTI 326          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 152.525 bits (384), Expect = 1.191e-38
Identity = 113/362 (31.22%), Postives = 180/362 (49.72%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCR----HLSDEENIL-------DYAG----EDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLI--GDNRDSAQQGIMQRSLVTILTE-ERLRQRDWEYKISACVVEIYNDNCTDILSGES--------GVQIYVDHGME---TAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNT--VCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTL 2544
            RR ++N +QE  GNIRV CR R    +L + +  L       D +G    E T I  T+    F+FDK+F    +  D+++E   LV S +DGYNVC   YG   SGKT+T++  GD       GI+  ++  I     +L+ + W+YK++   +EIYN+N  D+L  ++        G++  + H  E   T    + S  + +E   +++++     R  A TA N  SSRSH I +I L G +   G +    L L DLAG E I  ++   +++  +E   IN+SL+    V  +L + D     + +R++KLT+LL+  LT   K  + V +      +  T N+LRF  +     L
Sbjct:  373 RRTLHNELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-------GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRL--RETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRL 725          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 114.005 bits (284), Expect = 1.768e-26
Identity = 105/354 (29.66%), Postives = 158/354 (44.63%), Query Frame = 1
Query: 1696 FEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTE--ERLRQRDWEYKISACVVEIYNDNCTDIL-SG--ESGVQIYVDH------------GMETAFQK-----LKSVPITN---EADADVL--IQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTV------------------------------CYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPN 2583
            F+FD VF    +  ++YE   +P++   + G+N     YG   SGKT+T+ G+ +   + G++  S+  + T   E+    D ++ +    +EIYN+   D+L SG  ESG +I                G+E   +      +K + +T    E+  ++L  I V    RK+  T  N  SSRSH I+LIRL   +  +G +  S L LCDLAG E   +A  Q  +   KE  +IN+SL A   V   L     N+V                               YRD+KLT LL+P L+       I TV     +   T NTLRF    + V L  +++ + ISN N
Sbjct:  163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRSSTLSLCDLAGSE---RATGQQER--RKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSKKSI-ISNGN 507          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 107.842 bits (268), Expect = 2.041e-24
Identity = 90/305 (29.51%), Postives = 145/305 (47.54%), Query Frame = 1
Query: 1693 RFEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSV----PITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKI---HGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVC---YRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHIS 2574
            +F FDK+F    SQ+ +Y+E   PL+ S +DG+N     YG    GKTYT+ G     +Q GI+  ++  +  +    + + +++IS   +EIYN+   D+L  E+  +  V         K+ ++    P T E   D+++Q   + R  + T  N  SSRSH ++ I +   +K+     ++  + L + DLAG E    A T+   +   E   INRSL A      +L   D +  C   YRD+KLT LLK  L  + K  +IV +         T NTL++    + +     R Q  +S
Sbjct:  152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT---PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQ-GNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSER--AAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLS 450          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 106.301 bits (264), Expect = 7.635e-24
Identity = 99/365 (27.12%), Postives = 167/365 (45.75%), Query Frame = 1
Query: 1588 GNIRVCCRCRHLSDEE---------NILDYAGEDTLILT------TSFNERFEFDKVFQPGVSQSDLYEE-FRPLVMSFIDGYNVCFITYGGEASGKTYTLIGD--------NRDS----AQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTD-----------ILSGESGVQIYVDHGMETAF--QKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIR---LQGCSKIHGENI----CSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
             NI V  RCR  +  E         + L   G++ ++        +S  + ++FD+VF     Q  ++    +  +   + GYN     YG   +GKTYT+ GD        + D+       GI+ R LV +  E  L   + EY +    +E+YN+N  D           +   +  ++I+ ++   ++   + ++ + I +  +   L+   ++KRKVA T  N  SSRSH +  I    ++  SK HG+N        L L DLAG E+I ++  +  +  ++EAG IN+SL    RV  +L     N + YR++KLT LL+  L    K  +I T+   K SM  T +TL +    + +
Sbjct:   51 SNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKE--LSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKR--AQEAGLINKSLLTLGRVINALVDHS-NHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI 410          
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 82.4185 bits (202), Expect = 1.957e-16
Identity = 55/166 (33.13%), Postives = 78/166 (46.99%), Query Frame = 1
Query: 1591 NIRVCCRCRHLSDEE---------NILDYAGE---------DTLILTTSFNERFEFDKVFQPGVSQSDLYEEFR-PLVMSFIDGYNVCFITYGGEASGKTYTLIGDNR-------DSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESG 2010
            NI V  RCR  ++ E         N+ D  G          DT I      +R+  DKVF PG SQ  +++E   PL   FI GYN   + YG  ++GKTYT+ GD +       D+A  GI+ R L+ +     L+Q D  Y +    +E+YN+   D+L   S 
Sbjct:   36 NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAA--GIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLDSNSN 197          

HSP 2 Score: 72.7886 bits (177), Expect = 1.695e-13
Identity = 57/166 (34.34%), Postives = 87/166 (52.41%), Query Frame = 1
Query: 2047 FQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENI--CSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGV 2538
             Q L+   ITN  +   L+Q     R+VA T +N  SSRSH I  I L    K H + +   S + L DLAG E+I ++     +  +KEAG IN+SL    RV  +L  +  + + +R++KLT LL+  L  + K ALI T+   K +   T +TL +  + + +
Sbjct:  318 IQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLY---KKHQDELFRISKMNLVDLAGSENINRSGALNQR--AKEAGSINQSLLTLGRVINALVDKSGH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 477          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO45950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH2])

HSP 1 Score: 199.904 bits (507), Expect = 4.856e-56
Identity = 123/356 (34.55%), Postives = 197/356 (55.34%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDE-------ENILDYAGEDTLIL---TTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAF-QKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQ 2586
            R++  N + E  GNIRV CR R +  E       EN++ +  +D  IL   +    + FE D+VFQP  +Q +++EE +PLV+S +DGYNVC   YG   SGKT+T+ G     +  GI QR+L  + TE   R  DW+Y+++  V+EIYN+   D+LS +   ++ +  G E  +   L  V +TN  + + + Q+    R  A T +N  SSRSH ++   + G ++  G      L L DLAG E + K+ ++  ++  KEA  IN+SL++   V  +LK +  + V YR++KLT+LL+  L    K  ++V V   ++++G T  +L F +  R V LG+A R+   ++  Q
Sbjct:   76 RKKYLNELIELKGNIRVYCRVRPVIREDGAGKPAENVISFDDDDDAILNVFSRGALKPFEMDRVFQPQSTQVEVFEEVKPLVISCVDGYNVCIFAYGQTGSGKTFTMEG---PVSNPGINQRALQHLFTETADRGVDWDYQVTVSVMEIYNEMLRDLLSSDPSAKLDIKQGKEGLYVPGLSEVEVTNLDEVNEIFQLGKQNRATAFTDMNEHSSRSHALLCATVIGVNRTTGARTIGKLNLVDLAGSERVSKSGSEGARM--KEAQNINKSLSSLGDVIHNLKNKSAH-VPYRNSKLTYLLQESLGGDSKTLMVVQVAPVEKNVGETVCSLNFAQRVRAVELGQATRKTDNADGGQ 425          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO31606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF7])

HSP 1 Score: 200.29 bits (508), Expect = 1.238e-53
Identity = 172/609 (28.24%), Postives = 286/609 (46.96%), Query Frame = 1
Query:  886 KIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYF-----------------------------KKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPRE--------ISSTPINSIYKNISFSS----VCKFPLADAK-TRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTL-ILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILT--EERLRQRDWEYKISACVVEIYNDNCTDILS--GE-SGVQIYVD-HGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            K+P++ EL  P I+  ID+I    P   D  +++A LR CNY+  + +  +                             K S+  R    +  T+L   ++S    L+ SL  E         S + IN +Y  ++       V +  L +AK T  + +     M  N  ++T    + S +L                  N+V +L     +VF   RS ++  + Q S+ +  N  ++   +   ++EELK     E   R+ +YN++QE  GNIRV CRCR     E  + +  +  +  +  S  + F FD+VF P  +Q  ++E+  PL+ S +DGYNVC + YG   +GKT+T++G   +    G+  RS++ +L    ER    + +Y +S  ++E+YN+   D+L   G  +G Q+ +   G +     L  + + +      ++      R V  T +N +SSRSHL++++ + G  KI      S L L DLAG E I K E    +++  EA  IN+SL+A  +VF +L R +   V YR++KLT LL+  L   GK  + V V   + ++  T +TL+FG   + V LGKA + +
Sbjct:  236 KLPLSWELHSPPIKEMIDSIQDTLPTWTDRHDILAMLRQCNYNSEEVVSTYLSILHGDYWQKRIEKSNPVIGESDLALEHKNSEITRL--KRKVTDLEAALESKDSLLEQSLEVERRLKYHLDESDSTINDLYSKVTGLKRELIVAEKKLTEAKPTTPKPTPMQSPMKANISMKTASSVKMSFKL----------------LFNEVGHL----REVFSRGRSEVIETLQQASKAI--NSLQLNNKSHDSEIEELKALYHKEALHRKLLYNKLQELRGNIRVFCRCRRDPTVEVAVTFPSDQEIQAVGPSGRKTFMFDRVFTPDSTQEQVFEDTLPLIASCVDGYNVCIMAYGQTGAGKTFTMMGPEDNP---GVNVRSILELLRVCNER---PNVDYTLSLAMLEVYNETLKDLLEEFGSCAGTQLSIQLKGKQVVVPHLTEIQVNSAKAIRTIMAKGDANRSVGATKMNTSSSRSHLVLILHINGVDKISHAITHSTLTLVDLAGSERISKTEATGQRLV--EAAAINKSLSALGQVFTAL-RTNAMHVPYRNSKLTQLLQGSLGGDGKACMFVNVSPAEWNLSETISTLQFGAGAKQVQLGKATQNI 811          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO34961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMV5])

HSP 1 Score: 172.17 bits (435), Expect = 6.068e-47
Identity = 117/351 (33.33%), Postives = 186/351 (52.99%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRH-LSDEEN------ILDYAGEDTLILTTSFNE------------RFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTI-LTEERLRQRDWEYKISACVVEIYNDNCTDIL-SGESGV--QIYVDHG-----METAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFG 2520
            RR ++N +QE  GNIRV CR R  L +E N       L   G    I  ++  E             F FDKVFQ    Q+ ++EE   LV S +DGYNVC   YG   SGKTYT+ GD+ +   +G++ RS+  + L   +L+++ W+YK+    +EIYN+   D+L SG+  +  +I + +G      +     LK+  + +E+    L++  +  R V  TA N  SSRSH + +++L G + I  E+    L L DLAG E + ++    +++  KE   IN+SL+  + V ++L  ++ + V YR++KLT+LLK  L  + K  + V +   + S+  T  +LRF 
Sbjct:   25 RRTLHNTIQELKGNIRVFCRVRPPLPNEMNKDLVNVSLQDEGRGIAITPSNLPEDVMATKKGVSKYEFSFDKVFQHTSKQAQVFEEISQLVQSALDGYNVCIFAYGQTGSGKTYTMEGDHNNLEHRGMIPRSMEQVFLNTHKLQEKGWKYKMDVSFLEIYNETIRDLLGSGDETIKHEIKMVNGSNSTNSQVMVTNLKTFEVEDESQVYSLLKTASQNRAVGATACNERSSRSHSVFIMKLTGENSITEESCSGTLNLVDLAGSERLGQSCASGDRL--KETKNINKSLSTLSSVIIALANKEGH-VPYRNSKLTYLLKNSLGGNSKSLMFVNISPREESLQETLCSLRFA 372          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO49352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG40])

HSP 1 Score: 120.168 bits (300), Expect = 1.334e-29
Identity = 93/319 (29.15%), Postives = 148/319 (46.39%), Query Frame = 1
Query: 1591 NIRVCCRCRHLSDEEN------ILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS-GESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGK 2523
            NI+V CR R  SD E       ++ +   DT I        F FD+VF+P  +Q  +Y E  + +V   ++GYN     YG  +SGKT+T+ G    S  QGI+ R +  I         + E+ I     EIY D   D+L   ++ + ++ D       +      +++  +   +I      R VA T +N  SSRSH I L+ ++  +    + +   L L DLAG E + K  T     +  EA  IN+SL+A   V  +L     + V YRD+K+T +L+  L  + +  +I+       +   T +TL FG+
Sbjct:   12 NIKVFCRFRPQSDAETKAGGQIVVKFPTPDTAI---HGGRTFTFDRVFKPTATQEKVYSEAAQAIVQDVLNGYNGTIFAYGQTSSGKTHTMEGLIDSSLHQGIIPRIVQDIFNHIYNMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLAVHEDKNRVPFVKGGTERFVSSPEEVMEIIDEGKANRHVAVTNMNEHSSRSHSIFLLHIKQENVETNKKLSGKLYLVDLAGSEKVSK--THAEGSVLDEAKNINKSLSALGNVISALAEGTKSHVPYRDSKMTRILQESLGGNARTTIIICCSPSSFNDQETRSTLMFGQ 325          
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Match: EDO38070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY9])

HSP 1 Score: 121.709 bits (304), Expect = 2.741e-29
Identity = 85/310 (27.42%), Postives = 145/310 (46.77%), Query Frame = 1
Query: 1657 EDTLILTTSFNERFEFDKVFQPGVSQSDLYEEF-RPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHG---ENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHIS 2574
            +D L +  S  +++ FD  F P  SQ +++ +  +PL+   + GYN     YG   +GKTYT++G +   ++ GIM  +L  + ++      D  YK++   +EIYN+   D+L+  SG     + G       +  V     ++   ++ +   +R    TA N  SSRSH I+ + +   S++     E     L + DLAG E   + + +  +++  E  +INRSL A      +L     + V YRD+KLT LLK  L  +    +I  V    R    + NTL +    + +     R Q ++S
Sbjct:   40 DDILRVNRSREKQYVFDHAFGPTASQVEVFSKTTKPLIDGVVSGYNATVFAYGATGAGKTYTMLGTD---SEIGIMGLTLNNLFSQMDETNDDMAYKVTMSYLEIYNEMIRDLLNPSSGYLELREDGKGVNVAGISEVEAKTTSEVLGMLHMGNKQRTSEPTAANKTSSRSHAILQVTVTQESRVKNIIREMRVGKLFMIDLAGSERAAQTKNRGKRMI--EGAHINRSLLALGNCINALSENRGHYVNYRDSKLTRLLKDSLGGNCHTVMIAHVSPASRMFEESRNTLLYADRAKSIKTKVKRNQFNVS 344          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: kifc1 (kinesin family member C1 [Source:NCBI gene;Acc:101167717])

HSP 1 Score: 179.104 bits (453), Expect = 5.925e-47
Identity = 122/362 (33.70%), Postives = 190/362 (52.49%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHL-------------SDEENILDYAGEDT---LILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTE-ERLRQRDWEYKISACVVEIYNDNCTDIL-SGESGVQIYVDHGMETAFQKLKS--VPITN--------EADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKA 2553
            RR+++N +QE  GNIRV CR R L             SD+++I+    E++    +  T  N  F FD+VF P  SQ +++EE   LV S +DGYNVC   YG   SGKTYT+ G+  D   +G++ R++  +    ++L  + WE+  +A  VEIYN+   D+L +G++  +       E   +K+ S  V +TN        E     LI V    R  A+T+ N  SSRSH +  + ++G +        S LCL DLAG E ++K+++Q ++   KE   IN SL+    V  SL  ++ + + YR++KLT+LL+  L  + K  + V +  +  S G T N+LRF  +     +G A
Sbjct:  271 RRRLHNTIQELKGNIRVFCRVRPLVSGGLSKHIQLPASDDKSIVLAKTEESHTGKVADTQKNYNFSFDRVFGPQASQQEIFEEISLLVQSALDGYNVCVFAYGQTGSGKTYTMEGEEYDDT-RGVIPRAVQQVFKAGQKLAAQGWEFTFTASFVEIYNETLRDLLYTGKASKRP------EHEIRKMASNEVTVTNLTYEKVYTEDQVQGLIAVAKRNRSTAQTSQNDRSSRSHSVFQLHIEGVNAGRDVTCKSTLCLVDLAGSERMMKSQSQGDRF--KEMTAINSSLSNLGIVITSLANKESH-IPYRNSKLTYLLQGCLGGNSKTLMFVNISPESDSFGETLNSLRFASKVNDCVIGTA 622          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:101163027])

HSP 1 Score: 172.555 bits (436), Expect = 9.171e-44
Identity = 117/351 (33.33%), Postives = 180/351 (51.28%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEEN---------ILDYAGEDTL-ILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILS--GES-GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQV 2565
            RR+ + ++ E  GNIRV CR + +  E+           +D   E +L +LT      FE DKVFQP  +Q ++++E  PLV S IDGY+VC   YG   SGKT+T+ G   +    GI QR+L  +  E   R+  W Y +S   VEIYN+   D+LS  GE   ++I  D   +     L+ + + +      ++      R    T +N  SSRSH ++ I +QG     G      L L DLAG E + K+  +  ++  KEA  INRSL A   V  +L+ +  + V +R+++LT+LL+  L    K  ++V V   + ++G T  +L+F +    V LG A R++
Sbjct:  566 RRKYHEQLVELKGNIRVLCRVKPVLKEDQHEEGQSVVVAIDPNNESSLTVLTKGKGRVFELDKVFQPQATQEEIFQEIEPLVTSSIDGYHVCIFAYGQTGSGKTHTMEGTVENP---GINQRALKHLFHEIEERKDMWSYNVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVNSFQHIKKILATARRNRITFGTQMNQHSSRSHALLCITVQGTDLATGSKTTGKLNLVDLAGSERVWKSGAEGERL--KEAQNINRSLLALGDVIQALRARQTH-VPFRNSRLTYLLQDSLGKGSKTVMVVQVSALESNVGETLCSLKFAQRVCKVELGPAARKI 910          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 166.007 bits (419), Expect = 8.372e-42
Identity = 109/338 (32.25%), Postives = 179/338 (52.96%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEEN-------ILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL----SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGK 2523
            R++ +N +    GNIRV CR R +S EE        +L +  ED  +L  S   +   FE DK+F P  +Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  +  E   +  DW+Y+I+  +VEIYN+   D+L    + +  +++  D   +     L    + +  D + + ++    R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +L+ +  + V +R+++LT+LL+  L+   K  ++V V     +M  +  +L+F +
Sbjct:  444 RKKCHNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLYLSNKGKTMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVEGDP---GINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENPTDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRL--REAQCINKSLSALGDVISALRGKHAH-VPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSLKFAQ 775          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 166.007 bits (419), Expect = 1.188e-41
Identity = 109/338 (32.25%), Postives = 179/338 (52.96%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEEN-------ILDYAGEDTLILTTSFNER---FEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL----SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGK 2523
            R++ +N +    GNIRV CR R +S EE        +L +  ED  +L  S   +   FE DK+F P  +Q ++++E + LV S IDG+NVC   YG   SGKTYT+ G   D    GI QR+L  +  E   +  DW+Y+I+  +VEIYN+   D+L    + +  +++  D   +     L    + +  D + + ++    R  A T LN  SSRSH +++I + G +   G      L L DLAG E I K+  + +++  +EA  IN+SL+A   V  +L+ +  + V +R+++LT+LL+  L+   K  ++V V     +M  +  +L+F +
Sbjct:  550 RKKCHNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLYLSNKGKTMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVEGDP---GINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENPTDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRL--REAQCINKSLSALGDVISALRGKHAH-VPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSLKFAQ 881          
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 157.918 bits (398), Expect = 7.508e-40
Identity = 112/363 (30.85%), Postives = 177/363 (48.76%), Query Frame = 1
Query: 1552 RRQVYNRMQEQMGNIRVCCRCRHLSDEE----------NILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDIL--------------SGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVH 2568
            R++ YN +++  G IRV CR R ++  E           I DY+     + T      F+FDKVF    SQ +++++   L+ S IDGYNVC   YG   SGKT+T++GD +D    GIM RS   I    R     +E+K+SA ++E+YND   D+               S    V+I          Q  ++   ++  +   L Q     R +A T +N  SSRSHLI++I ++  +  +G      L L DLAG E   K   + +++  KEA  IN+SL+A   V  +L    P+ V YR++KLT +++  L  + K  +IV +   + ++  T  +L +    + +T   A+R V 
Sbjct:  261 RKKYYNMVEDMKGKIRVFCRLRPMNRNEAGQGGTAFVEKIDDYS---VSVETPRGLREFQFDKVFGAEASQDEVFQDTSRLIQSVIDGYNVCIFAYGQTGSGKTFTMVGD-KDQRNPGIMPRSFNAIFDITRENSSKFEFKVSAYMLELYNDRLQDLFISQAAEAQAQTQPSSQTRRVEIKRTRKGVVFAQGAETKEASSAQELYALFQQACANRHIAATKMNVESSRSHLIVVIMVESRNLTNGSISTGKLSLVDLAGSERAAKTGAKDHQL--KEANSINKSLSALGDVISALSADLPH-VPYRNSKLTQVMQDSLGGNAKTLMIVNISPSESNLDETLTSLIYATRVKAIT-NNAQRNVE 615          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000069914.1 (SMESG000069914.1)

HSP 1 Score: 1687.93 bits (4370), Expect = 0.000e+0
Identity = 846/846 (100.00%), Postives = 846/846 (100.00%), Query Frame = 1
Query:   58 MKSNDKSPNQXXXXXXXXXXXXXVFADYSFENKNVVNFGDNFTDEIQKKVDSNFHFYSKKSPVHFIAAQDCKTYMQFMHDISLINYENDVFIENLWKENEKNDQTMRLLFSFYKLYQEYSELYEILSNYATYYSGDNVQKFQEFPEKTAILVKENGENVSLKAETSNAENQTDHQLLKCNFVLTPIENEITIFPDNRSLIYGLKTLFKPPFKFGKCLKTGKFSKSTENFLNFRSLLYDRVAEKNIEVFEFEHYNCKKVVHKISLIKSDTSKKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQRTT 2595
            MKSNDKSPNQSIASLILPPPPLSVFADYSFENKNVVNFGDNFTDEIQKKVDSNFHFYSKKSPVHFIAAQDCKTYMQFMHDISLINYENDVFIENLWKENEKNDQTMRLLFSFYKLYQEYSELYEILSNYATYYSGDNVQKFQEFPEKTAILVKENGENVSLKAETSNAENQTDHQLLKCNFVLTPIENEITIFPDNRSLIYGLKTLFKPPFKFGKCLKTGKFSKSTENFLNFRSLLYDRVAEKNIEVFEFEHYNCKKVVHKISLIKSDTSKKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVEELKLKLKMEENKRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQRTT
Sbjct:    1 MKSNDKSPNQSIASLILPPPPLSVFADYSFENKNVVNFGDNFTDEIQKKVDSNFHFYSKKSPVHFIAAQDCKTYMQFMHDISLINYENDVFIENLWKENEKNDQTMRLLFSFYKLYQEYSELYEILSNYATYYSGDNVQKFQEFPEKTAILVKENGENVSLKAETSNAENQTDHQLLKCNFVLTPIENEITIFPDNRSLIYGLKTLFKPPFKFGKCLKTGKFSKSTENFLNFRSLLYDRVAEKNIEVFEFEHYNCKKVVHKISLIKSDTSKKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKSNCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVEELKLKLKMEENKRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQRTT 846          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000047227.1 (SMESG000047227.1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 271/397 (68.26%), Postives = 337/397 (84.89%), Query Frame = 1
Query: 1381 YLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQ-GIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVH 2568
            +L RQ++ +  +L++++ ++I+  S+  +++  + +++  +RQV+ELKLKLK EE KRR VYN MQEQMGN+RV CRCR +   EN+L+  G ++++L     ERF+FDKVF   +SQ+D+YEEFRPLVMSFIDG+NVCFITYG EASGKTYTLIG +    ++ GIMQR+L T+L E+ LR RDW+Y+I+AC+VEIYNDNC DILSGESG+Q+YVD GME+ +QKLKSVPI NE D D+L+Q+C  KRK+A+TALNPASSRSHLI LIRLQG SKIHGENI SF+CLCDLAGFEDIIKAETQ+NK LSKEAGYIN+SLTAFNRVFVSL+RQDPNTVCYRDTKLTHLLKPFLTNSGKCAL++T+R D+RS+ ST NTLRFG+ETRGV+LGKARRQV+
Sbjct:  644 HLRRQVSSLLKALKNNIDLIISLSSKHFMSDQHRNRIIQLARQVDELKLKLKEEETKRRIVYNLMQEQMGNVRVYCRCRDIPHNENVLEIQGNESIVLPILPQERFDFDKVFPSNMSQNDIYEEFRPLVMSFIDGFNVCFITYGSEASGKTYTLIGGSEGITEEYGIMQRALSTLLIEQSLRSRDWDYQITACLVEIYNDNCIDILSGESGIQLYVDCGMESVYQKLKSVPIKNENDTDILLQLCRSKRKIAKTALNPASSRSHLITLIRLQGKSKIHGENIRSFMCLCDLAGFEDIIKAETQSNKTLSKEAGYINKSLTAFNRVFVSLRRQDPNTVCYRDTKLTHLLKPFLTNSGKCALVITIRTDRRSLSSTQNTLRFGRETRGVSLGKARRQVN 1040          

HSP 2 Score: 60.4622 bits (145), Expect = 6.394e-9
Identity = 25/61 (40.98%), Postives = 43/61 (70.49%), Query Frame = 1
Query:  883 IKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYL 1065
            + +PI ++++LPK+Q  I  I  +C FL +PLE++AELR+ NY++   I +FK ++ LR +
Sbjct:  429 VDLPIIMDMMLPKMQVKIRQIFDECSFLNNPLEIMAELRHFNYNKNSTIDHFKNTRQLRSI 489          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000019919.1 (SMESG000019919.1)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 344/834 (41.25%), Postives = 476/834 (57.07%), Query Frame = 1
Query:  226 YSKKSPVHFIAAQDCKTYMQFMHDISLINYENDVFIENLWKENEKNDQTMRLLFSFYKLYQEYSELYEILSNYATYYSGDNV-QKFQEFPEKTAILVKENGEN----------------VSLKAETSNAENQTDHQLLKCNFVLTPIENEITIFPDNRSLI-YGLKTLFKPPFKFGKCLKTGKFSKSTENFLNFRSLLYDRVAEKNIEVFE-FEHYNCKKVV-HKISLIKSDT--SKKFQTIKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLR--------------------YLYSQHSTELGKFMKSNCCQL-KNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEKMTNNSLIQTEDQQEYSHQLGIIGDKLRVAK-EIQSNTL-NDVKYLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSA-------QQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHI 2571
            Y +K P++F++++D   Y+ F +              N   + + N++  RLL +F KLYQEYS            Y  DN+   F  +P +  +  K N EN                +S         N  DH +  C  V+  IEN+  +  +NR+L  + LK L +        +KT   S ST          YD++     E  E F +   ++V+ H+I+    D     K + I++PIALELL+PKIQ+ I  I+  C FL DPLEV AELR  NY+   C  +F+++K  R                    +L+ +  + L K    N   L  N      S    N   KN   +S  + P+    +   E +    +    LI+          +    +KL++ K EIQ   + N  KY      K  D     +  V+    + L+T++Q+ +++   +Q +ELK+KLK EE KR+ +YN MQ+Q+GN+RV CRCR      ++LD    DT+++ T F E ++FDKVF+P  SQ+ +YEEF+PL+MSFIDG+NVCFITYGGEASGKTYTL+G    S          G+M+R+L  +L E+  R+RDWEY+++ACVVEIYND   D+L+G++G+ + +D G+E     LKSVP+  +AD + LI+VC +KR+V +TALNP SSRSHLI +I L G SKIHGE I SFL +CDLAGFEDI+KAET  N  LSKEAGYIN+SLTAFNRVF SL+RQDPNTV YRDTKLT+LLKPFLTN GKC LIVTVR DK S+ ST +TLRFG+E+RGV LGKA+RQ ++
Sbjct:   62 YIRKLPINFVSSKDWSFYLHFTNKF------------NNPHKKKPNNRVYRLLSAFLKLYQEYS------------YVCDNILPSFMNYPNEANMFTKINNENNKNHVYNFDEYPQDADMSRLLYPPKCSNIHDHVV--CPNVM--IENKCQVLSENRTLKRWFLKKLHR--------VKTNS-SNSTHP--------YDKICRHQYETIEIFSNEKLQRVISHRINFTGFDAMGHPKIKWIQVPIALELLIPKIQHKIQRIMMTCNFLYDPLEVAAELRFFNYNVDMCTSHFQRTKKFRDILEEFLPQKSQLKELELQPHLWEKFKSFLDKMETENGGYLINNDASFSTSKISNNKSNKNTGSNSYPEIPMNKGASLMNEKERDTSVLQAKLIK----------VVCAIEKLKLTKSEIQQLVMRNQAKY-----KKQIDEYSLKITRVVEYFKDFLMTDEQRGRVIHLLKQNDELKIKLKDEEKKRKTIYNMMQDQLGNVRVYCRCRAFEKNHSVLDIKTNDTVMMQTGFFEEYKFDKVFEPFRSQAAIYEEFQPLIMSFIDGFNVCFITYGGEASGKTYTLLGATLSSPSCKDNDKHDGVMKRALKEVLAEQSARKRDWEYRLNACVVEIYNDTFIDLLTGDTGIHLPIDRGLEKVQASLKSVPVNCDADIEALIKVCKLKRRVGKTALNPQSSRSHLITMIHLTGRSKIHGETISSFLAMCDLAGFEDILKAETHNNLTLSKEAGYINKSLTAFNRVFTSLRRQDPNTVSYRDTKLTYLLKPFLTNQGKCVLIVTVRTDKSSISSTQSTLRFGRESRGVALGKAKRQANL 835          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000019241.1 (SMESG000019241.1)

HSP 1 Score: 484.182 bits (1245), Expect = 6.098e-156
Identity = 244/396 (61.62%), Postives = 305/396 (77.02%), Query Frame = 1
Query: 1381 YLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVH 2568
            +L RQ++ +  +L++++ ++I+  S+  +++  + +++  +RQV+ELKLKLK EE KRR VYN MQEQMGN+RV CRCR +   EN+L+  G ++++L     ERF+FDKVF   +SQ+D+YEEFRPLVMSFIDG+NVCFITYG EASGKTYTLIG +               ++ + RL   +                    L GESG+Q+YVD GME+ +QKLKSVPI NE D D+L+Q+C  KRK+A+TALNPASSRSHLI LIRLQG SKIHGENI SF+CLCDLAGFEDIIKAETQ+NK LSKEAGYIN+SLTAFNRVFVSL+RQDPNTVCYRDTKLTHLLKPFLTNSGKCAL++T+R D+RS+ ST NTLRFG+ETRGV+LGKARRQV+
Sbjct:  636 HLRRQVSSLLKALKNNIDLIISLSSKHFMSDQHRNRIIQLARQVDELKLKLKEEETKRRIVYNLMQEQMGNVRVYCRCRDIPHNENVLEIQGNESIVLPILPQERFDFDKVFPSNMSQNDIYEEFRPLVMSFIDGFNVCFITYGSEASGKTYTLIGGSE--------------VIAQSRLGLSNHS------------------LPGESGIQLYVDCGMESVYQKLKSVPIKNENDTDILLQLCRSKRKIAKTALNPASSRSHLITLIRLQGKSKIHGENIRSFMCLCDLAGFEDIIKAETQSNKTLSKEAGYINKSLTAFNRVFVSLRRQDPNTVCYRDTKLTHLLKPFLTNSGKCALVITIRTDRRSLSSTQNTLRFGRETRGVSLGKARRQVN 999          

HSP 2 Score: 60.4622 bits (145), Expect = 5.801e-9
Identity = 25/61 (40.98%), Postives = 43/61 (70.49%), Query Frame = 1
Query:  883 IKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYL 1065
            + +PI ++++LPK+Q  I  I  +C FL +PLE++AELR+ NY++   I +FK ++ LR +
Sbjct:  421 VDLPIIMDMMLPKMQVKIRQIFDECSFLNNPLEIMAELRHFNYNKNSTIDHFKNTRQLRSI 481          
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Match: SMESG000019241.1 (SMESG000019241.1)

HSP 1 Score: 484.182 bits (1245), Expect = 8.126e-156
Identity = 244/396 (61.62%), Postives = 305/396 (77.02%), Query Frame = 1
Query: 1381 YLSRQLNKVFDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVXXXXXXXXXXXXXRRQVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFDKVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNRDSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGESGVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPASSRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSKEAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCALIVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVH 2568
            +L RQ++ +  +L++++ ++I+  S+  +++  + +++  +RQV+ELKLKLK EE KRR VYN MQEQMGN+RV CRCR +   EN+L+  G ++++L     ERF+FDKVF   +SQ+D+YEEFRPLVMSFIDG+NVCFITYG EASGKTYTLIG +               ++ + RL   +                    L GESG+Q+YVD GME+ +QKLKSVPI NE D D+L+Q+C  KRK+A+TALNPASSRSHLI LIRLQG SKIHGENI SF+CLCDLAGFEDIIKAETQ+NK LSKEAGYIN+SLTAFNRVFVSL+RQDPNTVCYRDTKLTHLLKPFLTNSGKCAL++T+R D+RS+ ST NTLRFG+ETRGV+LGKARRQV+
Sbjct:  644 HLRRQVSSLLKALKNNIDLIISLSSKHFMSDQHRNRIIQLARQVDELKLKLKEEETKRRIVYNLMQEQMGNVRVYCRCRDIPHNENVLEIQGNESIVLPILPQERFDFDKVFPSNMSQNDIYEEFRPLVMSFIDGFNVCFITYGSEASGKTYTLIGGSE--------------VIAQSRLGLSNHS------------------LPGESGIQLYVDCGMESVYQKLKSVPIKNENDTDILLQLCRSKRKIAKTALNPASSRSHLITLIRLQGKSKIHGENIRSFMCLCDLAGFEDIIKAETQSNKTLSKEAGYINKSLTAFNRVFVSLRRQDPNTVCYRDTKLTHLLKPFLTNSGKCALVITIRTDRRSLSSTQNTLRFGRETRGVSLGKARRQVN 1007          

HSP 2 Score: 60.4622 bits (145), Expect = 5.766e-9
Identity = 25/61 (40.98%), Postives = 43/61 (70.49%), Query Frame = 1
Query:  883 IKIPIALELLLPKIQNDIDTILGQCPFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYL 1065
            + +PI ++++LPK+Q  I  I  +C FL +PLE++AELR+ NY++   I +FK ++ LR +
Sbjct:  429 VDLPIIMDMMLPKMQVKIRQIFDECSFLNNPLEIMAELRHFNYNKNSTIDHFKNTRQLRSI 489          
The following BLAST results are available for this feature:
BLAST of Kinesin motor domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIFC37.463e-4429.69kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC37.463e-4429.69kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC37.463e-4429.69kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC31.172e-4329.69kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC32.741e-4329.69kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-173.124e-4032.74Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-32.874e-3329.17Kinesin-like protein klp-3 [Source:UniProtKB/Swis... [more]
klp-168.417e-3128.41Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-168.417e-3128.41Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-158.804e-3128.70Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncd2.742e-3832.05gene:FBgn0002924 transcript:FBtr0344976[more]
ncd2.742e-3832.05gene:FBgn0002924 transcript:FBtr0085534[more]
Klp61F2.226e-3329.57gene:FBgn0004378 transcript:FBtr0072733[more]
Khc3.804e-2829.20gene:FBgn0001308 transcript:FBtr0087184[more]
Klp68D1.295e-2527.66gene:FBgn0004381 transcript:FBtr0332129[more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-257p13.32.915e-4432.22si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
si:ch211-257p13.36.262e-4432.22si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
kifc32.082e-4331.69kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc32.793e-4331.69kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc33.933e-4331.69kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc31.220e-4932.77kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc36.386e-4832.77kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc39.117e-4832.77kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc31.045e-4732.77kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc31.188e-4732.77kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kifc31.365e-4429.93kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc31.780e-4429.93kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc36.996e-4429.93kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc12.659e-3929.26kinesin family member C1 [Source:MGI Symbol;Acc:MG... [more]
Kifc15.168e-3929.26kinesin family member C1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin motor domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0WN69|KN14P_ARATH5.910e-4933.14Kinesin-like protein KIN-14P OS=Arabidopsis thalia... [more]
sp|Q0J9V3|KN14H_ORYSJ3.990e-4833.15Kinesin-like protein KIN-14H OS=Oryza sativa subsp... [more]
sp|P46875|KN14N_ARATH4.457e-4832.23Kinesin-like protein KIN-14N OS=Arabidopsis thalia... [more]
sp|F4IJK6|KN14R_ARATH2.716e-4733.52Kinesin-like protein KIN-14R OS=Arabidopsis thalia... [more]
sp|P46864|KN14M_ARATH5.269e-4732.42Kinesin-like protein KIN-14M OS=Arabidopsis thalia... [more]
back to top
BLAST of Kinesin motor domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P1114.165e-14143.74Kinesin family member C2/C3 OS=Paragonimus westerm... [more]
H2KNY91.148e-13639.35Kinesin family member C2/C3 OS=Clonorchis sinensis... [more]
A0A183AKL31.974e-13441.18Kinesin motor domain-containing protein OS=Echinos... [more]
A0A1S8XAP82.550e-13433.68Kinesin motor domain protein OS=Opisthorchis viver... [more]
A0A074Z3N14.134e-13433.68Kinesin motor domain-containing protein OS=Opistho... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc38.760e-4431.70kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
si:ch211-257p13.31.222e-4332.01kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
si:ch211-257p13.31.246e-4332.01kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
kifc31.319e-4331.70kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc32.246e-4331.70kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010492.11.238e-5134.80pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
kifc32.184e-5032.67kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca6.176e-2929.04kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
kif153.694e-2730.52kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000001811.16.636e-2728.09pep scaffold:Pmarinus_7.0:GL477555:33781:61877:1 g... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR31.191e-3831.22Minus-end-directed microtubule motor; functions in... [more]
KIP21.768e-2629.66Kinesin-related motor protein involved in mitotic ... [more]
KIP32.041e-2429.51Kinesin-related antiparallel sliding motor protein... [more]
KIP17.635e-2427.12Kinesin-related motor protein; required for mitoti... [more]
CIN81.957e-1633.13Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO459504.856e-5634.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316061.238e-5328.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349616.068e-4733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493521.334e-2929.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380702.741e-2927.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin motor domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc15.925e-4733.70kinesin family member C1 [Source:NCBI gene;Acc:101... [more]
si:ch211-257p13.39.171e-4433.33kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
kifc38.372e-4232.25kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
kifc31.188e-4132.25kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
si:dkey-96l17.67.508e-4030.85kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
back to top
BLAST of Kinesin motor domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069914.10.000e+0100.00SMESG000069914.1[more]
SMESG000047227.16.394e-968.26SMESG000047227.1[more]
SMESG000019919.10.000e+041.25SMESG000019919.1[more]
SMESG000019241.16.098e-15661.62SMESG000019241.1[more]
SMESG000019241.18.126e-15661.62SMESG000019241.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002362 ID=SMED30002362|Name=Kinesin motor domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2710bp
TAAACATTATTTATTAATATTCTATTCAATAAATAAATTTAAAAAATATG
AAGTATTATGAAGTCCAATGATAAAAGCCCTAATCAGAGTATTGCAAGTT
TAATTTTACCCCCGCCTCCCTTGTCAGTATTTGCAGATTACAGTTTTGAA
AATAAAAATGTTGTAAATTTTGGAGATAATTTCACGGATGAAATTCAGAA
AAAAGTTGATTCAAATTTTCATTTTTATTCAAAAAAGTCTCCAGTACATT
TCATCGCGGCACAAGATTGCAAAACCTATATGCAATTTATGCACGACATT
TCATTAATTAATTATGAAAATGATGTTTTTATTGAAAATTTGTGGAAAGA
AAATGAAAAAAACGATCAAACAATGCGTTTATTATTCTCCTTTTATAAAT
TATATCAAGAGTATTCAGAACTATATGAAATATTATCGAATTATGCAACG
TATTATTCGGGAGATAATGTTCAAAAATTTCAAGAGTTTCCAGAAAAAAC
TGCAATTCTAGTGAAAGAAAATGGAGAAAATGTTTCACTAAAAGCTGAAA
CATCCAATGCAGAAAACCAAACAGATCATCAATTATTAAAATGCAATTTT
GTGTTGACTCCAATTGAAAACGAAATCACGATCTTCCCTGATAATCGTTC
TTTAATTTATGGGCTCAAAACCTTATTTAAACCTCCATTTAAATTCGGGA
AATGCTTAAAGACAGGAAAATTTTCCAAGTCAACCGAAAATTTTTTGAAT
TTTAGATCATTACTTTACGATAGAGTTGCTGAGAAGAACATTGAGGTATT
CGAATTCGAGCATTACAATTGCAAAAAGGTTGTCCATAAGATTTCCCTCA
TAAAGTCTGATACGTCAAAGAAATTCCAAACGATTAAGATACCAATTGCT
TTGGAATTACTTTTGCCGAAGATTCAAAACGATATCGATACAATATTAGG
TCAATGTCCATTTCTTTGCGATCCCCTGGAGGTGATCGCTGAATTGCGCA
ATTGTAATTACGACCAAATAAAATGCATTCAATACTTTAAAAAGTCAAAA
TTTCTCAGATATTTGTATTCACAACATAGTACGGAATTGGGGAAATTTAT
GAAATCAAACTGCTGTCAACTAAAAAACAGTTTACCACGAGAAATATCCA
GTACACCGATAAATTCTATCTATAAAAATATTTCGTTTTCCAGCGTATGT
AAATTCCCATTGGCTGACGCCAAAACTAGAAGACGCGAAAGTCAAAACTT
TGAGAAAATGACAAATAATTCACTTATTCAAACAGAGGATCAACAAGAAT
ATTCACATCAATTAGGCATTATTGGTGATAAATTGAGGGTTGCTAAAGAA
ATTCAAAGCAATACGTTAAATGATGTGAAATATCTCTCAAGGCAATTGAA
TAAGGTATTCGATTCATTAAGAAGTCATATGTTAGTGGTAATAAATCAGT
GCAGCGAACGACTCGTAACAAACGACCAGAAAATAAAGTTATTGGCATTT
TCAAGGCAGGTTGAAGAATTAAAACTGAAGCTAAAAATGGAGGAAAATAA
AAGACGTCAAGTTTATAACCGAATGCAGGAACAAATGGGGAATATTAGAG
TATGCTGTCGATGCAGACATTTGTCAGACGAAGAAAACATTTTGGATTAT
GCCGGTGAAGATACTTTAATTTTGACCACTTCGTTTAATGAGCGCTTTGA
ATTTGATAAAGTTTTCCAGCCAGGAGTTTCTCAATCTGATCTCTATGAAG
AATTTCGTCCATTAGTTATGTCGTTTATTGATGGATATAATGTCTGCTTT
ATAACATATGGCGGAGAAGCCAGCGGTAAAACCTATACATTAATTGGTGA
CAATAGAGATTCAGCACAACAGGGAATAATGCAGAGATCACTAGTGACAA
TACTGACAGAGGAGCGACTGAGACAACGAGACTGGGAATACAAAATCAGC
GCATGTGTTGTGGAAATATATAATGACAACTGTACCGATATTCTCAGTGG
AGAAAGCGGTGTACAGATCTACGTTGATCACGGAATGGAAACCGCATTTC
AAAAGTTAAAGAGTGTTCCCATAACAAATGAAGCAGATGCCGATGTGCTA
ATCCAAGTATGTACTGTTAAACGAAAAGTAGCCCGAACCGCTCTAAATCC
CGCGTCCTCTAGGTCTCACCTCATAATTTTAATACGACTACAAGGCTGTT
CCAAAATCCACGGAGAGAATATCTGTAGTTTTCTATGCTTGTGCGATTTG
GCGGGTTTCGAAGACATAATCAAGGCGGAAACCCAAACCAATAAAGTCCT
AAGCAAAGAGGCCGGCTACATAAATCGTTCATTGACGGCGTTCAATAGAG
TTTTCGTCAGTTTAAAACGACAAGACCCAAACACAGTATGTTACCGAGAC
ACAAAACTAACACATCTGTTAAAGCCATTTCTGACAAATTCGGGAAAATG
CGCCCTCATAGTAACCGTTCGAAACGACAAAAGAAGCATGGGATCGACTC
ACAACACTTTACGATTCGGAAAGGAAACTCGAGGCGTCACCCTTGGCAAA
GCCCGCCGACAAGTTCACATAAGTAATCCCAATCAACGGACAACTTAATT
GACCAATAAAATACAAGTTTCAATTACCTATATAAATAAAAATGTATTCT
AAAAATATTCTGATTACACTAATTTTTGTTGAAAAGCAGTCAGAAACAAA
TAAAATTCTT
back to top

protein sequence of SMED30002362-orf-1

>SMED30002362-orf-1 ID=SMED30002362-orf-1|Name=SMED30002362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=847bp
MKSNDKSPNQSIASLILPPPPLSVFADYSFENKNVVNFGDNFTDEIQKKV
DSNFHFYSKKSPVHFIAAQDCKTYMQFMHDISLINYENDVFIENLWKENE
KNDQTMRLLFSFYKLYQEYSELYEILSNYATYYSGDNVQKFQEFPEKTAI
LVKENGENVSLKAETSNAENQTDHQLLKCNFVLTPIENEITIFPDNRSLI
YGLKTLFKPPFKFGKCLKTGKFSKSTENFLNFRSLLYDRVAEKNIEVFEF
EHYNCKKVVHKISLIKSDTSKKFQTIKIPIALELLLPKIQNDIDTILGQC
PFLCDPLEVIAELRNCNYDQIKCIQYFKKSKFLRYLYSQHSTELGKFMKS
NCCQLKNSLPREISSTPINSIYKNISFSSVCKFPLADAKTRRRESQNFEK
MTNNSLIQTEDQQEYSHQLGIIGDKLRVAKEIQSNTLNDVKYLSRQLNKV
FDSLRSHMLVVINQCSERLVTNDQKIKLLAFSRQVEELKLKLKMEENKRR
QVYNRMQEQMGNIRVCCRCRHLSDEENILDYAGEDTLILTTSFNERFEFD
KVFQPGVSQSDLYEEFRPLVMSFIDGYNVCFITYGGEASGKTYTLIGDNR
DSAQQGIMQRSLVTILTEERLRQRDWEYKISACVVEIYNDNCTDILSGES
GVQIYVDHGMETAFQKLKSVPITNEADADVLIQVCTVKRKVARTALNPAS
SRSHLIILIRLQGCSKIHGENICSFLCLCDLAGFEDIIKAETQTNKVLSK
EAGYINRSLTAFNRVFVSLKRQDPNTVCYRDTKLTHLLKPFLTNSGKCAL
IVTVRNDKRSMGSTHNTLRFGKETRGVTLGKARRQVHISNPNQRTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008569ATP-dependent microtubule motor activity, minus-end-directed
GO:0008017microtubule binding
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
IPR000834Peptidase_M14
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.531