GATA456-2

Overview
NameGATA456-2
Smed IDSMED30002349
Length (bp)1336
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GATA456-2 (SMED30002349) t-SNE clustered cells

Violin plots show distribution of expression levels for GATA456-2 (SMED30002349) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GATA456-2 (SMED30002349) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GATA456-2 (SMED30002349) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002349

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30002349SMESG000022702.1 dd_Smed_v4_9910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002349SMESG000022702.1 dd_Smed_v4_9910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002349SMESG000022702.1 dd_Smed_v4_9910_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30002349SMESG000022702.1 dd_Smed_v4_9910_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30002349SMESG000022702.1 dd_Smed_v4_9910_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
medial-lateral axis of the whole animalSMED30002349SMESG000022702.1 dd_Smed_v4_9910_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002349SMESG000022702.1 KX827244smed_ncbi_20200123PMID:28287248
González-Sastre et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30002349SMESG000022702.1 KX827244smed_ncbi_20200123PMID:28287248
González-Sastre et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GATA456-2 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 96.6709 bits (239), Expect = 3.056e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:    6 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456-2 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 96.6709 bits (239), Expect = 3.056e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:    6 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456-2 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 93.9745 bits (232), Expect = 5.429e-22
Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGL-------------YHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456-2 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 93.9745 bits (232), Expect = 5.429e-22
Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGL-------------YHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456-2 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 98.9821 bits (245), Expect = 7.886e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:  213 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 318          
BLAST of GATA456-2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 107.457 bits (267), Expect = 2.860e-25
Identity = 50/112 (44.64%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+   KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 317          
BLAST of GATA456-2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 107.842 bits (268), Expect = 4.116e-25
Identity = 50/112 (44.64%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+   KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          
BLAST of GATA456-2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 107.071 bits (266), Expect = 4.162e-25
Identity = 52/113 (46.02%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTA-KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+Q A KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 318          
BLAST of GATA456-2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 107.071 bits (266), Expect = 6.171e-25
Identity = 52/113 (46.02%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTA-KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+Q A KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  286 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          
BLAST of GATA456-2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 107.071 bits (266), Expect = 6.213e-25
Identity = 52/113 (46.02%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTA-KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+Q A KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 390          
BLAST of GATA456-2 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0081808)

HSP 1 Score: 100.523 bits (249), Expect = 1.371e-22
Identity = 48/113 (42.48%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C         +  LI   ++  +    + +  AKR G  C+NCKT  TTLWRRN+ G+PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  258 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQ---SLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 367          

HSP 2 Score: 53.1434 bits (126), Expect = 3.183e-7
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 2
Query:  827 KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRP--PTMRKEILQS 985
            +  G +C NC   +T LWRR+  G  +CNACGLYY+++  +RP     R+  LQS
Sbjct:  255 REEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQS 309          
BLAST of GATA456-2 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0330188)

HSP 1 Score: 100.908 bits (250), Expect = 1.739e-22
Identity = 48/113 (42.48%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C         +  LI   ++  +    + +  AKR G  C+NCKT  TTLWRRN+ G+PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  471 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQ---SLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          
BLAST of GATA456-2 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0300040)

HSP 1 Score: 100.908 bits (250), Expect = 1.875e-22
Identity = 50/120 (41.67%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C        +  P + P   L     +S           AKR G  C+NCKT  TTLWRRN+ G+PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  471 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQS----------AAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          
BLAST of GATA456-2 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0083221)

HSP 1 Score: 97.4413 bits (241), Expect = 1.714e-21
Identity = 48/122 (39.34%), Postives = 65/122 (53.28%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C           P + PS             K L      +R GL C+NC T  TTLWRRN++G+PVCNACGLYY+LH  +RP  MRK+ +Q+
Sbjct:  164 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPS-------------KRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 272          
BLAST of GATA456-2 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0335427)

HSP 1 Score: 97.0561 bits (240), Expect = 1.836e-21
Identity = 48/122 (39.34%), Postives = 65/122 (53.28%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C           P + PS             K L      +R GL C+NC T  TTLWRRN++G+PVCNACGLYY+LH  +RP  MRK+ +Q+
Sbjct:  112 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPS-------------KRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 220          
BLAST of GATA456-2 vs. Ensembl Zebrafish
Match: gata1b (GATA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-081104-43])

HSP 1 Score: 96.6709 bits (239), Expect = 2.237e-22
Identity = 49/113 (43.36%), Postives = 66/113 (58.41%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG      + +DG G++ C  C   +     +  LI   K         R   +KR G QC+NC+T  TTLWRRNS G+PVCNACGLY++LH  +RP  M+KE +Q+
Sbjct:   77 ARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKK---------RPVVSKRIGTQCANCQTSTTTLWRRNSSGEPVCNACGLYFKLHNVNRPLAMKKEGIQT 180          
BLAST of GATA456-2 vs. Ensembl Zebrafish
Match: gata6 (GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-000622-1])

HSP 1 Score: 99.3673 bits (246), Expect = 2.528e-22
Identity = 49/113 (43.36%), Postives = 67/113 (59.29%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            ++ECV CG  +   + +DG G+F C  C   +     S  LI         K   R  +++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  199 SRECVNCGSMSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLI---------KPQKRMSSSRRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 302          
BLAST of GATA456-2 vs. Ensembl Zebrafish
Match: gata1a (GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-980526-268])

HSP 1 Score: 98.9821 bits (245), Expect = 3.420e-22
Identity = 48/120 (40.00%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG      + +DG G++ C  C        +  P + P   LI                 +KR G QC+NC T  TTLWRRN+ G+PVCNACGLY++LH  +RP TM+K+ +Q+
Sbjct:  235 ARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLI----------------VSKRAGTQCANCHTSTTTLWRRNASGEPVCNACGLYFKLHNVNRPLTMKKDGIQT 338          
BLAST of GATA456-2 vs. Ensembl Zebrafish
Match: gata1a (GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-980526-268])

HSP 1 Score: 98.9821 bits (245), Expect = 3.420e-22
Identity = 48/120 (40.00%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG      + +DG G++ C  C        +  P + P   LI                 +KR G QC+NC T  TTLWRRN+ G+PVCNACGLY++LH  +RP TM+K+ +Q+
Sbjct:  235 ARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLI----------------VSKRAGTQCANCHTSTTTLWRRNASGEPVCNACGLYFKLHNVNRPLTMKKDGIQT 338          
BLAST of GATA456-2 vs. Ensembl Zebrafish
Match: gata1b (GATA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-081104-43])

HSP 1 Score: 98.2117 bits (243), Expect = 3.745e-22
Identity = 49/117 (41.88%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG      + +DG G++ C  C                +K +  N+ L R +     +KR G QC+NC+T  TTLWRRNS G+PVCNACGLY++LH  +RP  M+KE +Q+
Sbjct:  195 ARECVNCGATATPLWRRDGTGHYLCNACGLY-------------HKMNGQNRPLIRPKKRPVVSKRIGTQCANCQTSTTTLWRRNSSGEPVCNACGLYFKLHNVNRPLAMKKEGIQT 298          
BLAST of GATA456-2 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 98.2117 bits (243), Expect = 1.303e-21
Identity = 48/113 (42.48%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   A+R G  C+NC+T  TTLWRRN+ G PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          

HSP 2 Score: 51.6026 bits (122), Expect = 1.704e-6
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  815 KQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            K  +   G +C NC   +T LWRR+  G  +CNACGLY++++  +RP    K  L +
Sbjct:  247 KTRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSA 303          
BLAST of GATA456-2 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 98.2117 bits (243), Expect = 1.432e-21
Identity = 48/113 (42.48%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   A+R G  C+NC+T  TTLWRRN+ G PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          

HSP 2 Score: 51.6026 bits (122), Expect = 1.691e-6
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  815 KQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            K  +   G +C NC   +T LWRR+  G  +CNACGLY++++  +RP    K  L +
Sbjct:  247 KTRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSA 303          
BLAST of GATA456-2 vs. Ensembl Xenopus
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:496852])

HSP 1 Score: 96.2857 bits (238), Expect = 2.875e-21
Identity = 48/119 (40.34%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q    +++R GL C+NC T  TTLWRRNSEG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  179 GEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQKRLSSSRRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQT 284          
BLAST of GATA456-2 vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:Xenbase;Acc:XB-GENE-1011481])

HSP 1 Score: 96.2857 bits (238), Expect = 3.379e-21
Identity = 47/119 (39.50%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  181 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 286          
BLAST of GATA456-2 vs. Ensembl Xenopus
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:496852])

HSP 1 Score: 96.2857 bits (238), Expect = 3.534e-21
Identity = 48/119 (40.34%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q    +++R GL C+NC T  TTLWRRNSEG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  179 GEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQKRLSSSRRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQT 284          
BLAST of GATA456-2 vs. Ensembl Mouse
Match: Gata5 (GATA binding protein 5 [Source:MGI Symbol;Acc:MGI:109497])

HSP 1 Score: 99.7525 bits (247), Expect = 2.304e-22
Identity = 50/119 (42.02%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C                +K + +N+ L R Q    +++R+GL CSNC T  TTLWRRNSEG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  191 GEGRECVNCGALSTPLWRRDGTGHYLCNACGLY-------------HKMNGVNRPLVRPQKRLSSSRRSGLCCSNCHTATTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQT 296          
BLAST of GATA456-2 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 95.9005 bits (237), Expect = 3.433e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:    6 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456-2 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 98.5969 bits (244), Expect = 6.727e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:  212 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 317          

HSP 2 Score: 51.9878 bits (123), Expect = 9.737e-7
Identity = 25/72 (34.72%), Postives = 37/72 (51.39%), Query Frame = 2
Query:  740 NPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRP 955
             P  +P L  +P       + NL         G +C NC   +T LWRR+  G  +CNACGLY++++  +RP
Sbjct:  182 GPFDSPVLHSLPGRANPGRHPNLVDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRP 253          
BLAST of GATA456-2 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 98.5969 bits (244), Expect = 6.931e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:  211 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 316          
BLAST of GATA456-2 vs. Ensembl Mouse
Match: Gata3 (GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:95663])

HSP 1 Score: 97.8265 bits (242), Expect = 1.316e-21
Identity = 48/115 (41.74%), Postives = 65/115 (56.52%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   A+R G  C+NC+T  TTLWRRN+ G PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  258 TEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          

HSP 2 Score: 51.2174 bits (121), Expect = 1.527e-6
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  815 KQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            K  +   G +C NC   +T LWRR+  G  +CNACGLY++++  +RP    K  L +
Sbjct:  253 KARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSA 309          
BLAST of GATA456-2 vs. UniProt/SwissProt
Match: sp|P28515|ELT1_CAEEL (Transcription factor elt-1 OS=Caenorhabditis elegans OX=6239 GN=elt-1 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 5.295e-24
Identity = 52/113 (46.02%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTA-KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+Q A KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 318          
BLAST of GATA456-2 vs. UniProt/SwissProt
Match: sp|P91623|GATAC_DROME (GATA-binding factor C OS=Drosophila melanogaster OX=7227 GN=grn PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.374e-21
Identity = 48/113 (42.48%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C         +  LI   ++  +    + +  AKR G  C+NCKT  TTLWRRN+ G+PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  258 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQ---SLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 367          

HSP 2 Score: 53.1434 bits (126), Expect = 3.190e-6
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 2
Query:  827 KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRP--PTMRKEILQS 985
            +  G +C NC   +T LWRR+  G  +CNACGLYY+++  +RP     R+  LQS
Sbjct:  255 REEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQS 309          
BLAST of GATA456-2 vs. UniProt/SwissProt
Match: sp|P97489|GATA5_MOUSE (Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.611e-21
Identity = 50/119 (42.02%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
               +ECV CG  +   + +DG G++ C  C                +K + +N+ L R Q    +++R+GL CSNC T  TTLWRRNSEG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  191 GEGRECVNCGALSTPLWRRDGTGHYLCNACGLY-------------HKMNGVNRPLVRPQKRLSSSRRSGLCCSNCHTATTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQT 296          
BLAST of GATA456-2 vs. UniProt/SwissProt
Match: sp|P43694|GATA4_HUMAN (Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 3.902e-21
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:  212 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 317          
BLAST of GATA456-2 vs. UniProt/SwissProt
Match: sp|P46152|GATA4_RAT (Transcription factor GATA-4 OS=Rattus norvegicus OX=10116 GN=Gata4 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.507e-21
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     ++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  MRKE +Q+
Sbjct:  211 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 316          
BLAST of GATA456-2 vs. TrEMBL
Match: A0A1L6KW39 (GATA456-2 OS=Schmidtea mediterranea OX=79327 GN=gata456-2 PE=2 SV=1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 359/370 (97.03%), Postives = 360/370 (97.30%), Query Frame = 2
Query:  134 MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLIN-NYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMAXXXXXXXXXXXXXXXXXNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 1240
            MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLIN +YHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMASEYSKSD   S      NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ
Sbjct:    1 MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINIDYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMASEYSKSDVNSS------NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 364          
BLAST of GATA456-2 vs. TrEMBL
Match: F1CDE5 (GATA456b OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 334/370 (90.27%), Postives = 344/370 (92.97%), Query Frame = 2
Query:  134 MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMAXXXXXXXXXXXXXXXXXNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTNGHCI-PTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 1240
            MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMN+C+GVRYPF YPS Q S QD+ D KVP NLINNYHLLNSMWPNH+DS+SR+QMQYP MQY SQCNYNPLQPSVP HYSIP ENQMFIEQVKTMV DQAHLQNCQKMNFSDYSM+ASEYSKSD   S      NRAKECVICGMENGDTYHQDGN NFHCLNCVRKNPCVNPSLDLIPSYKK+QMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTM MKYMDQEFPIKSETQ+MSSPFTNGHCI  TTDKYDS+FRHH FELTQPPSNINDMVQHPITNISHHGPFDYIPQ
Sbjct:    1 MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMNLCNGVRYPFTYPSVQASGQDFPDTKVPPNLINNYHLLNSMWPNHIDSMSRAQMQYPQMQY-SQCNYNPLQPSVPTHYSIPSENQMFIEQVKTMVIDQAHLQNCQKMNFSDYSMLASEYSKSDVNSS------NRAKECVICGMENGDTYHQDGNENFHCLNCVRKNPCVNPSLDLIPSYKKNQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMSMKYMDQEFPIKSETQLMSSPFTNGHCIQQTTDKYDSTFRHHGFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 363          
BLAST of GATA456-2 vs. TrEMBL
Match: G0PAQ2 (Uncharacterized protein OS=Caenorhabditis brenneri OX=135651 GN=CAEBREN_00985 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.308e-22
Identity = 53/113 (46.90%), Postives = 70/113 (61.95%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTA-KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+Q A KRTG++C NC T NTTLWRRN EG PVCNACGLYY+LHK  RP  M+K+ +Q+
Sbjct:  210 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCHTNNTTLWRRNGEGHPVCNACGLYYKLHKVERPMAMKKDGIQT 313          
BLAST of GATA456-2 vs. TrEMBL
Match: G0NRC3 (CBN-ELT-1 protein OS=Caenorhabditis brenneri OX=135651 GN=Cbn-elt-1 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 8.603e-22
Identity = 53/113 (46.90%), Postives = 70/113 (61.95%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTA-KRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+Q A KRTG++C NC T NTTLWRRN EG PVCNACGLYY+LHK  RP  M+K+ +Q+
Sbjct:  210 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCHTNNTTLWRRNGEGHPVCNACGLYYKLHKVERPMAMKKDGIQT 313          
BLAST of GATA456-2 vs. TrEMBL
Match: A0A061ACV8 (Transcription factor elt-1 OS=Caenorhabditis elegans OX=6239 GN=elt-1 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.078e-21
Identity = 50/112 (44.64%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  650 KECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +ECV CG+ N   + +DG+GN+ C  C          L    ++    + K   R+   KRTG++C NC+T  TTLWRRN EG PVCNACGLY++LHK  RP TM+K+ +Q+
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNAC---------GLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 317          
BLAST of GATA456-2 vs. Ensembl Cavefish
Match: gata6 (GATA binding protein 6 [Source:NCBI gene;Acc:103028246])

HSP 1 Score: 100.908 bits (250), Expect = 1.245e-22
Identity = 50/113 (44.25%), Postives = 67/113 (59.29%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG  +   + +DG G+F C  C   +     S  LI         K   R  +++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  292 ARECVNCGSVSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLI---------KPQKRMASSRRLGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 395          
BLAST of GATA456-2 vs. Ensembl Cavefish
Match: ENSAMXT00000017595.2 (GATA-binding factor 1-B-like [Source:NCBI gene;Acc:103031807])

HSP 1 Score: 100.138 bits (248), Expect = 1.293e-22
Identity = 48/122 (39.34%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
              A+ECV CG      + +DG G++ C  C        +  P + P   L+                 +KR G QC+NC+T  TTLWRRN+ G+PVCNACGLY++LH  +RP TM+KE +Q+
Sbjct:  237 TEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLV----------------VSKRAGTQCANCQTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQT 342          
BLAST of GATA456-2 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 97.4413 bits (241), Expect = 1.455e-21
Identity = 48/115 (41.74%), Postives = 66/115 (57.39%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   A+R G  C+NC+T  TTLWRRN+ G PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  253 SEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 358          
BLAST of GATA456-2 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 97.0561 bits (240), Expect = 1.562e-21
Identity = 48/115 (41.74%), Postives = 66/115 (57.39%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            +  +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   A+R G  C+NC+T  TTLWRRN+ G PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:  255 SEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 360          
BLAST of GATA456-2 vs. Ensembl Cavefish
Match: gata1a (GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-980526-268])

HSP 1 Score: 96.2857 bits (238), Expect = 1.628e-21
Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG      + +DG G++ C  C                +K +  N+ L R +     +KR G QC+NC+T  TTLWRRN  G+PVCNACGLY++LH  +RP TM+K+ +Q+
Sbjct:  200 ARECVNCGATATPLWRRDGTGHYLCNACGLY-------------HKMNGQNRPLIRPKKRLIVSKRAGTQCANCQTSTTTLWRRNVNGEPVCNACGLYFKLHNVNRPLTMKKDGIQT 303          
BLAST of GATA456-2 vs. Ensembl Sea Lamprey
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:30458])

HSP 1 Score: 93.2041 bits (230), Expect = 2.148e-22
Identity = 48/113 (42.48%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   A+R G  C+NC+T  TTLWRRN+ G PVCNACGLYY+LH  +RP TM+KE +Q+
Sbjct:    2 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSAARRAGTSCANCQTTITTLWRRNASGDPVCNACGLYYKLHNINRPLTMKKEGIQT 105          
BLAST of GATA456-2 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 90.5077 bits (223), Expect = 1.262e-21
Identity = 46/113 (40.71%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C   +     +  LI         K   R   ++R G  C+NC+T  TTLWRRN  G+PVCNACGLYY+LH  +RP +M+KE +Q+
Sbjct:   59 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLI---------KPKRRLSASRRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQT 162          
BLAST of GATA456-2 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 90.1225 bits (222), Expect = 5.257e-21
Identity = 46/120 (38.33%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C        +  P + P   L  S                +R G  C+NC+T  TTLWRRN  G+PVCNACGLYY+LH  +RP +M+KE +Q+
Sbjct:   27 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAS----------------RRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQT 130          
BLAST of GATA456-2 vs. Ensembl Sea Lamprey
Match: gata4 (GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-980526-476])

HSP 1 Score: 68.9366 bits (167), Expect = 1.664e-14
Identity = 41/117 (35.04%), Postives = 62/117 (52.99%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG G++ C  C   N             K + +N+ L + Q     ++R GL CSNC+T  TTLWRRN+EG+P   ACG+   +    RP  M+K+ +Q+
Sbjct:   13 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYN-------------KMNGINRPLIKPQRRMSGSRRVGLSCSNCQTSTTTLWRRNAEGEPGYIACGIIV-IEGVPRPLAMKKDGIQT 115          
BLAST of GATA456-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000698.1 (pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 gene:ENSPMAG00000000635.1 transcript:ENSPMAT00000000698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 8.579e-10
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 2
Query:  818 QTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKE 973
            Q  +  GL C NC T  TTLWR+N+ G  VCNACGLY +LH   RP ++ K+
Sbjct:    1 QRKRGQGLFCVNCLTTTTTLWRKNAGGVYVCNACGLYEKLHSAPRPLSIIKQ 52          
BLAST of GATA456-2 vs. Ensembl Yeast
Match: GLN3 (Transcriptional activator of genes regulated by nitrogen catabolite repression; localization and activity regulated by quality of nitrogen source and Ure2p [Source:SGD;Acc:S000000842])

HSP 1 Score: 70.0922 bits (170), Expect = 2.620e-13
Identity = 35/94 (37.23%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  716 HCLNCVRKNPCVNP-SLDLIPSYKK----SQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQ 982
            +  N VRKN  + P S   + ++K+    S    N+      K+  +QC NCKT  T LWRR+ EG  +CNACGL+ +LH T RP +++ ++++
Sbjct:  258 NTTNSVRKNSLIKPMSSTSLANFKRAASVSSSISNMEPSGQNKKPLIQCFNCKTFKTPLWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIK 351          
BLAST of GATA456-2 vs. Ensembl Yeast
Match: GAT1 (Transcriptional activator of nitrogen catabolite repression genes; contains a GATA-1-type zinc finger DNA-binding motif; activity and localization regulated by nitrogen limitation and Ure2p; different translational starts produce two major and two minor isoforms that are differentially regulated and localized [Source:SGD;Acc:S000001873])

HSP 1 Score: 64.6994 bits (156), Expect = 9.988e-12
Identity = 23/54 (42.59%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  821 TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQ 982
            T+    ++CSNC T  T LWR++ +G P+CNACGL+ +LH   RP +++ +I++
Sbjct:  302 TSSNPDIKCSNCTTSTTPLWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIK 355          
BLAST of GATA456-2 vs. Ensembl Yeast
Match: GZF3 (GATA zinc finger protein; negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p; GZF3 has a paralog, DAL80, that arose from the whole genome duplication [Source:SGD;Acc:S000003646])

HSP 1 Score: 56.9954 bits (136), Expect = 2.937e-9
Identity = 21/47 (44.68%), Postives = 32/47 (68.09%), Query Frame = 2
Query:  845 CSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            C NC T  T LWRR+  G  +CNACGL+ +LH   RP +++ ++++S
Sbjct:  131 CKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKS 177          
BLAST of GATA456-2 vs. Ensembl Yeast
Match: DAL80 (Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Gzf3p; DAL80 has a paralog, GZF3, that arose from the whole genome duplication [Source:SGD;Acc:S000001742])

HSP 1 Score: 54.299 bits (129), Expect = 9.543e-9
Identity = 21/47 (44.68%), Postives = 31/47 (65.96%), Query Frame = 2
Query:  845 CSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            C NC T  T LWRR+  G  +CNACGL+ +LH   RP +++ + ++S
Sbjct:   31 CQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPISLKTDTIKS 77          
BLAST of GATA456-2 vs. Ensembl Nematostella
Match: GATA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY2])

HSP 1 Score: 92.8189 bits (229), Expect = 1.318e-20
Identity = 46/113 (40.71%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
             +ECV CG  +   + +DG+G++ C  C   +     S  LI         K   R   A+R G  C+NC T  TTLWRRN  G PVCNACGLY++LH  +RP +M+K+ +Q+
Sbjct:  215 GRECVNCGATSTPLWRRDGSGHYLCNACGLYHKMNGSSRPLI---------KPKRRLSAARRAGTSCANCHTTQTTLWRRNQNGDPVCNACGLYWKLHAVNRPLSMKKDGIQT 318          
BLAST of GATA456-2 vs. Ensembl Medaka
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:101164399])

HSP 1 Score: 100.523 bits (249), Expect = 6.181e-23
Identity = 58/153 (37.91%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ-----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTN 1090
             +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     T++R GL C+NC T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+RKRK K  +       +    +KSE  +  SP+  
Sbjct:  178 GRECVNCGSVSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQKRLQSTSRRAGLCCTNCHTSTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKLPKNRTSAVSEHASTVKSEPTLAPSPYAG 317          
BLAST of GATA456-2 vs. Ensembl Medaka
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:101164399])

HSP 1 Score: 100.523 bits (249), Expect = 6.181e-23
Identity = 58/153 (37.91%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ-----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTN 1090
             +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     T++R GL C+NC T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+RKRK K  +       +    +KSE  +  SP+  
Sbjct:  178 GRECVNCGSVSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQKRLQSTSRRAGLCCTNCHTSTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKLPKNRTSAVSEHASTVKSEPTLAPSPYAG 317          
BLAST of GATA456-2 vs. Ensembl Medaka
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:101164399])

HSP 1 Score: 100.523 bits (249), Expect = 6.181e-23
Identity = 58/153 (37.91%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQ-----TAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTN 1090
             +ECV CG  +   + +DG G++ C  C                +K + +N+ L + Q     T++R GL C+NC T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+RKRK K  +       +    +KSE  +  SP+  
Sbjct:  178 GRECVNCGSVSTPLWRRDGTGHYLCNACGLY-------------HKMNGINRPLIKPQKRLQSTSRRAGLCCTNCHTSTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKLPKNRTSAVSEHASTVKSEPTLAPSPYAG 317          
BLAST of GATA456-2 vs. Ensembl Medaka
Match: gata6 (GATA binding protein 6 [Source:NCBI gene;Acc:101159296])

HSP 1 Score: 100.908 bits (250), Expect = 1.191e-22
Identity = 50/115 (43.48%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  641 NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
              ++ECV CG  +   + +DG G+F C  C   +     S  LI         K   R  T++R GL C+NC+T  TTLWRRN+EG+PVCNACGLY +LH   RP  M+KE +Q+
Sbjct:  287 GESRECVNCGSISTPLWRRDGTGHFLCNACGLYSKMNGLSRPLI---------KPQKRTSTSRRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 392          
BLAST of GATA456-2 vs. Ensembl Medaka
Match: gata-1 (hematopietic transcription factor GATA-1 [Source:NCBI gene;Acc:100125425])

HSP 1 Score: 100.138 bits (248), Expect = 1.304e-22
Identity = 49/120 (40.83%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCV-------RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            A+ECV CG      + +DG G++ C  C        +  P + P   LI                 +KR G QC+NC T  TTLWRRN+ G+PVCNACGLY++LH  +RP TM+KE +Q+
Sbjct:  235 ARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLI----------------VSKRAGTQCANCHTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQT 338          
BLAST of GATA456-2 vs. Planmine SMEST
Match: SMESG000022702.1 (SMESG000022702.1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 361/362 (99.72%), Postives = 362/362 (100.00%), Query Frame = 2
Query:  155 DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMAXXXXXXXXXXXXXXXXXNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 1240
            DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSM+ASEYSKSDDFLSSSVNSSNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ
Sbjct:   29 DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMLASEYSKSDDFLSSSVNSSNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 390          
BLAST of GATA456-2 vs. Planmine SMEST
Match: SMESG000022702.1 (SMESG000022702.1)

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 352/362 (97.24%), Postives = 353/362 (97.51%), Query Frame = 2
Query:  155 DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMAXXXXXXXXXXXXXXXXXNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 1240
            DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSM+ASEYSKSD   S      NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ
Sbjct:   29 DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMLASEYSKSDVNSS------NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 384          
BLAST of GATA456-2 vs. Planmine SMEST
Match: SMESG000022702.1 (SMESG000022702.1)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 351/363 (96.69%), Postives = 353/363 (97.25%), Query Frame = 2
Query:  155 DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLIN-NYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMMAXXXXXXXXXXXXXXXXXNRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSXXXXXXXXXXXXXXYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 1240
            DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLIN +YHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSM+ASEYSKSD   S      NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ
Sbjct:   29 DSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPSAQGSNQDYSDPKVPSNLINIDYHLLNSMWPNHMDSISRSQMQYPSMQYPSQCNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSMLASEYSKSDVNSS------NRAKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYMDQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDMVQHPITNISHHGPFDYIPQ 385          
BLAST of GATA456-2 vs. Planmine SMEST
Match: SMESG000039559.1 (SMESG000039559.1)

HSP 1 Score: 107.842 bits (268), Expect = 4.882e-25
Identity = 53/120 (44.17%), Postives = 77/120 (64.17%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARK-------QTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            ++ECV CG  N   + +D +G + C  C R +   + +L+ +P+ + S   +N   K       Q  KR+ L+CSNCK   T+LWRRN+EG+PVCNACGLYY+LHK+ RP +MRKE +Q+
Sbjct:  257 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 376          
BLAST of GATA456-2 vs. Planmine SMEST
Match: SMESG000037031.1 (SMESG000037031.1)

HSP 1 Score: 107.842 bits (268), Expect = 4.882e-25
Identity = 53/120 (44.17%), Postives = 77/120 (64.17%), Query Frame = 2
Query:  647 AKECVICGMENGDTYHQDGNGNFHCLNCVRKNPCVNPSLDLIPSYKKSQMNKNLARK-------QTAKRTGLQCSNCKTENTTLWRRNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQS 985
            ++ECV CG  N   + +D +G + C  C R +   + +L+ +P+ + S   +N   K       Q  KR+ L+CSNCK   T+LWRRN+EG+PVCNACGLYY+LHK+ RP +MRKE +Q+
Sbjct:  257 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 376          
The following BLAST results are available for this feature:
BLAST of GATA456-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GATA43.056e-2240.34GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA43.056e-2240.34GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA45.429e-2241.03GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA45.429e-2241.03GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA47.886e-2240.34GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elt-12.860e-2544.64Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-14.116e-2544.64Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-14.162e-2546.02Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-16.171e-2546.02Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-16.213e-2546.02Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grn1.371e-2242.48gene:FBgn0001138 transcript:FBtr0081808[more]
grn1.739e-2242.48gene:FBgn0001138 transcript:FBtr0330188[more]
grn1.875e-2241.67gene:FBgn0001138 transcript:FBtr0300040[more]
pnr1.714e-2139.34gene:FBgn0003117 transcript:FBtr0083221[more]
pnr1.836e-2139.34gene:FBgn0003117 transcript:FBtr0335427[more]
back to top
BLAST of GATA456-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata1b2.237e-2243.36GATA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata62.528e-2243.36GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
gata1a3.420e-2240.00GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata1a3.420e-2240.00GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata1b3.745e-2241.88GATA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata31.303e-2142.48GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
gata31.432e-2142.48GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
gata52.875e-2140.34GATA binding protein 5 [Source:NCBI gene;Acc:49685... [more]
mcm43.379e-2139.50minichromosome maintenance complex component 4 [So... [more]
gata53.534e-2140.34GATA binding protein 5 [Source:NCBI gene;Acc:49685... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gata52.304e-2242.02GATA binding protein 5 [Source:MGI Symbol;Acc:MGI:... [more]
Gata43.433e-2240.34GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata46.727e-2240.34GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata46.931e-2240.34GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata31.316e-2141.74GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of GATA456-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28515|ELT1_CAEEL5.295e-2446.02Transcription factor elt-1 OS=Caenorhabditis elega... [more]
sp|P91623|GATAC_DROME1.374e-2142.48GATA-binding factor C OS=Drosophila melanogaster O... [more]
sp|P97489|GATA5_MOUSE1.611e-2142.02Transcription factor GATA-5 OS=Mus musculus OX=100... [more]
sp|P43694|GATA4_HUMAN3.902e-2140.34Transcription factor GATA-4 OS=Homo sapiens OX=960... [more]
sp|P46152|GATA4_RAT4.507e-2140.34Transcription factor GATA-4 OS=Rattus norvegicus O... [more]
back to top
BLAST of GATA456-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L6KW390.000e+097.03GATA456-2 OS=Schmidtea mediterranea OX=79327 GN=ga... [more]
F1CDE50.000e+090.27GATA456b OS=Schmidtea polychroa OX=50054 PE=2 SV=1[more]
G0PAQ27.308e-2246.90Uncharacterized protein OS=Caenorhabditis brenneri... [more]
G0NRC38.603e-2246.90CBN-ELT-1 protein OS=Caenorhabditis brenneri OX=13... [more]
A0A061ACV81.078e-2144.64Transcription factor elt-1 OS=Caenorhabditis elega... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata61.245e-2244.25GATA binding protein 6 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000017595.21.293e-2239.34GATA-binding factor 1-B-like [Source:NCBI gene;Acc... [more]
gata31.455e-2141.74GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata31.562e-2141.74GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata1a1.628e-2141.03GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata32.148e-2242.48GATA binding protein 3 [Source:NCBI gene;Acc:30458... [more]
gata2b1.262e-2140.71GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata2b5.257e-2138.33GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata41.664e-1435.04GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-9... [more]
ENSPMAT00000000698.18.579e-1051.92pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 ... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GLN32.620e-1337.23Transcriptional activator of genes regulated by ni... [more]
GAT19.988e-1242.59Transcriptional activator of nitrogen catabolite r... [more]
GZF32.937e-944.68GATA zinc finger protein; negatively regulates nit... [more]
DAL809.543e-944.68Negative regulator of genes in multiple nitrogen d... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
GATA1.318e-2040.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GATA456-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata56.181e-2337.91GATA binding protein 5 [Source:NCBI gene;Acc:10116... [more]
gata56.181e-2337.91GATA binding protein 5 [Source:NCBI gene;Acc:10116... [more]
gata56.181e-2337.91GATA binding protein 5 [Source:NCBI gene;Acc:10116... [more]
gata61.191e-2243.48GATA binding protein 6 [Source:NCBI gene;Acc:10115... [more]
gata-11.304e-2240.83hematopietic transcription factor GATA-1 [Source:N... [more]
back to top
BLAST of GATA456-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022702.10.000e+099.72SMESG000022702.1[more]
SMESG000022702.10.000e+097.24SMESG000022702.1[more]
SMESG000022702.10.000e+096.69SMESG000022702.1[more]
SMESG000039559.14.882e-2544.17SMESG000039559.1[more]
SMESG000037031.14.882e-2544.17SMESG000037031.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002349 ID=SMED30002349|Name=GATA456-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1336bp
CTGAAATCGATTGGCTAATAGTTTCTATGCGAATTATCGTATCGGATAAA
TCGGCCAATCAAATTCAAGCGACAGTGAAGATGAAATAAAGTATTTTATC
AGGACGAATTCAGTAACCTGGCATATTATCAGTATGCACCAGCAACAATC
ACCAGATTCCCAAAATCCTCAACATCCTCAACATTTGCCATATCTAAGAA
GTTATGAGAATTTGGGCTTACGGAATTGCTCTTACGACATGAATATTTGC
AGTGGAGTGAGATATCCTTTTAATTATCCATCAGCACAGGGGTCGAATCA
AGACTATTCTGATCCCAAAGTTCCATCAAATCTCATCAACAATTATCATC
TTTTGAATTCGATGTGGCCGAATCATATGGACTCGATATCTCGGTCACAA
ATGCAGTATCCATCAATGCAGTATCCGTCACAGTGCAATTACAACCCCTT
GCAGCCGTCAGTTCCAGGCCACTATTCGATCCCACCAGAAAACCAAATGT
TCATCGAGCAAGTGAAAACCATGGTCAACGACCAAGCGCATTTACAAAAC
TGTCAGAAAATGAATTTCTCCGACTATTCCATGATGGCGTCCGAATATTC
AAAATCCGATGATTTTCTCTCCTCGTCAGTCAACTCGTCAAACCGAGCAA
AGGAATGCGTAATTTGTGGAATGGAAAACGGAGACACCTATCACCAAGAC
GGCAACGGGAATTTCCATTGCTTGAATTGCGTCAGAAAAAATCCCTGCGT
CAATCCGTCATTGGACTTGATTCCGTCGTATAAAAAGTCTCAAATGAACA
AAAATCTCGCGAGAAAACAAACTGCAAAACGAACAGGACTCCAGTGCTCG
AACTGCAAAACTGAAAATACGACTCTTTGGCGAAGGAACAGTGAAGGCCA
GCCAGTATGCAACGCATGCGGTCTCTATTACCGGCTTCATAAAACGCATC
GGCCTCCGACAATGAGGAAAGAGATACTCCAAAGCAGGAAACGAAAAACG
AAAAAGAAGCAAACCATGTGCATGAAATATATGGATCAAGAATTCCCGAT
CAAATCAGAAACCCAAATCATGTCGTCTCCATTCACAAATGGACATTGCA
TACCGACAACAGACAAATACGATTCCTCATTTCGACATCACTCATTCGAG
TTGACCCAGCCGCCTTCCAATATCAATGATATGGTCCAGCATCCGATCAC
AAATATCAGCCACCATGGACCATTTGACTATATACCCCAATAGGAGGGGT
CTTCATTGTTCGTGTTCACTAACGCCGTTTGATAGATCGTTTTCATGTAG
AGTTTTATTAATATAGAATTGTTTGTTTTAAAAAAA
back to top

protein sequence of SMED30002349-orf-1

>SMED30002349-orf-1 ID=SMED30002349-orf-1|Name=SMED30002349-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=370bp
MHQQQSPDSQNPQHPQHLPYLRSYENLGLRNCSYDMNICSGVRYPFNYPS
AQGSNQDYSDPKVPSNLINNYHLLNSMWPNHMDSISRSQMQYPSMQYPSQ
CNYNPLQPSVPGHYSIPPENQMFIEQVKTMVNDQAHLQNCQKMNFSDYSM
MASEYSKSDDFLSSSVNSSNRAKECVICGMENGDTYHQDGNGNFHCLNCV
RKNPCVNPSLDLIPSYKKSQMNKNLARKQTAKRTGLQCSNCKTENTTLWR
RNSEGQPVCNACGLYYRLHKTHRPPTMRKEILQSRKRKTKKKQTMCMKYM
DQEFPIKSETQIMSSPFTNGHCIPTTDKYDSSFRHHSFELTQPPSNINDM
VQHPITNISHHGPFDYIPQ*
back to top
Aliases
The feature 'GATA456-2' has the following synonyms
Synonym
Spol-gata456b
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002142parenchyma
PLANA:0007522medial-lateral axis of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR039355Transcription_factor_GATA
IPR000679Znf_GATA
IPR013088Znf_NHR/GATA
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000679Zinc finger, GATA-typePRINTSPR00619GATAZNFINGERcoord: 252..269
score: 53.3
coord: 234..251
score: 50.61
IPR000679Zinc finger, GATA-typeSMARTSM00401GATA_3coord: 232..282
e-value: 8.3E-20
score: 81.8
IPR000679Zinc finger, GATA-typePFAMPF00320GATAcoord: 238..271
e-value: 2.6E-14
score: 52.5
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 238..262
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 232..285
score: 26.337
IPR000679Zinc finger, GATA-typeCDDcd00202ZnF_GATAcoord: 237..280
e-value: 4.63856E-17
score: 72.4054
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 226..288
e-value: 3.4E-26
score: 92.5
IPR039355Transcription factor GATAPANTHERPTHR10071TRANSCRIPTION FACTOR GATA FAMILY MEMBERcoord: 4..348
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 229..291