Cell division control protein

Overview
NameCell division control protein
Smed IDSMED30002348
Length (bp)1610
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell division control protein (SMED30002348) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell division control protein (SMED30002348) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell division control protein (SMED30002348) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell division control protein (SMED30002348) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002348

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002348SMESG000070150.1 SmedASXL_007210SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002348SMESG000070150.1 dd_Smed_v6_18778_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30002348SMESG000070150.1 dd_Smed_v4_18778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002348SMESG000070150.1 SMED_29386_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002348SMESG000070150.1 SMED_29386_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002348SMESG000070150.1 SmWIOct06_030436GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell division control protein vs. Ensembl Human
Match: CDC6 (cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC:1744])

HSP 1 Score: 181.03 bits (458), Expect = 1.174e-49
Identity = 120/428 (28.04%), Postives = 232/428 (54.21%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTN--YQKAATEIEIYLKSR--PMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPM--RRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            + ++L  R  E + +  FL  +I      ++Y+SG PGTGKT  ++ ++++L  + K  K   +NCM L     ++  I  ++    ++    +    ++E ++ +   PM    +V VLDE+DQL  +   +L  +F+W  ++ S L+++GIAN+LDL +++LP L   + C+P  +NF PY   +I  IL  ++ +    + L   AV++C++K+SA SGD R ALD+ +RA+E  E      ++S+++ +  S  +    P+  +RV                     + H+++ + EV    D  +  +++   + + PL QK+ +C+ ++L R+    ++K++ + +LY+ Y ++C+ Q++  +D S  + ++G LE+RGI+ ++ +KETR       ++ K IE AL D  L+ +I+   LP
Sbjct:  168 VPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVE----SDVKSQTILKPLSECKSPSEPLIPKRV--------------------GLIHISQVISEV----DGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQ---LKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP 560          
BLAST of Cell division control protein vs. Ensembl Human
Match: CDC6 (cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC:1744])

HSP 1 Score: 181.03 bits (458), Expect = 1.174e-49
Identity = 120/428 (28.04%), Postives = 232/428 (54.21%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTN--YQKAATEIEIYLKSR--PMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPM--RRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            + ++L  R  E + +  FL  +I      ++Y+SG PGTGKT  ++ ++++L  + K  K   +NCM L     ++  I  ++    ++    +    ++E ++ +   PM    +V VLDE+DQL  +   +L  +F+W  ++ S L+++GIAN+LDL +++LP L   + C+P  +NF PY   +I  IL  ++ +    + L   AV++C++K+SA SGD R ALD+ +RA+E  E      ++S+++ +  S  +    P+  +RV                     + H+++ + EV    D  +  +++   + + PL QK+ +C+ ++L R+    ++K++ + +LY+ Y ++C+ Q++  +D S  + ++G LE+RGI+ ++ +KETR       ++ K IE AL D  L+ +I+   LP
Sbjct:  168 VPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVE----SDVKSQTILKPLSECKSPSEPLIPKRV--------------------GLIHISQVISEV----DGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQ---LKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP 560          
BLAST of Cell division control protein vs. Ensembl Human
Match: ORC1 (origin recognition complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:8487])

HSP 1 Score: 85.8853 bits (211), Expect = 7.002e-17
Identity = 62/210 (29.52%), Postives = 101/210 (48.10%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLC------KYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITE----TPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEE 1001
            G PGTGKT  V EV++ L            +Y  +N M L+ P+ +Y +IL +LTG   T    A    + +          ++ V +       + +++ N +F W     +RL+++ IAN++DL E+++ N          M FQPY   ++  IL S++        D  QL+A     +K++A SGDAR  LD+ +RA E  E  +
Sbjct:  534 GVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYN-LFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVA-----RKVAALSGDARRCLDICRRATEICEFSQ 737          
BLAST of Cell division control protein vs. Ensembl Human
Match: ORC1 (origin recognition complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:8487])

HSP 1 Score: 85.8853 bits (211), Expect = 7.002e-17
Identity = 62/210 (29.52%), Postives = 101/210 (48.10%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLC------KYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITE----TPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEE 1001
            G PGTGKT  V EV++ L            +Y  +N M L+ P+ +Y +IL +LTG   T    A    + +          ++ V +       + +++ N +F W     +RL+++ IAN++DL E+++ N          M FQPY   ++  IL S++        D  QL+A     +K++A SGDAR  LD+ +RA E  E  +
Sbjct:  534 GVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYN-LFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVA-----RKVAALSGDARRCLDICRRATEICEFSQ 737          
BLAST of Cell division control protein vs. Ensembl Celegans
Match: cdc-6 (Cell division control protein [Source:UniProtKB/TrEMBL;Acc:P91155])

HSP 1 Score: 102.834 bits (255), Expect = 4.686e-23
Identity = 72/221 (32.58%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  312 LIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKR 974
            L GR  E + L  ++  +   +++ +IY+SG PGTGKT     V+K+L   K  +   +NC   +  + +++ I   L      N        EI+ K        LV VLDEID L +R N  L   F+W +    ++II+GIANS+DL E++LP L L    P  + F+PY + +I  IL  ++          A++  ++K++A SGD R AL ++K+
Sbjct:  172 LKGRREEFDSLKLWIMKSKETNTSLSIYVSGQPGTGKTATTMRVLKSL--GKSVRSCIVNCASTNTKSALFKTIFESLDLDGKPNE-------EIFEKHVKQFKTPLVLVLDEIDHLANRKNAALYAAFQWPETLSRKIIILGIANSIDLTERLLPKLMLAKP-PKRLVFEPYTKDDIVEILNDKMKNEETSIDAKAIELTARKVAAMSGDLRTALHIFKQ 382          
BLAST of Cell division control protein vs. Ensembl Celegans
Match: orc-1 (Origin recognition complex subunit 1 [Source:UniProtKB/TrEMBL;Acc:Q9XX17])

HSP 1 Score: 92.4337 bits (228), Expect = 1.806e-19
Identity = 59/208 (28.37%), Postives = 104/208 (50.00%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLC-KYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSL---------ALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETP--DPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFS 989
            G PGTGKT  V  V+ ++   K C K+ ++    +     ++ EI + +      + +    +I      + +NS+          +V ++DE+D L +R   +L  IF+W  +  S++ I+GIAN+LD  E+ML            + FQPY  ++I  I+ +++  +   DPK   AV+  +KK++  +GD R ALD   RA+  +
Sbjct:  299 GVPGTGKTATVRAVVNSMKKSKKCQKFVYVEVNAMIFKKTVFVEIYNGIQEEYNISKKPQRAKITATAARQELNSIFKREDPKRPPIVVLIDELDSLCNRKQDVLYDIFEWTALPQSKVTIIGIANTLDFPERMLCQRNASRLDKRRLVFQPYQHEQIEEIVRARLQGSNLIDPK---AVELVAKKVAMNTGDLRQALDFLCRAIRVA 503          
BLAST of Cell division control protein vs. Ensembl Celegans
Match: orc-1 (Origin recognition complex subunit 1 [Source:UniProtKB/TrEMBL;Acc:Q9XX17])

HSP 1 Score: 92.4337 bits (228), Expect = 1.806e-19
Identity = 59/208 (28.37%), Postives = 104/208 (50.00%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLC-KYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSL---------ALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETP--DPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFS 989
            G PGTGKT  V  V+ ++   K C K+ ++    +     ++ EI + +      + +    +I      + +NS+          +V ++DE+D L +R   +L  IF+W  +  S++ I+GIAN+LD  E+ML            + FQPY  ++I  I+ +++  +   DPK   AV+  +KK++  +GD R ALD   RA+  +
Sbjct:  299 GVPGTGKTATVRAVVNSMKKSKKCQKFVYVEVNAMIFKKTVFVEIYNGIQEEYNISKKPQRAKITATAARQELNSIFKREDPKRPPIVVLIDELDSLCNRKQDVLYDIFEWTALPQSKVTIIGIANTLDFPERMLCQRNASRLDKRRLVFQPYQHEQIEEIVRARLQGSNLIDPK---AVELVAKKVAMNTGDLRQALDFLCRAIRVA 503          
BLAST of Cell division control protein vs. Ensembl Fly
Match: Cdc6 (gene:FBgn0035918 transcript:FBtr0076647)

HSP 1 Score: 158.303 bits (399), Expect = 2.905e-41
Identity = 130/468 (27.78%), Postives = 234/468 (50.00%), Query Frame = 3
Query:  177 NQIFFKSVESITEKLENISFKTPRKSRAPSIR-IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATE-IEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETP--DPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS---------TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIM 1538
            NQ   KS     E+ +  +  +P +++  + R + N  ET      L GR ++  +L EF ++++ + ++ ++Y+SG PGTGKT  ++ ++++    K  +  +INC  +++   +Y+++ ++L   +    ++   E I+ +LK+       L+ VLDEIDQL      +L  IF+W  +  SR+++VGIANSLDL ++ L  L  +   +P  M+F PY++Q+I  I  S++ E    D    + ++  + K+SA SGD R ALD+ +R VE +E ++    +  ++                        A+++  K  V +   K     L  VQ  Q     ++N+  G S         + PL QKL LC  +++ R   + R K I + +L+++Y  +C  + I  +D + F      +E+RGI+RI   KE R     +  D + +  AL D  L+ SI+
Sbjct:  225 NQTKEKSNIQTNEETQQNNLPSPSRNKYQNARRVLNSAET----QNLPGRESQLQELREFFSNHLESQTSGSLYVSGQPGTGKTACLSLLLRDPDFSKRLQRVYINCTSIASVGAVYKKLCTELQLKVSGRTERDHLEAIQRHLKT---AKRMLLLVLDEIDQLCTSRQEVLYTIFEWPALPGSRILLVGIANSLDLTDRALMRLNARCELKPRLMHFPPYSKQQIVEIFKSRLAEAEVLDVFPPVTLQLLAAKVSAISGDVRRALDIGRRVVEIAEQQKRDGEKEFNMK-----------------------ALQLEGKDAVEA---KEKQDTLKPVQVTQ--VAAVLNKVYGASQNLEEDIEASFPLQQKLMLCTLVLMLR---NERNKDISMGRLHEVYRRVCAKRNILALDQAEFTGTVDLVETRGILRIMRKKEPRLHKVLLQWDEEEVHAALSDKQLIASIL 654          
BLAST of Cell division control protein vs. Ensembl Fly
Match: Orc1 (gene:FBgn0286788 transcript:FBtr0088959)

HSP 1 Score: 104.76 bits (260), Expect = 3.518e-23
Identity = 64/212 (30.19%), Postives = 116/212 (54.72%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLCK--------YHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSI 1013
            G PGTGKT  VT V++ L  Q++ K        Y  IN M L+ P   Y +I  QLTG  ++ +++A   +E    +     +  V ++DE+D L +R   ++  +  W   + ++L++V IAN++DL E++L            + FQPY+ +++  I+ +++  +   K   AV+  ++K++A SGDAR ALD+ +RA E ++   ++ +
Sbjct:  598 GVPGTGKTATVTGVIRTL--QRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQLTGKTVS-WEQAHALLEKRFTTPAPRRVTTVLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTMDLPERLLMGKVTSRLGLTRLTFQPYSHKQLQEIVTARLGGSETFKGE-AVQLVARKVAAVSGDARRALDICRRATEIADTAAVKCV 805          
BLAST of Cell division control protein vs. Ensembl Zebrafish
Match: cdc6 (cell division cycle 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050506-131])

HSP 1 Score: 184.111 bits (466), Expect = 6.636e-51
Identity = 139/434 (32.03%), Postives = 230/434 (53.00%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVM---KNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQS-CRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS-TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +K    TA +  +L+ R AER  +  FL +++     S++YISG PGTGKT  +  V+   K L+  K  +   INCM+L + + I+  +  QL          +   +E YL S   +   ++ VLDE+DQL  ++  +L  IF+W  +  SR+ ++GIAN+LDL +++LP L  +  CRP  +NF PY+ +E+NAI+  ++T+      L   AV++C++K+SA SGDAR ALD+ +RAVE  E  +   + SE                              +  S VS  S+  V R L EV      Y + +  +SG   + PL QKL +C  L++ R  +S   K+ ++ +L ++Y ++CK +++ G+  +  + +   LESRGI+ ++  K+ R    ++ ++ + +E AL D  LL SI+   LP
Sbjct:  176 VKQALHTA-VPERLLSREAERAAIVSFLQNHVVAEKPSSLYISGAPGTGKTACLNCVLQEQKALL--KGIQTVVINCMNLRSSHAIFPLLGEQLE----VPKGNSQARLEKYLTS---SGPTVLLVLDEMDQLDSKSQEVLYTIFEWPYLPKSRVCLIGIANALDLTDRILPRLQAKPHCRPKLLNFPPYSHEELNAIVQDRLTQVSGEGVLDAAAVQFCARKVSAVSGDARKALDICRRAVEIVEAGDRSKMASEP-----------------------------TASSKVSRVSVPQVARVLSEV------YGDRMASSSGDGESFPLQQKLLVCCLLLIIRNGKS---KETQLGKLCEVYSKLCKQRQVGGVGQTECLSLCSLLESRGILTLKKAKDARLTKISLKIEERDVEHALKDRTLLGSILAAGLP 561          
BLAST of Cell division control protein vs. Ensembl Zebrafish
Match: cdc6 (cell division cycle 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050506-131])

HSP 1 Score: 184.111 bits (466), Expect = 6.636e-51
Identity = 139/434 (32.03%), Postives = 230/434 (53.00%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVM---KNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQS-CRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS-TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +K    TA +  +L+ R AER  +  FL +++     S++YISG PGTGKT  +  V+   K L+  K  +   INCM+L + + I+  +  QL          +   +E YL S   +   ++ VLDE+DQL  ++  +L  IF+W  +  SR+ ++GIAN+LDL +++LP L  +  CRP  +NF PY+ +E+NAI+  ++T+      L   AV++C++K+SA SGDAR ALD+ +RAVE  E  +   + SE                              +  S VS  S+  V R L EV      Y + +  +SG   + PL QKL +C  L++ R  +S   K+ ++ +L ++Y ++CK +++ G+  +  + +   LESRGI+ ++  K+ R    ++ ++ + +E AL D  LL SI+   LP
Sbjct:  176 VKQALHTA-VPERLLSREAERAAIVSFLQNHVVAEKPSSLYISGAPGTGKTACLNCVLQEQKALL--KGIQTVVINCMNLRSSHAIFPLLGEQLE----VPKGNSQARLEKYLTS---SGPTVLLVLDEMDQLDSKSQEVLYTIFEWPYLPKSRVCLIGIANALDLTDRILPRLQAKPHCRPKLLNFPPYSHEELNAIVQDRLTQVSGEGVLDAAAVQFCARKVSAVSGDARKALDICRRAVEIVEAGDRSKMASEP-----------------------------TASSKVSRVSVPQVARVLSEV------YGDRMASSSGDGESFPLQQKLLVCCLLLIIRNGKS---KETQLGKLCEVYSKLCKQRQVGGVGQTECLSLCSLLESRGILTLKKAKDARLTKISLKIEERDVEHALKDRTLLGSILAAGLP 561          
BLAST of Cell division control protein vs. Ensembl Zebrafish
Match: cdc6 (cell division cycle 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050506-131])

HSP 1 Score: 184.111 bits (466), Expect = 6.636e-51
Identity = 139/434 (32.03%), Postives = 230/434 (53.00%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVM---KNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQS-CRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS-TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +K    TA +  +L+ R AER  +  FL +++     S++YISG PGTGKT  +  V+   K L+  K  +   INCM+L + + I+  +  QL          +   +E YL S   +   ++ VLDE+DQL  ++  +L  IF+W  +  SR+ ++GIAN+LDL +++LP L  +  CRP  +NF PY+ +E+NAI+  ++T+      L   AV++C++K+SA SGDAR ALD+ +RAVE  E  +   + SE                              +  S VS  S+  V R L EV      Y + +  +SG   + PL QKL +C  L++ R  +S   K+ ++ +L ++Y ++CK +++ G+  +  + +   LESRGI+ ++  K+ R    ++ ++ + +E AL D  LL SI+   LP
Sbjct:  176 VKQALHTA-VPERLLSREAERAAIVSFLQNHVVAEKPSSLYISGAPGTGKTACLNCVLQEQKALL--KGIQTVVINCMNLRSSHAIFPLLGEQLE----VPKGNSQARLEKYLTS---SGPTVLLVLDEMDQLDSKSQEVLYTIFEWPYLPKSRVCLIGIANALDLTDRILPRLQAKPHCRPKLLNFPPYSHEELNAIVQDRLTQVSGEGVLDAAAVQFCARKVSAVSGDARKALDICRRAVEIVEAGDRSKMASEP-----------------------------TASSKVSRVSVPQVARVLSEV------YGDRMASSSGDGESFPLQQKLLVCCLLLIIRNGKS---KETQLGKLCEVYSKLCKQRQVGGVGQTECLSLCSLLESRGILTLKKAKDARLTKISLKIEERDVEHALKDRTLLGSILAAGLP 561          
BLAST of Cell division control protein vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 89.7373 bits (221), Expect = 2.884e-18
Identity = 61/203 (30.05%), Postives = 109/203 (53.69%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSE 992
            G PGTGKT  V EV+++L       ++  ++FI  N M +++P+  Y +IL +LT    T+   AA   + +    P     ++ V +       + N++ N +F W     +RL+++ IAN++DL E+++ N          M+FQPY  +++  I+ S++      ++  A++  S+K++A SGDAR  LD+ +RA E  E
Sbjct:  546 GVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRFSAPAPKKETTVLLVDELDLLWTRKQNVMYN-LFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKAFEE-DALQLVSRKVAALSGDARRCLDICRRATEICE 746          
BLAST of Cell division control protein vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 89.7373 bits (221), Expect = 2.935e-18
Identity = 61/203 (30.05%), Postives = 109/203 (53.69%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSE 992
            G PGTGKT  V EV+++L       ++  ++FI  N M +++P+  Y +IL +LT    T+   AA   + +    P     ++ V +       + N++ N +F W     +RL+++ IAN++DL E+++ N          M+FQPY  +++  I+ S++      ++  A++  S+K++A SGDAR  LD+ +RA E  E
Sbjct:  546 GVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRFSAPAPKKETTVLLVDELDLLWTRKQNVMYN-LFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKAFEE-DALQLVSRKVAALSGDARRCLDICRRATEICE 746          
BLAST of Cell division control protein vs. Ensembl Xenopus
Match: phf3 (PHD finger protein 3 [Source:Xenbase;Acc:XB-GENE-988185])

HSP 1 Score: 188.348 bits (477), Expect = 2.312e-52
Identity = 136/420 (32.38%), Postives = 238/420 (56.67%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVF-VLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS-TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMD 1541
            I  +L+ R +E   +  FLTS++S     ++YISG PGTGKT  + ++++      K CK  +INCM L +   ++  I  +++G        AA +I   L+    +   ++  VLDE+DQL  R   +L  +F+W  +  SR++++GIAN+LDL +++LP L  +  C+P  +NF PY + +I  IL  ++ +    + L   A+++C++KISA SGDAR ALD+ +RAVE  E +    +R ++V  L    E + SP + V S P        +   VS P   H++R L +V      Y + +  + G S + PL QKL +CA L+LTR+   S++K++ + +L++ Y ++C+ Q++ G+  S  + +   LE+RGI+ ++  KE R    ++ ++ + IE A  D +L+ ++++
Sbjct:  165 IPERLLARDSETATIKAFLTSHVSGGKPGSLYISGAPGTGKTACLNKLLQESKDDLKQCKTVYINCMSLRSSQAVFPAIAEEISGG---KSSIAAKDIVRSLEKMVTSKGPIILLVLDEMDQLDSRGQDVLYTVFEWPWLPNSRVVLIGIANALDLTDRILPRLQARPQCKPQLLNFSPYTKDQIATILQERLNQVSGDQVLDNAAIQFCARKISAVSGDARKALDICRRAVEIVEAD----VRGQTV--LKPLTE-SLSPSKEVPSNP--------VPKKVSLP---HISRVLSDV------YGDKMASSGGSSESFPLQQKLLVCALLLLTRQ---SKIKEVTLGKLHEAYSKVCRKQQVPGVGQSECLSLCQLLETRGILGLKKAKEARLTKVSLKIEERDIEHAFKDKVLIGNVLN 554          
BLAST of Cell division control protein vs. Ensembl Xenopus
Match: phf3 (PHD finger protein 3 [Source:Xenbase;Acc:XB-GENE-988185])

HSP 1 Score: 187.963 bits (476), Expect = 3.565e-52
Identity = 136/420 (32.38%), Postives = 238/420 (56.67%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVF-VLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS-TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMD 1541
            I  +L+ R +E   +  FLTS++S     ++YISG PGTGKT  + ++++      K CK  +INCM L +   ++  I  +++G        AA +I   L+    +   ++  VLDE+DQL  R   +L  +F+W  +  SR++++GIAN+LDL +++LP L  +  C+P  +NF PY + +I  IL  ++ +    + L   A+++C++KISA SGDAR ALD+ +RAVE  E +    +R ++V  L    E + SP + V S P        +   VS P   H++R L +V      Y + +  + G S + PL QKL +CA L+LTR+   S++K++ + +L++ Y ++C+ Q++ G+  S  + +   LE+RGI+ ++  KE R    ++ ++ + IE A  D +L+ ++++
Sbjct:  179 IPERLLARDSETATIKAFLTSHVSGGKPGSLYISGAPGTGKTACLNKLLQESKDDLKQCKTVYINCMSLRSSQAVFPAIAEEISGG---KSSIAAKDIVRSLEKMVTSKGPIILLVLDEMDQLDSRGQDVLYTVFEWPWLPNSRVVLIGIANALDLTDRILPRLQARPQCKPQLLNFSPYTKDQIATILQERLNQVSGDQVLDNAAIQFCARKISAVSGDARKALDICRRAVEIVEAD----VRGQTV--LKPLTE-SLSPSKEVPSNP--------VPKKVSLP---HISRVLSDV------YGDKMASSGGSSESFPLQQKLLVCALLLLTRQ---SKIKEVTLGKLHEAYSKVCRKQQVPGVGQSECLSLCQLLETRGILGLKKAKEARLTKVSLKIEERDIEHAFKDKVLIGNVLN 568          
BLAST of Cell division control protein vs. Ensembl Xenopus
Match: phf3 (PHD finger protein 3 [Source:Xenbase;Acc:XB-GENE-988185])

HSP 1 Score: 188.348 bits (477), Expect = 4.965e-52
Identity = 136/420 (32.38%), Postives = 238/420 (56.67%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVF-VLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS-TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMD 1541
            I  +L+ R +E   +  FLTS++S     ++YISG PGTGKT  + ++++      K CK  +INCM L +   ++  I  +++G        AA +I   L+    +   ++  VLDE+DQL  R   +L  +F+W  +  SR++++GIAN+LDL +++LP L  +  C+P  +NF PY + +I  IL  ++ +    + L   A+++C++KISA SGDAR ALD+ +RAVE  E +    +R ++V  L    E + SP + V S P        +   VS P   H++R L +V      Y + +  + G S + PL QKL +CA L+LTR+   S++K++ + +L++ Y ++C+ Q++ G+  S  + +   LE+RGI+ ++  KE R    ++ ++ + IE A  D +L+ ++++
Sbjct:  203 IPERLLARDSETATIKAFLTSHVSGGKPGSLYISGAPGTGKTACLNKLLQESKDDLKQCKTVYINCMSLRSSQAVFPAIAEEISGG---KSSIAAKDIVRSLEKMVTSKGPIILLVLDEMDQLDSRGQDVLYTVFEWPWLPNSRVVLIGIANALDLTDRILPRLQARPQCKPQLLNFSPYTKDQIATILQERLNQVSGDQVLDNAAIQFCARKISAVSGDARKALDICRRAVEIVEAD----VRGQTV--LKPLTE-SLSPSKEVPSNP--------VPKKVSLP---HISRVLSDV------YGDKMASSGGSSESFPLQQKLLVCALLLLTRQ---SKIKEVTLGKLHEAYSKVCRKQQVPGVGQSECLSLCQLLETRGILGLKKAKEARLTKVSLKIEERDIEHAFKDKVLIGNVLN 592          
BLAST of Cell division control protein vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 90.1225 bits (222), Expect = 1.924e-18
Identity = 88/308 (28.57%), Postives = 147/308 (47.73%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITE----TPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMS--MKSTVSSPSIKHVNRALYEVQKGQDPYKN--IINETSGKSTLPLHQKLALCAGLILTR 1283
            G PGTGKT  V EV+++L      ++L  + +I  N M L++P+  Y +IL  LTG   T    AA  +E    +        V ++DE+D L  R   ++  +F W     ++LI++ IAN++DL E+++ N          M+FQPY  +++  I+ S++        D  QL+A     +K++A SGDAR  LD+ +RA E  E      +   S+ ++   +E  E     + S+P   AI+ S  M+ T     I    R+  E    Q  Y+   ++    G     + + +A+C  L  +R
Sbjct:  302 GVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATA-DHAAALLEKRFSTPASKKETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKAFGDDAIQLVA-----RKVAALSGDARRCLDICRRATEICEFS--CKMGDSSLVKMSHVMEALE----EMFSSPYVTAIRNSSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASR 597          
BLAST of Cell division control protein vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 90.1225 bits (222), Expect = 1.981e-18
Identity = 88/308 (28.57%), Postives = 147/308 (47.73%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITE----TPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMS--MKSTVSSPSIKHVNRALYEVQKGQDPYKN--IINETSGKSTLPLHQKLALCAGLILTR 1283
            G PGTGKT  V EV+++L      ++L  + +I  N M L++P+  Y +IL  LTG   T    AA  +E    +        V ++DE+D L  R   ++  +F W     ++LI++ IAN++DL E+++ N          M+FQPY  +++  I+ S++        D  QL+A     +K++A SGDAR  LD+ +RA E  E      +   S+ ++   +E  E     + S+P   AI+ S  M+ T     I    R+  E    Q  Y+   ++    G     + + +A+C  L  +R
Sbjct:  294 GVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATA-DHAAALLEKRFSTPASKKETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKAFGDDAIQLVA-----RKVAALSGDARRCLDICRRATEICEFS--CKMGDSSLVKMSHVMEALEE----MFSSPYVTAIRNSSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASR 589          
BLAST of Cell division control protein vs. Ensembl Mouse
Match: Cdc6 (cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1345150])

HSP 1 Score: 192.586 bits (488), Expect = 4.793e-54
Identity = 132/434 (30.41%), Postives = 236/434 (54.38%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIY--------REILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVEC---TESPM-RRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            + ++L  R  E   +  FL  +I      ++Y+SG PGTGKT  ++ ++++   + K  K   +NCM L +   ++        RE L +  G  L        E  +  +  PM    +V VLDE+DQL  +   +L  +F+W  ++ SRL+++GIAN+LDL +++LP L   ++C+P  +NF PY   +I AIL  ++++    + L   A+++C++K+SA SGD R ALD+ +RA+E  E      +RS++V  L    EC   +ESP+ +RV                     + H+++ + EV    D  +  +++ + + +LPL QK+ +C+ L+LTRR    ++K++ + +LY+ Y  IC+ Q++  +D S  + ++G LESRG+V ++ +KE+R    ++ ++ K IE  L+      +I+   LP
Sbjct:  170 VPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKKEVKGFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMR----KLEKHLTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVE----SDVRSQTV--LKPLSECKSPSESPVPKRV--------------------GLAHISQVISEV----DGNRVTLSQENTQDSLPLQQKILVCSLLLLTRRL---KIKEVTLGKLYEAYSSICRKQQVTAVDQSECLSLSGLLESRGLVGLKKNKESRLTKVSLKIEEKEIEHVLNGKAFTGNILAAGLP 562          
BLAST of Cell division control protein vs. Ensembl Mouse
Match: Cdc6 (cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1345150])

HSP 1 Score: 192.586 bits (488), Expect = 7.634e-54
Identity = 132/434 (30.41%), Postives = 236/434 (54.38%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIY--------REILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVEC---TESPM-RRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            + ++L  R  E   +  FL  +I      ++Y+SG PGTGKT  ++ ++++   + K  K   +NCM L +   ++        RE L +  G  L        E  +  +  PM    +V VLDE+DQL  +   +L  +F+W  ++ SRL+++GIAN+LDL +++LP L   ++C+P  +NF PY   +I AIL  ++++    + L   A+++C++K+SA SGD R ALD+ +RA+E  E      +RS++V  L    EC   +ESP+ +RV                     + H+++ + EV    D  +  +++ + + +LPL QK+ +C+ L+LTRR    ++K++ + +LY+ Y  IC+ Q++  +D S  + ++G LESRG+V ++ +KE+R    ++ ++ K IE  L+      +I+   LP
Sbjct:  197 VPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKKEVKGFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMR----KLEKHLTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVE----SDVRSQTV--LKPLSECKSPSESPVPKRV--------------------GLAHISQVISEV----DGNRVTLSQENTQDSLPLQQKILVCSLLLLTRRL---KIKEVTLGKLYEAYSSICRKQQVTAVDQSECLSLSGLLESRGLVGLKKNKESRLTKVSLKIEEKEIEHVLNGKAFTGNILAAGLP 589          
BLAST of Cell division control protein vs. Ensembl Mouse
Match: Cdc6 (cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1345150])

HSP 1 Score: 130.183 bits (326), Expect = 1.396e-32
Identity = 83/254 (32.68%), Postives = 141/254 (55.51%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIY--------REILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESV 1028
            + ++L  R  E   +  FL  +I      ++Y+SG PGTGKT  ++ ++++    K  K   +NCM L +   ++        RE L +  G  L        E  +  +  PM    +V VLDE+DQL  +   +L  +F+W  ++ SRL+++GIAN+LDL +++LP L   ++C+P  +NF PY   +I AIL  ++++    + L   A+++C++K+SA SGD R ALD+ +RA+E  E      +RS++V
Sbjct:  170 VPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKEVKGFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMR----KLEKHLTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVE----SDVRSQTV 411          
BLAST of Cell division control protein vs. Ensembl Mouse
Match: Orc1 (origin recognition complex, subunit 1 [Source:MGI Symbol;Acc:MGI:1328337])

HSP 1 Score: 88.5817 bits (218), Expect = 6.634e-18
Identity = 64/213 (30.05%), Postives = 105/213 (49.30%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLC------KYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITE----TPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQS 1010
            G PGTGKT  V EV++ L            +Y  +N M L+ P+ +Y +IL +LTG   T    A    + +          ++ V +       + +++ N +F W     + LI++ IAN++DL E+++ N          M+FQPY+  ++  IL+S++        D  QL+A     +K++A SGDAR  LD+ +RA E  EL  L+ 
Sbjct:  513 GVPGTGKTATVHEVIRCLQQAAETDDVPPFQYVEVNGMKLTEPHQVYVQILKKLTGQKATANHAAELLAKQFCGQGSQKETTVLLVDELDLLWTHKQDVMYN-LFDWPTHKGAHLIVLTIANTMDLPERIMMNRVSSRLGLTRMSFQPYSHSQLKQILVSRLRNLRAFEDDAIQLVA-----RKVAALSGDARRCLDICRRATEICELSHLRG 719          
BLAST of Cell division control protein vs. UniProt/SwissProt
Match: sp|O89033|CDC6_MOUSE (Cell division control protein 6 homolog OS=Mus musculus OX=10090 GN=Cdc6 PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 3.353e-53
Identity = 132/434 (30.41%), Postives = 236/434 (54.38%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIY--------REILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVEC---TESPM-RRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            + ++L  R  E   +  FL  +I      ++Y+SG PGTGKT  ++ ++++   + K  K   +NCM L +   ++        RE L +  G  L        E  +  +  PM    +V VLDE+DQL  +   +L  +F+W  ++ SRL+++GIAN+LDL +++LP L   ++C+P  +NF PY   +I AIL  ++++    + L   A+++C++K+SA SGD R ALD+ +RA+E  E      +RS++V  L    EC   +ESP+ +RV                     + H+++ + EV    D  +  +++ + + +LPL QK+ +C+ L+LTRR    ++K++ + +LY+ Y  IC+ Q++  +D S  + ++G LESRG+V ++ +KE+R    ++ ++ K IE  L+      +I+   LP
Sbjct:  170 VPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKKEVKGFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMR----KLEKHLTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVE----SDVRSQTV--LKPLSECKSPSESPVPKRV--------------------GLAHISQVISEV----DGNRVTLSQENTQDSLPLQQKILVCSLLLLTRRL---KIKEVTLGKLYEAYSSICRKQQVTAVDQSECLSLSGLLESRGLVGLKKNKESRLTKVSLKIEEKEIEHVLNGKAFTGNILAAGLP 562          
BLAST of Cell division control protein vs. UniProt/SwissProt
Match: sp|Q99741|CDC6_HUMAN (Cell division control protein 6 homolog OS=Homo sapiens OX=9606 GN=CDC6 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.637e-49
Identity = 120/428 (28.04%), Postives = 232/428 (54.21%), Query Frame = 3
Query:  300 ISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTN--YQKAATEIEIYLKSR--PMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPM--RRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            + ++L  R  E + +  FL  +I      ++Y+SG PGTGKT  ++ ++++L  + K  K   +NCM L     ++  I  ++    ++    +    ++E ++ +   PM    +V VLDE+DQL  +   +L  +F+W  ++ S L+++GIAN+LDL +++LP L   + C+P  +NF PY   +I  IL  ++ +    + L   AV++C++K+SA SGD R ALD+ +RA+E  E      ++S+++ +  S  +    P+  +RV                     + H+++ + EV    D  +  +++   + + PL QK+ +C+ ++L R+    ++K++ + +LY+ Y ++C+ Q++  +D S  + ++G LE+RGI+ ++ +KETR       ++ K IE AL D  L+ +I+   LP
Sbjct:  168 VPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPM----IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVE----SDVKSQTILKPLSECKSPSEPLIPKRV--------------------GLIHISQVISEV----DGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQ---LKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP 560          
BLAST of Cell division control protein vs. UniProt/SwissProt
Match: sp|P41411|CDC18_SCHPO (Cell division control protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc18 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.273e-29
Identity = 115/463 (24.84%), Postives = 201/463 (43.41%), Query Frame = 3
Query:  303 SNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ----KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSL-----ALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAIL-------------------LSQITETPDPK--------------QLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSP--SIKHVNRALYEV-QKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEIC-KSQEIEGIDMSNFIDITGHLESRGIVRI---QPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDK 1544
            S  ++GR  E++ +  F   ++  ++   +Y+SG PGTGKT ++  V+ ++V       +C   +INCM ++ P  I+ +I S++    +   +      +  L+S    S       ++ VLDE+D LI R   +L  +F+W     SRLI+VGIAN+LD+ ++ LP L  +   P  ++F PY  QEI+ I+                   +  I+E  D                   A++ C++K++A SGD R ALD+ + A+E +E E                                + A   +  S+V  P  SI HV RA   + Q      KN          L L QK  LC  ++  +         + ++ +++ Y  +C + + I  +  S F D+   LE+  I+R+   Q + + + RI ++ +    +  A+ D   L    D+
Sbjct:  166 SAGVVGRENEKSIVESFFRQHLDANAGGALYVSGAPGTGKTVLLHNVLDHVVSDYPKVNVC---YINCMTINEPKAIFEKIHSKIVKEEILENEDHHINFQCELESHFTQSANELYNPVIIVLDEMDHLIAREQQVLYTLFEWPSRPTSRLILVGIANALDMTDRFLPRLRTKHITPKLLSFTPYTAQEISTIIKARLKTAATTSEKNNPFTPIKSISEVSDDSINVVSQHADETPFIHPAAIELCARKVAASSGDLRKALDICRHAIELAERE--------------------------------WKAQHDNTLSSVDIPRASIAHVVRATSAMSQSASARLKN----------LGLQQKAILCTLVVCEK-------TSLSVADVFEKYSSLCLRDRLIYPLTSSEFCDVANSLETLAIIRLRTKQRNGKPQDRIISLLVPEMDVITAVGDIGTLKRFFDR 576          
BLAST of Cell division control protein vs. UniProt/SwissProt
Match: sp|Q8W032|CDC6B_ARATH (Cell division control protein 6 homolog B OS=Arabidopsis thaliana OX=3702 GN=CDC6B PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.499e-27
Identity = 107/429 (24.94%), Postives = 197/429 (45.92%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKL------CKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYL---KSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAIL------LSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDD 1514
            +K     +K  + ++ R  E+ ++ EF+   I      ++YI G PGTGK+  + +V++ +                +NC  LS    I+ +IL ++      N   +  +    L   K    +S  ++ + DE+D LI ++  +L  +F    +  SR I++G+AN++DL ++ LP L   +C+P  + F+ Y++ +I  IL      LS +   P      A++ C++K++A SGD R AL + + A+E  E+E   S   ES           + P      TP    ++M            H+  AL +       +K+ + ET    +LP HQ++ +CA     R  +    K   + +L  +YLEICKS  I    ++ F ++   L  +GI+++   +  + +  ++ +D   I  AL +
Sbjct:  113 VKEALHVSKAPSTILCREDEQIRIFEFVKGCIDQQKAGSLYICGCPGTGKSLSMEKVVQQVGDWSTQAGLPPVDTLSVNCTSLSKTTDIFSKILGEIKPGKNANTNSSPLQHLQNLFSQKQESSSSRMMLIIADEMDYLITKDRGVLYDLFMLTTLPFSRCILIGVANAIDLADRFLPKLKSLNCKPMVITFRAYSKDQILRILQERLRVLSYVAFQPK-----ALELCARKVAAASGDMRKALCVCRSALEILEIETRGSTGPES-----------QGP------TPDDSVVRMD-----------HMAAALSKT------FKSPVVETI--QSLPQHQQIIICAAAKAFRGSK----KDATVGELNKLYLEICKSWMISPAGITEFTNMCTVLNDQGILKVGQARRDKLKRVSLRVDESDITFALQE 496          
BLAST of Cell division control protein vs. UniProt/SwissProt
Match: sp|Q5N897|CDC6_ORYSJ (Cell division control protein 6 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=CDC6 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.802e-27
Identity = 104/414 (25.12%), Postives = 191/414 (46.14%), Query Frame = 3
Query:  303 SNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ------KLCKYHFINCMDLSNPNLIYREILSQL-----TGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETP-DPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKAL 1508
            S  L+ R  E++++ EF    +    + ++Y+ G PGTGKT  + +V +++         +      INC  L+  + I+ +IL++          L+  Q+  T    + +S P     L+ V+DE+D LI R+  +L+ +F       SR I++GIAN++DL ++ LP L   +C+P  + F+ Y++ +I+ I+  ++     D  + +A+++C++K++A SGD R AL + + AVE  E   LQ    ES D+    V               F  + +++     SP +  +                          LP HQ++ LCA   L       + K   + +L   Y+EIC+S ++  + M  F ++   L  +G +++   KE + R   + +D   I  A 
Sbjct:  136 SCGLVCRDDEQSRVLEFCKGCVEQERSGSLYVCGCPGTGKTLSINKVKESVARWADETGMETPDALSINCTSLAKTHEIFSKILAKFQTRKKATCKLSPLQQLQTMFS-HKESAPRR--MLLVVVDEMDYLITRDRAVLHDLFMLTTYQFSRCILIGIANAIDLADRFLPKLESLNCKPLVVTFRAYSKDQISDIIKHRLKVLEYDVFEPLALEFCARKVAAASGDMRKALGVCRSAVEVFE-ARLQ----ESSDQEFGLV--------------TFDHMDIALSKAFKSPVVDSI------------------------LCLPQHQQMVLCA---LANTFHHCKKKATTLGELNKSYIEICRSTQVPAVGMLEFSNMCMVLSDQGFMKLGQSKEDKLRRVMLQIDSSDITFAF 500          
BLAST of Cell division control protein vs. TrEMBL
Match: A0A2C9JQ11 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106063250 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 6.685e-60
Identity = 143/436 (32.80%), Postives = 244/436 (55.96%), Query Frame = 3
Query:  258 APSIRIKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQS-CRPHCMNFQPYNEQEINAILLSQITETP--DPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSG-KSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +P    K    TAK  + L+GR  E +++ +F+T  I    + ++YISG PGTGKT VV+ ++  +      +  FINCM L + N +++++L QL GT     ++A   +E Y +S       ++ VLDEIDQL  +++ +L +IF+W  +   ++I++GIAN+LDL +++LP L   S C+P  +NF PY   +I  I+ +++ +    +P    A+ +C++KISA +GDAR ALD+  RA+E  E      +R + V +     +C  SP +R   TP        MK      ++ H+++ + EV      Y + +N   G +  LPL QKLA+C+ L+L +   S + K++ + +L++ Y  +CK Q++  +D S F  +   L+SRGI+ ++  KETR    ++ LD   +E+ L D  L+ +I+   +P
Sbjct:    1 SPYQSAKRSLHTAK-PDFLVGREKEESEIEKFITDRIKEKKSGSMYISGAPGTGKTAVVSHILDRIKFHHTNQIAFINCMMLKDSNTVFKQLLEQL-GTSPVKTKEAMKALEKYFRSV---EDPVLLVLDEIDQLDSKHHHVLYQIFEWPALQDFKVILIGIANALDLTDRILPRLQASSSCQPALINFPPYTTSQITDIIKNRLQQDSVLEPA---AISFCARKISAVAGDARKALDVCHRAIELVE----SDVRGQQVLK---PADCN-SPTKR-HQTP--------MKKV----TVMHISKIMSEV------YSSSVNSADGSEHALPLQQKLAICSLLLLVK---SGKFKEVLLGKLHETYSNVCKRQQMVPVDQSEFHSVLTLLDSRGIIIMKKAKETRLNKISLKLDEHELEQTLKDKTLMAAILSDKIP 398          
BLAST of Cell division control protein vs. TrEMBL
Match: R7TAL5 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_148720 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 6.925e-60
Identity = 141/434 (32.49%), Postives = 240/434 (55.30%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLT-GTLLTNYQKAATE-IEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQLI----AVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGK-STLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFL 1550
            +K    TA + ++L+ R AE   + +FL  ++ + +  ++YISG PGTGKT VV+ + + L  ++ C+  ++NCM + NP  I+ +I S+   G  L+   KAA + +E  L S+      +V +LDEIDQL  RN  IL  +F+W  +  SRL+++GIAN+LDL +++LP L  +  CRP  +NF PY + ++  +L  ++         +    AV++C+ K++A +GD R ALD+ +RAVE  E E    +R + V           SP +R  + P+ + +              H+ R +  V      Y + ++   G+  T+PL QKLA+C  L++ R+    + K+  + + ++ Y  +CK Q+++ +D S F  +  H+E+RGI+RI+  K+ R     + LD K +E AL D  LL++++DK L
Sbjct:   28 VKKALHTA-LPDRLLCREAEMKTVNDFLDVHLGDEAPGSLYISGAPGTGKTAVVSLIRQRLQEERTCQSVYVNCMSVQNPQAIFNKIYSEFNHGKELSLSVKAAVQKLEKVLSSK---GSMVVLILDEIDQLDCRNQEILYTMFEWPTLANSRLVLIGIANALDLTDRILPRLQARPKCRPQLLNFTPYTKDQLIKVLKDRLQSLELNGHSVIEPSAVQFCAMKVAAVAGDMRKALDVCRRAVEAVETE----VRKQQV-------LSPGSPSKRP-TVPKKIGVA-------------HILRIVNTV------YGSKVSSQPGQVETIPLQQKLAMCTLLMVVRQ---GKGKETTLGKFHEFYSSVCKGQKLQPVDQSEFFTVCSHMETRGIIRIKKSKDARNAKVNLGLDEKELEIALQDKTLLSAVLDKGL 423          
BLAST of Cell division control protein vs. TrEMBL
Match: A0A210QKE8 (Cell division control protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24464 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.245e-58
Identity = 143/425 (33.65%), Postives = 240/425 (56.47%), Query Frame = 3
Query:  291 TAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQLI----AVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFL 1550
            TAK   +L+GR  E  +++ F+  ++S  +  +IYISG PGTGKT V+T ++ N+     CK  ++NCM L +   +Y ++ + LTG    + +     +E +L S      +++ VLDEIDQL  +N  IL  IF+W  MT SRLI++GIAN+LDL +++LP L  +  C+P  +NF PY++ +I AIL  +I +       +    A+++C++KISA +GD R ALD+ +RAVE  E E    +RS+ V +  +T+    SP +R  + P+ + + M + S +S          +Y               +S + ++P+ QKL +C  L++ ++    RMK++ + +L D Y ++CK +++   D   F  +   LE+RGI+ I+  KE R    ++ L+ K +E AL D +L++SI+   L
Sbjct:  206 TAK-PERLVGRDTETEEISAFVKGHMSKKTAGSIYISGAPGTGKTAVLTHILDNVQASHSCKPVYLNCMTLKDSATVYGKLYTDLTGKSPPSAKDRLRAVERHLTS---TGPSIIMVLDEIDQLDSKNQEILYTIFEWPSMTKSRLILIGIANALDLTDRILPRLQARPKCKPKLLNFAPYSKDQIAAILKDRIAKLESEGVAVMENSAIQFCARKISAVAGDMRKALDVCRRAVEMVETE----VRSQQVLKSNTTL---NSPSKRPPAIPKKIGV-MQISSVLSE---------VY----------GSSTTSSSQDSIPIQQKLVVCTLLLMVKQ---GRMKEVTMGKLQDTYTKVCKKRQMATHD--EFQGLCSLLETRGIIGIKKPKEGRLAKVSLKLNEKELEHALQDKVLISSILQDGL 594          
BLAST of Cell division control protein vs. TrEMBL
Match: A0A0V0J5J7 (Cell division control protein 6 homolog (Fragment) OS=Schistocephalus solidus OX=70667 GN=CDC6 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.380e-58
Identity = 155/468 (33.12%), Postives = 249/468 (53.21%), Query Frame = 3
Query:  258 APSIRIKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQK----AATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVD-MTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAI----LLSQITETPDPKQL---IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDP-------------------YKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVR-IQPH---------KETRQRIFTMNLDRKGIEKALDDGMLLTSIM 1538
            AP+  +     T+++ N++IGR  E   L + +   IS   ++++YISG PGTGKT  VT+ ++ L+    C+  FINCM L  P  ++  ILS L+ +           AA E  +  KSR    L L+ VLDEIDQL      +L  IF W D +T S LI++GIAN+LDL E++LP L  +S RP  ++F PY++ +I+ I    LL Q   +    Q    +A+++C+KK++A SGD R AL +  RA+E + LE     R+   D     VE T    RR+LS+P   A+K + ++ V  P+I+HV++A +E Q   +P                    ++    +  ++ +PLH KL L         ++   +++  + QLYD+Y  +C  +++  ++MS F  +   L+S G++R I P             R +  ++ LD KG+E++LDD +LLTS++
Sbjct:   36 APTFSLSQALHTSEL-NEVIGREKEIEFLRKTMEDCISQKRSASLYISGAPGTGKTATVTQEVQALLKTGRCQAIFINCMQLQTPKAVFARILSTLSVSCSFPSSSENVVAAVEACLTKKSR---RLPLIIVLDEIDQLAGAYQDVLYTIFGWPDGLTDSHLILLGIANALDLTERLLPGLQSRSLRPLHLSFPPYSKDQISQIISDRLLRQSNSSGSSVQALDKLAIQFCAKKVAACSGDVRTALAVCHRAIELARLEARAKQRAVGDDE---DVENTPPLQRRLLSSP---ALKATTEAFV-VPTIRHVSQAFHEAQSIGEPSTRRLSLLHTSTGGGGGGGGQSAPQPSPARNNMPLHHKLVLATA---LLLRRLRGIREAAVGQLYDLYTHVCCMRKLVALEMSEFACVCELLDSHGLLRVITPGCRATAVASCTPARMKRVSLLLDDKGVERSLDDNLLLTSVL 489          
BLAST of Cell division control protein vs. TrEMBL
Match: A0A1S3HJB2 (Cell division control protein OS=Lingula unguis OX=7574 GN=LOC106155022 PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 7.844e-57
Identity = 147/436 (33.72%), Postives = 236/436 (54.13%), Query Frame = 3
Query:  270 RIKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVF-VLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAIL---LSQITETPDPKQLI---AVKYCSKKISAGSGDARAALDLYKRAVEFSELE-ELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFL 1550
            R+K    TA    +L+GR  E   + +FLT ++    + ++Y+SG PGTGKT V++ VM     +   K  FINCM   N   I+ ++ S+L G    + QK   E   +L+ +  +S  +V  +LDEIDQL  +N  +L  +F+W  +  SRL+++GIAN+LDL +++LP L     C+P  +NF PY  Q+I  I+   L Q+ +  D   L+   AV++C++K+SA +GD R ALD+ +RAVE  E + + Q+I   S    P        P+RR                 V    I +V   +Y  +   +P      +   + T+PL QK+ +C  L+LT++   ++ K++ + +L+D Y +ICK +++   D   F+ +   LE+RGIV ++  KETR    ++ LD K +E AL D +LLTSI  + L
Sbjct:  248 RVKKVLHTA-APERLVGREKETATIDKFLTKHLLGQVSGSLYVSGAPGTGKTAVLSSVMDTYKEKSKHKSIFINCMTAKNSAAIFNKVASELQGK---SVQKTVKESVRHLEKQLTSSGPMVLLILDEIDQLDSKNQDVLYTMFEWPALENSRLVLIGIANALDLTDRILPRLQAHPKCKPQLLNFAPYTRQQITDIIQDRLKQVGQ--DDGALVDPSAVQFCARKVSAVAGDMRKALDVCRRAVEVVESQVKRQTILKPSDSNSPRKT----PPVRR----------------KVGVADIANVVSDVYGSRVVTNP------QGEQQQTIPLQQKIVVCTLLLLTKQ---TKNKEVTLGKLHDSYAKICKKKQMTSSDQCEFLSLCTLLETRGIVGLKKTKETRMTKVSLKLDEKEVEFALQDKLLLTSIFSQGL 648          
BLAST of Cell division control protein vs. Ensembl Cavefish
Match: cdc6 (cell division cycle 6 [Source:NCBI gene;Acc:103046129])

HSP 1 Score: 172.94 bits (437), Expect = 1.056e-46
Identity = 136/435 (31.26%), Postives = 224/435 (51.49%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVM---KNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKS--TLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +K    TA +  +L+ R AER  +  FL +++     S++YISG PGTGKT  +  V+   K L+  K  +   INCM L + + I+      L   L T+   +  ++E  L S   +   ++ VLDE+DQL  ++  +L  IF+W  ++ SRL ++GIAN+LDL +++LP L T   CRP  ++F PY+ QE+ AI+  ++ +      L   A+++C++K+SA SGDAR ALD+ +RAVE  E +      SE                              +  +  S  S+  V + L EV      Y + +  ++G    + PL QKL +C  L+LTR  +S   +++++ +L + Y ++CK +++  +     + +   LESRGI  ++  KE R     + ++ K +E AL D  LL SI+   LP
Sbjct:  207 VKQSLHTA-VPERLLSREAERATIVSFLENHVVPGKPSSLYISGAPGTGKTACLNCVLQEQKALL--KGVQTVVINCMTLRSSHSIF----PLLAEKLKTSKSSSGGKLEKLLTS---SGPTVLLVLDEMDQLDSKSQDVLYTIFEWPYLSKSRLCLIGIANALDLTDRILPRLQTKPHCRPQLLHFPPYSRQELTAIVQDRLAQVSGEGVLDGAAIQFCARKVSAVSGDARKALDICRRAVEMVESKNKSKEASEP-----------------------------AANAKASRVSVPQVAKVLSEV------YGDRMTSSAGGDGESFPLQQKLLVCCLLLLTRNGKS---REVQLGKLCEAYSKLCKQRQVSAVGQGECLSLCSLLESRGIFSLKKAKEARLTKICLKIEEKDVENALKDRALLGSILAAGLP 593          
BLAST of Cell division control protein vs. Ensembl Cavefish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 88.9669 bits (219), Expect = 3.953e-18
Identity = 62/209 (29.67%), Postives = 111/209 (53.11%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQS 1010
            G PGTGKT  V EV+++L       ++  ++FI  N M +++P+  Y +IL +LT    T    AA   + +    P     ++ V +       + N++ N +F W     +RL+++ IAN++DL E+++ N          M+FQPY  +++  I+ S++ +    ++  A++  S+K++A SGDAR  LD+ +RA E  E    +S
Sbjct:  488 GVPGTGKTATVHEVIRSLQQAAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTNQKATADHAAALLEKRFSMPAPKKETTVLLVDELDLLWTRKQNVMYN-LFDWPTRRHARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKAFEE-DALQLVSRKVAALSGDARRCLDICRRATEICEYSSQRS 694          
BLAST of Cell division control protein vs. Ensembl Sea Lamprey
Match: cdc6 (cell division cycle 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050506-131])

HSP 1 Score: 171.785 bits (434), Expect = 4.437e-47
Identity = 137/426 (32.16%), Postives = 227/426 (53.29%), Query Frame = 3
Query:  309 KLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKL--CKYHFINCMDLSNPNLIYREILSQLT----GTLLTNYQKAATEIE-IYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNL-TLQSCRPHCMNFQPYNEQEINAIL---LSQITE-TPDPKQLIAVKYCSKKISAGSGDARAALDL-YKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSP---SIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIM 1538
            +L+ R  E   +  F+  ++      +IYISG PGTGKT  +  ++ ++  ++L   +  F+NCM L++   +Y  +LS+L      T     +  A ++E I  KS PM    +V VLDE+DQL  R   +L  +F+W  +  SRL+++G+AN+LDL +++LP L  L+S +PH +NF PY+  +I AIL   LS + E   DP    AV++C++K+SA SGDAR ALD+  +RAVE    E    IR ++V           SP     +   FL        T + P   ++  ++  L EV     P  +   +  G  + PL QKL +   L+L R   S ++++    ++++ Y  +C+  ++  +  S  + +   LE+RGI+ I+  KE R    ++ +D+  +E AL D +LL+SI+
Sbjct:  181 RLLCRERETAAIVAFVEEHVVARVPGSIYISGAPGTGKTACLKHILHSM-KKRLSNARVVFLNCMPLTSSQAVYPAVLSKLGEAGEKTAGVGSRDHARQLERIVTKSGPM----IVLVLDEMDQLDSRAQEVLYTMFEWPALPNSRLVLIGVANALDLTDRILPRLQALRSHQPHLINFPPYSRDQILAILQDRLSGLKEGVVDPA---AVQFCARKVSAMSGDARKALDVCSRRAVEKLGGE----IRKQTV----------LSP-----NGEGFLCASAGPVPTTTVPRRVTLPQISAVLSEVYG--SPMASRAGDHGG--SFPLQQKLLVITLLMLVR---SGKVREFTFGKIHETYTGVCQRHQMARLHQSECMALCSLLEARGILTIKNSKEARLMKVSLKIDQSDVEHALQDKVLLSSIL 572          
BLAST of Cell division control protein vs. Ensembl Yeast
Match: CDC6 (Essential ATP-binding protein required for DNA replication; component of the pre-replicative complex (pre-RC) which requires ORC to associate with chromatin and is in turn required for Mcm2-7p DNA association; homologous to S. pombe Cdc18p; relocalizes from nucleus to cytoplasm upon DNA replication stress; degraded in response to plasma membrane stress [Source:SGD;Acc:S000003730])

HSP 1 Score: 89.3521 bits (220), Expect = 1.975e-19
Identity = 113/427 (26.46%), Postives = 190/427 (44.50%), Query Frame = 3
Query:  312 LIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKN-----------------LVH-----QKLCKYHF------------INCMDLSNPNLIYREILS---QLTGTLL--TNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNN------LILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTL-QSCRPHCMNFQPYNEQEINAILLSQITETPDP-KQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEE--LQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGK-STLPLHQKLALCAGLILTRRQQSSRM-KQIKISQLYDMYLE-ICKSQEIEGIDMSNFIDITGHLESRGIVRI 1436
            L  RTAE  Q+  FL   IS H + ++YI+G PGTGKT  +  +++                  L H     Q L  +              INC+ L  P+ I+++I      L G  L   N Q     +E Y K         V VLDE+D+L+  N         +  +F    +     +++G+ANSLD+ ++ L  L L +   P  + FQPY  +++  I++ +++  P    Q +A+K+ +KK +  +GD R   D+ + ++E  ELE+  L S    S++     +  T SP+++    PQ   I ++  + V S   K VN                 N T  + + L + QKL LC  +      QS ++     I + +D Y++ I K+  +  +  + F++I   LE+ G+V I
Sbjct:   78 LPARTAEYEQVMNFLAKAISEHRSDSLYITGPPGTGKTAQLDMIIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFELPDGRLESVAVTSINCISLGEPSSIFQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYHKKT-----TFVVVLDEMDRLLHANTSETQSVRTILELFLLAKLPTVSFVLIGMANSLDMKDRFLSRLNLDRGLLPQTIVFQPYTAEQMYEIVIQKMSSLPTIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEKRFLLSPTRGSLNSAQVPLTPTTSPVKKSYPEPQG-KIGLNYIAKVFS---KFVNN----------------NSTRTRIAKLNIQQKLILCTII------QSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSI 473          
BLAST of Cell division control protein vs. Ensembl Yeast
Match: ORC1 (Largest subunit of the origin recognition complex; involved in directing DNA replication by binding to replication origins; also involved in transcriptional silencing; exhibits ATPase activity; ORC1 has a paralog, SIR3, that arose from the whole genome duplication [Source:SGD;Acc:S000004530])

HSP 1 Score: 88.9669 bits (219), Expect = 5.458e-19
Identity = 65/241 (26.97%), Postives = 107/241 (44.40%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLCK------YHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSL-ALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEI-----------------------NAILLSQITETPDPKQLI--------------AVKYCSKKISAGSGDARAALDLYKRAVEFSE 992
            G PG GKT  V EV+K L+     +      Y  IN + +  P   Y  + ++++G  LT +  +   +E Y K  P N    +V +LDE+D ++ ++  I+   F W     ++LI++ +AN++DL E+ L N          + F  Y  +E+                       NAIL+         KQ +              A++  S+K+++ SGDAR AL + KRA E +E
Sbjct:  479 GTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLT-WAASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAE 718          
BLAST of Cell division control protein vs. Ensembl Nematostella
Match: EDO49496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGA8])

HSP 1 Score: 176.407 bits (446), Expect = 7.587e-50
Identity = 122/417 (29.26%), Postives = 232/417 (55.64%), Query Frame = 3
Query:  306 NKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNL-VHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIE-IYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQLI---AVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIM 1538
            + ++ R  E   +T+FL  ++      ++YISG PGTGKT  +T V++++ V+   C   FINCM L + + I+ +I+ +L        + A   +E  +    PM     + +LDE+DQL  +N  +L  +F+W  +  S+L+++GIAN+LDL +++LP L  +  C+P  +NF PY   +I+ IL  +I++T     ++   A+++C++K++A +GD R ALD+ +RAVE  E      +R + + + P+  E  ++  +  L++P   A K+S+    S  S  + +R +              N +  + T+PL QKL +C  L++ ++    ++K++ + +L++ Y  +CK +++  +   +FI +   LE+RGI+ ++  KE R    ++ +D   ++ AL D  LL++I+
Sbjct:   17 DNILCRDTEIKAVTKFLEKHVQKKKPGSLYISGAPGTGKTACLTMVIRDMKVNVSDCPVTFINCMSLQHSHAIFAKIIEELGIEEKVATKDAQKVLERKFTAPGPMR----ILILDEMDQLETKNRDVLYTMFEWPSLPKSKLVLIGIANALDLTDRILPRLQARPKCKPELLNFPPYTRNQISTILQQRISQTEGETPVLDTPAIQFCARKVAAVAGDIRKALDICRRAVEVVE----SDVRKQHILQ-PTKYENAQT--QGELNSPTPTAKKVSLGHIASVVSDVYGSRIMA-------------NSSGSQPTIPLQQKLLVCTLLLMLKQ---GKVKEVILGKLHETYSNVCKKRQVNQVTQDDFIALCKLLETRGIITLKKAKEMRMIKVSLKIDENEVDFALQDKTLLSAIL 406          
BLAST of Cell division control protein vs. Ensembl Nematostella
Match: EDO32960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK3])

HSP 1 Score: 115.931 bits (289), Expect = 4.490e-28
Identity = 97/381 (25.46%), Postives = 177/381 (46.46%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVHQKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITE----TPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIK-HVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGML 1523
            G PGTGKT  V EV++ L       + F+  N M ++ PN IY  +L +LTG   T    A+  ++    S       +V ++DE+D L  R   ++  +F+W     S+LI++ IAN++DL E+M+ N          + FQPY   ++  I+LS+I +     PD  QL+A     +K++A SGDAR  LD+ +RAVE ++L+  +    +S               ++ LS    + +  +++   SSP IK  +N +++E                            L    +L   ++S  +++   S++Y     +C+ + +     +    IT  L +  ++ ++P +  +QR   +N+++  +  AL +  L
Sbjct:   93 GVPGTGKTATVHEVIRLLSESIEDDFRFVELNGMKMTEPNQIYSMLLKKLTGQKATPAH-ASELLDKMFSSNSSQRDCVVLMVDELDLLWTRKQGVMYNLFEWPSRRHSKLIVLAIANTMDLPERMMINRVQSRLGLTRITFQPYTHAQLQRIVLSRIQDLNVFDPDAMQLVA-----RKVAAVSGDARRCLDICRRAVEIADLQTSKKATPKS---------------KKPLSLVGMIHVDQALQEMFSSPKIKVMMNLSMFE---------------------------GLLMKAVLAEFKRSG-VEEAAFSEVYCQLGNLCRLEGLTPPSTTEASIITSRLGATRLLLVEPGRLDQQRRIRLNVNQDDVIYALRNATL 424          
BLAST of Cell division control protein vs. Ensembl Medaka
Match: cdc6 (cell division cycle 6 [Source:NCBI gene;Acc:101159640])

HSP 1 Score: 160.229 bits (404), Expect = 2.513e-42
Identity = 126/432 (29.17%), Postives = 218/432 (50.46%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEEL-QSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +K    TA +  +L+ R AE+  +  FL   +      ++YISG PGTGKT  +  V++ +  +    +   +NCM L + + I+  +  +L      N       ++ +L     +  A++ VLDE+DQL  +   +L  IF+W  +  SRL ++GIAN+LDL +++LP L  +  CRP  ++F PY+  E+ AI+  ++ +      L   AV++C++K+SA SGDAR ALD+ +RAVE  E ++  + ++ E+           ESP  RV                     +  V R L EV       + + ++++   + PL QKL +C  L+L R   S + ++  + +L+++Y  +C  +++ G      + +   LESRGI  ++  KE R     + ++ K +E AL D  LL +I+   LP
Sbjct:  185 VKQALHTA-VPERLLSREAEQASIRRFLQEKVLQRRPGSLYISGAPGTGKTACLNCVLQEMKGELAGVQAVTVNCMSLRSSHAIFPLLADKLRAPGGQNG------LQRFLTG---SGPAVLLVLDEMDQLDSKAQDVLYTIFEWPFLPKSRLCLIGIANALDLTDRILPRLQARLHCRPLLLHFAPYSRDELTAIVKDRLAQVSAEGVLDASAVQFCARKVSAVSGDARKALDICRRAVEMVESDQRKKKLQPEN-----------ESPASRV--------------------GLPQVARVLSEVYG-----ERMASQSADGESFPLQQKLLVCCLLLLVR---SGKSREASLGKLHEVYSRLCAQRQVSGAGQGECLSLCSLLESRGIFGLKKAKEARLTKVFLKIEEKEVENALKDRALLGAILAAGLP 567          
BLAST of Cell division control protein vs. Ensembl Medaka
Match: cdc6 (cell division cycle 6 [Source:NCBI gene;Acc:101159640])

HSP 1 Score: 160.229 bits (404), Expect = 2.513e-42
Identity = 126/432 (29.17%), Postives = 218/432 (50.46%), Query Frame = 3
Query:  273 IKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQ-KLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQ-SCRPHCMNFQPYNEQEINAILLSQITETPDPKQL--IAVKYCSKKISAGSGDARAALDLYKRAVEFSELEEL-QSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLP 1553
            +K    TA +  +L+ R AE+  +  FL   +      ++YISG PGTGKT  +  V++ +  +    +   +NCM L + + I+  +  +L      N       ++ +L     +  A++ VLDE+DQL  +   +L  IF+W  +  SRL ++GIAN+LDL +++LP L  +  CRP  ++F PY+  E+ AI+  ++ +      L   AV++C++K+SA SGDAR ALD+ +RAVE  E ++  + ++ E+           ESP  RV                     +  V R L EV       + + ++++   + PL QKL +C  L+L R   S + ++  + +L+++Y  +C  +++ G      + +   LESRGI  ++  KE R     + ++ K +E AL D  LL +I+   LP
Sbjct:  185 VKQALHTA-VPERLLSREAEQASIRRFLQEKVLQRRPGSLYISGAPGTGKTACLNCVLQEMKGELAGVQAVTVNCMSLRSSHAIFPLLADKLRAPGGQNG------LQRFLTG---SGPAVLLVLDEMDQLDSKAQDVLYTIFEWPFLPKSRLCLIGIANALDLTDRILPRLQARLHCRPLLLHFAPYSRDELTAIVKDRLAQVSAEGVLDASAVQFCARKVSAVSGDARKALDICRRAVEMVESDQRKKKLQPEN-----------ESPASRV--------------------GLPQVARVLSEVYG-----ERMASQSADGESFPLQQKLLVCCLLLLVR---SGKSREASLGKLHEVYSRLCAQRQVSGAGQGECLSLCSLLESRGIFGLKKAKEARLTKVFLKIEEKEVENALKDRALLGAILAAGLP 567          
BLAST of Cell division control protein vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 102.064 bits (253), Expect = 3.036e-22
Identity = 65/203 (32.02%), Postives = 110/203 (54.19%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSE 992
            G PGTGKT  V EVM+ L H     ++  +HFI  N M +++P+  Y +IL +LTG   T    AA   + +    P     ++ V +       + N++ N +F W     +RL+++ IAN++DL E+++ N          M+FQPY  +++  I+ S++ +    ++  A++  S+K++A SGDAR  LD+ +RA E  E
Sbjct:  584 GVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQKLTGQKATADHAAALLEKRFSNPAPRKETTVLLVDELDLLWTRKQNVMYN-LFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKAFEE-DALQLVSRKVAALSGDARRCLDICRRATEICE 784          
BLAST of Cell division control protein vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 102.064 bits (253), Expect = 3.036e-22
Identity = 65/203 (32.02%), Postives = 110/203 (54.19%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSE 992
            G PGTGKT  V EVM+ L H     ++  +HFI  N M +++P+  Y +IL +LTG   T    AA   + +    P     ++ V +       + N++ N +F W     +RL+++ IAN++DL E+++ N          M+FQPY  +++  I+ S++ +    ++  A++  S+K++A SGDAR  LD+ +RA E  E
Sbjct:  584 GVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQKLTGQKATADHAAALLEKRFSNPAPRKETTVLLVDELDLLWTRKQNVMYN-LFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKAFEE-DALQLVSRKVAALSGDARRCLDICRRATEICE 784          
BLAST of Cell division control protein vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 101.679 bits (252), Expect = 3.443e-22
Identity = 65/203 (32.02%), Postives = 110/203 (54.19%), Query Frame = 3
Query:  402 GFPGTGKTFVVTEVMKNLVH----QKLCKYHFI--NCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSE 992
            G PGTGKT  V EVM+ L H     ++  +HFI  N M +++P+  Y +IL +LTG   T    AA   + +    P     ++ V +       + N++ N +F W     +RL+++ IAN++DL E+++ N          M+FQPY  +++  I+ S++ +    ++  A++  S+K++A SGDAR  LD+ +RA E  E
Sbjct:  563 GVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQKLTGQKATADHAAALLEKRFSNPAPRKETTVLLVDELDLLWTRKQNVMYN-LFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKAFEE-DALQLVSRKVAALSGDARRCLDICRRATEICE 763          
BLAST of Cell division control protein vs. Planmine SMEST
Match: SMESG000070150.1 (SMESG000070150.1)

HSP 1 Score: 985.326 bits (2546), Expect = 0.000e+0
Identity = 514/516 (99.61%), Postives = 516/516 (100.00%), Query Frame = 3
Query:   18 MENINKTPRLTRSQSRLFQNTQIVXXXXXXXXXXXXXXXDKSPRVLLEKIDLNNQIFFKSVESITEKLENISFKTPRKSRAPSIRIKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLPPDDS 1565
            MENINKTPRLTRSQSRLFQNTQIVNKPNNITNNKNRNQKDKSPRVLLEKIDLNNQIFFKSVESITEKLENISFKTPRKSRAPSIRIKNPTETAKISNKLIGRTAERNQLTEFLTSNISNHSNSNIYISGFPGTGKTFVVTEVMKNLV+QKLCKYHFINCMDLSNPNLIYRE+LSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLPPDDS
Sbjct:    1 MENINKTPRLTRSQSRLFQNTQIVNKPNNITNNKNRNQKDKSPRVLLEKIDLNNQIFFKSVESITEKLENISFKTPRKSRAPSIRIKNPTETAKISNKLIGRTAERNQLTEFLTSNISNHSNSNIYISGFPGTGKTFVVTEVMKNLVYQKLCKYHFINCMDLSNPNLIYREMLSQLTGTLLTNYQKAATEIEIYLKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCSKKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESPMRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINETSGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEIEGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDGMLLTSIMDKFLPPDDS 516          
BLAST of Cell division control protein vs. Planmine SMEST
Match: SMESG000072187.1 (SMESG000072187.1)

HSP 1 Score: 103.99 bits (258), Expect = 1.948e-23
Identity = 84/263 (31.94%), Postives = 134/263 (50.95%), Query Frame = 3
Query:  231 SFKTPRKSRA-----PSIRIKNPTETAKISNKLIGRTAERNQLTEFLTXXXXXXXXXXXXXXGFPGTGKTFVVTEVMKNLVHQKLC-KYHFINCMDLSNPNLIYREILSQL-TGTLLTNYQKAATEIEIY-LKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETP-----DPKQLIAVKYCSKKISAGSGDARAALDLYKRAV 980
            S   P +SR      PS   +       I      R  E   +  FL  N+S  ++S ++ISG PGTGKT  V   +  L    L  +  FIN M +S P  +Y  I   L T  +  N   AA E E++   +R      ++ V+DEIDQL  +   +L +IF+W+  + SRL+++ I+N++DL  ++L            + F+PY+ Q++  I+ +++T        DPK   A++  ++K++A SGDAR ALD+ +RAV
Sbjct:  142 SISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVPANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPK---AIELVARKVAAMSGDARRALDICRRAV 401          
The following BLAST results are available for this feature:
BLAST of Cell division control protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CDC61.174e-4928.04cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC... [more]
CDC61.174e-4928.04cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC... [more]
ORC17.002e-1729.52origin recognition complex subunit 1 [Source:HGNC ... [more]
ORC17.002e-1729.52origin recognition complex subunit 1 [Source:HGNC ... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cdc-64.686e-2332.58Cell division control protein [Source:UniProtKB/T... [more]
orc-11.806e-1928.37Origin recognition complex subunit 1 [Source:UniP... [more]
orc-11.806e-1928.37Origin recognition complex subunit 1 [Source:UniP... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cdc62.905e-4127.78gene:FBgn0035918 transcript:FBtr0076647[more]
Orc13.518e-2330.19gene:FBgn0286788 transcript:FBtr0088959[more]
back to top
BLAST of Cell division control protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc66.636e-5132.03cell division cycle 6 homolog (S. cerevisiae) [Sou... [more]
cdc66.636e-5132.03cell division cycle 6 homolog (S. cerevisiae) [Sou... [more]
cdc66.636e-5132.03cell division cycle 6 homolog (S. cerevisiae) [Sou... [more]
orc12.884e-1830.05origin recognition complex, subunit 1 [Source:ZFIN... [more]
orc12.935e-1830.05origin recognition complex, subunit 1 [Source:ZFIN... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf32.312e-5232.38PHD finger protein 3 [Source:Xenbase;Acc:XB-GENE-9... [more]
phf33.565e-5232.38PHD finger protein 3 [Source:Xenbase;Acc:XB-GENE-9... [more]
phf34.965e-5232.38PHD finger protein 3 [Source:Xenbase;Acc:XB-GENE-9... [more]
klk11.924e-1828.57kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
klk11.981e-1828.57kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
back to top
BLAST of Cell division control protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cdc64.793e-5430.41cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1... [more]
Cdc67.634e-5430.41cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1... [more]
Cdc61.396e-3232.68cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1... [more]
Orc16.634e-1830.05origin recognition complex, subunit 1 [Source:MGI ... [more]
back to top
BLAST of Cell division control protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O89033|CDC6_MOUSE3.353e-5330.41Cell division control protein 6 homolog OS=Mus mus... [more]
sp|Q99741|CDC6_HUMAN5.637e-4928.04Cell division control protein 6 homolog OS=Homo sa... [more]
sp|P41411|CDC18_SCHPO1.273e-2924.84Cell division control protein 18 OS=Schizosaccharo... [more]
sp|Q8W032|CDC6B_ARATH3.499e-2724.94Cell division control protein 6 homolog B OS=Arabi... [more]
sp|Q5N897|CDC6_ORYSJ3.802e-2725.12Cell division control protein 6 homolog OS=Oryza s... [more]
back to top
BLAST of Cell division control protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JQ116.685e-6032.80Uncharacterized protein OS=Biomphalaria glabrata O... [more]
R7TAL56.925e-6032.49Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210QKE81.245e-5833.65Cell division control protein OS=Mizuhopecten yess... [more]
A0A0V0J5J71.380e-5833.12Cell division control protein 6 homolog (Fragment)... [more]
A0A1S3HJB27.844e-5733.72Cell division control protein OS=Lingula unguis OX... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc61.056e-4631.26cell division cycle 6 [Source:NCBI gene;Acc:103046... [more]
orc13.953e-1829.67origin recognition complex, subunit 1 [Source:ZFIN... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdc64.437e-4732.16cell division cycle 6 homolog (S. cerevisiae) [Sou... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CDC61.975e-1926.46Essential ATP-binding protein required for DNA rep... [more]
ORC15.458e-1926.97Largest subunit of the origin recognition complex;... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO494967.587e-5029.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329604.490e-2825.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell division control protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc62.513e-4229.17cell division cycle 6 [Source:NCBI gene;Acc:101159... [more]
cdc62.513e-4229.17cell division cycle 6 [Source:NCBI gene;Acc:101159... [more]
orc13.036e-2232.02origin recognition complex subunit 1 [Source:NCBI ... [more]
orc13.036e-2232.02origin recognition complex subunit 1 [Source:NCBI ... [more]
orc13.443e-2232.02origin recognition complex subunit 1 [Source:NCBI ... [more]
back to top
BLAST of Cell division control protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000070150.10.000e+099.61SMESG000070150.1[more]
SMESG000072187.11.948e-2331.94SMESG000072187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002348 ID=SMED30002348|Name=Cell division control protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1610bp
TATTTTTAACATAATTTATGGAAAATATAAATAAAACTCCAAGGCTTACT
AGAAGCCAGTCGAGATTATTTCAAAATACACAAATAGTAAATAAACCTAA
CAATATTACTAATAATAAAAATCGGAATCAAAAGGATAAGAGTCCCAGAG
TTCTTTTGGAAAAAATAGATTTAAATAACCAAATTTTTTTCAAATCAGTT
GAAAGCATCACAGAGAAGCTAGAAAATATCTCTTTTAAAACTCCAAGAAA
ATCCAGAGCTCCTTCAATTCGAATTAAAAACCCCACAGAAACCGCAAAGA
TATCCAATAAACTAATCGGTAGAACTGCTGAAAGGAATCAACTGACGGAA
TTTCTCACCTCAAACATCAGCAATCATAGTAATTCCAATATATATATTAG
CGGATTCCCGGGAACTGGAAAAACATTTGTTGTCACTGAAGTAATGAAAA
ATTTGGTCCATCAAAAGCTATGTAAATATCATTTCATCAATTGCATGGAT
CTATCGAATCCCAATCTGATTTATCGGGAAATACTTTCTCAACTAACTGG
AACGTTATTGACAAATTATCAGAAGGCAGCAACTGAAATCGAAATTTATT
TGAAATCTCGTCCAATGAATTCGTTGGCATTGGTTTTCGTGTTGGATGAA
ATCGATCAGCTGATTGATAGAAATAATTTGATTTTAAATCGAATATTCAA
ATGGGTTGATATGACTCCAAGTCGACTAATCATCGTCGGTATCGCCAACT
CATTGGATCTTGTGGAGAAAATGTTGCCAAATTTAACTCTTCAGTCTTGT
CGACCTCATTGCATGAATTTCCAACCATATAACGAGCAGGAAATCAATGC
TATCTTGCTGTCACAAATAACTGAAACTCCTGACCCCAAACAACTAATCG
CTGTGAAATACTGCAGTAAAAAGATCTCCGCGGGCTCAGGTGATGCGAGA
GCAGCTTTAGATTTATATAAAAGAGCCGTAGAGTTTTCGGAATTGGAAGA
ACTGCAATCGATAAGATCAGAATCTGTTGATAGATTACCGAGTACAGTTG
AGTGCACGGAAAGTCCCATGCGTCGAGTATTGAGTACTCCGCAATTTCTC
GCGATAAAAATGTCCATGAAATCCACCGTATCCTCACCGAGTATTAAACA
CGTCAATAGAGCTCTCTATGAAGTCCAAAAAGGACAAGATCCATATAAAA
ACATAATAAATGAAACATCTGGTAAGAGTACTTTGCCTTTGCACCAAAAA
TTAGCCTTATGCGCCGGATTGATTTTAACGCGTCGACAACAGTCTAGTCG
GATGAAACAGATAAAAATCAGTCAACTCTATGATATGTATTTGGAAATTT
GCAAGTCCCAGGAAATCGAGGGGATTGATATGAGTAATTTCATCGATATC
ACTGGCCATCTGGAATCTCGTGGAATCGTTCGAATCCAACCACACAAAGA
AACCCGCCAGCGAATTTTCACCATGAATTTAGATAGAAAAGGAATTGAGA
AAGCCCTTGACGACGGGATGCTATTGACATCAATTATGGACAAATTCCTC
CCCCCTGACGATTCCTAGATTAGATGTAAATGTTATTTAGTTGAATAAAT
ATTTGTCCGT
back to top

protein sequence of SMED30002348-orf-1

>SMED30002348-orf-1 ID=SMED30002348-orf-1|Name=SMED30002348-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=517bp
MENINKTPRLTRSQSRLFQNTQIVNKPNNITNNKNRNQKDKSPRVLLEKI
DLNNQIFFKSVESITEKLENISFKTPRKSRAPSIRIKNPTETAKISNKLI
GRTAERNQLTEFLTSNISNHSNSNIYISGFPGTGKTFVVTEVMKNLVHQK
LCKYHFINCMDLSNPNLIYREILSQLTGTLLTNYQKAATEIEIYLKSRPM
NSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVE
KMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETPDPKQLIAVKYCS
KKISAGSGDARAALDLYKRAVEFSELEELQSIRSESVDRLPSTVECTESP
MRRVLSTPQFLAIKMSMKSTVSSPSIKHVNRALYEVQKGQDPYKNIINET
SGKSTLPLHQKLALCAGLILTRRQQSSRMKQIKISQLYDMYLEICKSQEI
EGIDMSNFIDITGHLESRGIVRIQPHKETRQRIFTMNLDRKGIEKALDDG
MLLTSIMDKFLPPDDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR015163Cdc6_C
IPR016314Cdc6/18
IPR003593AAA+_ATPase
IPR011991WHTH_DNA-bd_dom
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0051301cell division
GO:0006270DNA replication initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015163Cdc6, C-terminalSMARTSM01074Cdc6_C_2coord: 414..497
e-value: 2.8E-5
score: 33.5
IPR015163Cdc6, C-terminalPFAMPF09079Cdc6_Ccoord: 414..495
e-value: 4.5E-11
score: 42.6
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 263..351
e-value: 5.0E-8
score: 34.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 83..262
e-value: 8.7E-44
score: 151.2
NoneNo IPR availablePANTHERPTHR10763CELL DIVISION CONTROL PROTEIN 6-RELATEDcoord: 53..500
NoneNo IPR availableCDDcd00009AAAcoord: 126..254
e-value: 0.00269263
score: 36.3551
IPR003593AAA+ ATPase domainPFAMPF13401AAA_22coord: 121..243
e-value: 8.1E-12
score: 45.6
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 406..506
e-value: 4.9E-13
score: 51.0
IPR016314Cell division protein Cdc6/18PIRSFPIRSF001767Cdc6coord: 1..510
e-value: 4.4E-92
score: 307.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 89..340
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 404..505