Bax inhibitor-1 protein

Overview
NameBax inhibitor-1 protein
Smed IDSMED30002344
Length (bp)1060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bax inhibitor-1 protein (SMED30002344) t-SNE clustered cells

Violin plots show distribution of expression levels for Bax inhibitor-1 protein (SMED30002344) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bax inhibitor-1 protein (SMED30002344) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bax inhibitor-1 protein (SMED30002344) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002344

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002344h1SMcG0012319 Contig3754GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30002344h1SMcG0012319 Contig39145newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002344h1SMcG0012319 Contig39145uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002344h1SMcG0012319 dd_Smed_v6_319_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002344h1SMcG0012319 dd_Smed_v6_319_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30002344h1SMcG0012319 dd_Smed_v6_319_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002344h1SMcG0012319 dd_Smed_v6_319_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30002344h1SMcG0012319 dd_Smed_v6_319_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002344h1SMcG0012319 dd_Smed_v4_319_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bax inhibitor-1 protein vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 163.31 bits (412), Expect = 6.759e-48
Identity = 107/225 (47.56%), Postives = 153/225 (68.00%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVH+ + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP +     ++P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S L++L++ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD +++FR++MM+LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 163.31 bits (412), Expect = 6.759e-48
Identity = 107/225 (47.56%), Postives = 153/225 (68.00%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVH+ + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP +     ++P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S L++L++ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD +++FR++MM+LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 163.31 bits (412), Expect = 6.759e-48
Identity = 107/225 (47.56%), Postives = 153/225 (68.00%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVH+ + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP +     ++P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S L++L++ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD +++FR++MM+LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 163.31 bits (412), Expect = 6.759e-48
Identity = 107/225 (47.56%), Postives = 153/225 (68.00%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVH+ + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP +     ++P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S L++L++ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD +++FR++MM+LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 163.31 bits (412), Expect = 3.456e-47
Identity = 107/225 (47.56%), Postives = 153/225 (68.00%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVH+ + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP +     ++P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S L++L++ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD +++FR++MM+LA
Sbjct:   61 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILA 284          
BLAST of Bax inhibitor-1 protein vs. Ensembl Fly
Match: BI-1 (gene:FBgn0035871 transcript:FBtr0076711)

HSP 1 Score: 117.472 bits (293), Expect = 1.248e-30
Identity = 66/156 (42.31%), Postives = 101/156 (64.74%), Query Frame = 2
Query:  323 ENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRED 790
            +N   RL     FGF  G  LGPL+  + +I+P I+ +AL  T V FIS SLSAL      YLY+GGML+S +N + ++S  N    S  +   +LY+G+ +   FI++DTQ IVEK R G+ D + H+LDLF D++S+FRR++++L ++ ER+++
Sbjct:   82 KNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLFFDVLSMFRRLLIILTQKEERKQN 237          
BLAST of Bax inhibitor-1 protein vs. Ensembl Fly
Match: BI-1 (gene:FBgn0035871 transcript:FBtr0076712)

HSP 1 Score: 108.997 bits (271), Expect = 1.140e-27
Identity = 64/154 (41.56%), Postives = 97/154 (62.99%), Query Frame = 2
Query:  311 EHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKR 772
            +   +N   RL     FGF  G  LGPL+  + +I+P I+ +AL  T V FIS SLSAL      YLY+GGML+S +N + ++S  N    S  +   +LY+G+ +   FI++DTQ IVEK R G+ D + H+LDLF D++S+FRR++++L ++
Sbjct:   78 KDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLFFDVLSMFRRLLIILTQK 231          
BLAST of Bax inhibitor-1 protein vs. Ensembl Zebrafish
Match: tegt (testis enhanced gene transcript (BAX inhibitor 1) [Source:ZFIN;Acc:ZDB-GENE-030826-10])

HSP 1 Score: 174.481 bits (441), Expect = 1.620e-52
Identity = 105/225 (46.67%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            +F+R  IN ++ FKF  + +  QQHLKNVY++LA+ ++ A  G+Y++V + IFQ GL        + +  + T H  +    RLA    F F  G+ LGPL+    +IDP+I+ TA L TS+IF  F+LSAL+ + RSYL++GG L++GL +L+++S LN F GS +I  A LYLGL + C F+LFDTQLI+EK  +GD D+IWH +DLFLD V+IFR++++LL+
Sbjct:    3 VFDRN-INFDALFKFSQISRSTQQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAM-TPHSPQTEKKRLAILAAFAFFTGLGLGPLMDYAISIDPSIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVLLLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLVILLS 225          
BLAST of Bax inhibitor-1 protein vs. Ensembl Zebrafish
Match: tegt (testis enhanced gene transcript (BAX inhibitor 1) [Source:ZFIN;Acc:ZDB-GENE-030826-10])

HSP 1 Score: 152.14 bits (383), Expect = 7.213e-44
Identity = 99/225 (44.00%), Postives = 146/225 (64.89%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            +F+R  IN ++ FKF  + +  QQHLKNVY++LA+ ++ A  G+Y++V + IFQ GL        + +  + T H  +    RLA    F F  G      + V   +   I+ TA L TS+IF  F+LSAL+ + RSYL++GG L++GL +L+++S LN F GS +I  A LYLGL + C F+LFDTQLI+EK  +GD D+IWH +DLFLD V+IFR++++LL+
Sbjct:    3 VFDRN-INFDALFKFSQISRSTQQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAM-TPHSPQTEKKRLAILAAFAFFTG------VCVCVCVLLRIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVLLLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLVILLS 219          
BLAST of Bax inhibitor-1 protein vs. Ensembl Xenopus
Match: siah1 (siah E3 ubiquitin protein ligase 1 [Source:Xenbase;Acc:XB-GENE-1014415])

HSP 1 Score: 154.836 bits (390), Expect = 9.728e-45
Identity = 104/230 (45.22%), Postives = 154/230 (66.96%), Query Frame = 2
Query:  113 INLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHV-FSIFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA-----KRNERR 784
            IN  +  KF H+    QQHLK VYS+ AI ++ AA GAYV+V     Q   LSF  S G++  ++ T H  E+   RL    GF F  G+ LGP +++   I+P+I+PTA L T++IFI FSLSAL+ + RS+L++GG+L+S L++L++ S +N  +GS ++    +Y+GL + C F+LFDTQLI+EK   GD D++WH +DLFLD ++IFR++M++LA     KR ER+
Sbjct:    8 INFNALLKFSHISSSTQQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKKRLGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMSALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDFITIFRKLMVILAMNEKEKRKERK 237          
BLAST of Bax inhibitor-1 protein vs. Ensembl Xenopus
Match: siah1 (siah E3 ubiquitin protein ligase 1 [Source:Xenbase;Acc:XB-GENE-1014415])

HSP 1 Score: 147.902 bits (372), Expect = 4.246e-42
Identity = 100/220 (45.45%), Postives = 149/220 (67.73%), Query Frame = 2
Query:  143 HLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHV-FSIFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA-----KRNERR 784
            H+    QQHLK VYS+ AI ++ AA GAYV+V     Q   LSF  S G++  ++ T H  E+   RL    GF F  G+ LGP +++   I+P+I+PTA L T++IFI FSLSAL+ + RS+L++GG+L+S L++L++ S +N  +GS ++    +Y+GL + C F+LFDTQLI+EK   GD D++WH +DLFLD ++IFR++M++LA     KR ER+
Sbjct:   11 HISSSTQQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKKRLGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMSALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDFITIFRKLMVILAMNEKEKRKERK 230          
BLAST of Bax inhibitor-1 protein vs. Ensembl Xenopus
Match: siah1 (siah E3 ubiquitin protein ligase 1 [Source:Xenbase;Acc:XB-GENE-1014415])

HSP 1 Score: 144.436 bits (363), Expect = 7.910e-41
Identity = 99/214 (46.26%), Postives = 147/214 (68.69%), Query Frame = 2
Query:  161 QQHLKNVYSTLXXXXXXXXXXXYVHV-FSIFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA-----KRNERR 784
            QQHLK VYS+ AI ++ AA GAYV+V     Q   LSF  S G++  ++ T H  E+   RL    GF F  G+ LGP +++   I+P+I+PTA L T++IFI FSLSAL+ + RS+L++GG+L+S L++L++ S +N  +GS ++    +Y+GL + C F+LFDTQLI+EK   GD D++WH +DLFLD ++IFR++M++LA     KR ER+
Sbjct:   18 QQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKKRLGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMSALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDFITIFRKLMVILAMNEKEKRKERK 231          
BLAST of Bax inhibitor-1 protein vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 174.096 bits (440), Expect = 3.299e-52
Identity = 109/234 (46.58%), Postives = 161/234 (68.80%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA--KRNERRE 787
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP + +   ++P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LYLGL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA  ++++++E
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILAFNEKDKKKE 235          
BLAST of Bax inhibitor-1 protein vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 171.4 bits (433), Expect = 3.658e-51
Identity = 108/225 (48.00%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP + +   ++P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LYLGL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 171.4 bits (433), Expect = 3.658e-51
Identity = 108/225 (48.00%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP + +   ++P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LYLGL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 171.4 bits (433), Expect = 3.658e-51
Identity = 108/225 (48.00%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP + +   ++P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LYLGL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 171.4 bits (433), Expect = 3.658e-51
Identity = 108/225 (48.00%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP + +   ++P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LYLGL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILA 226          
BLAST of Bax inhibitor-1 protein vs. UniProt/SwissProt
Match: sp|Q9IA79|BI1_PAROL (Probable Bax inhibitor 1 OS=Paralichthys olivaceus OX=8255 GN=tmbim6 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.631e-52
Identity = 114/226 (50.44%), Postives = 158/226 (69.91%), Query Frame = 2
Query:   92 RIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
             +F+R  IN +S FKF  +    Q HLKNVYS+LA+ +  AA G+YVHV + +FQ G+LS + S G++F + +T H  E    RLA   GF F  G+ L P +  V  I+P+I+ TA L TSVIF+ F+LSAL+ + RSYL++GG L+SGL+IL +MS +N F GS M+  A +YLGL I C F+L DTQLI+EK   GD D++WHS+DLFLD ++IFR++M++LA
Sbjct:    2 NVFDRN-INFDSLFKFSQISHSTQVHLKNVYSSLAVCMFVAAAGSYVHVVTRLFQGGMLSVLGSLGMMFWLAMTPHNSETEKKRLAILAGFAFLTGVGLCPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLMSMMNMFFGSVMLFKAHMYLGLLIMCGFVLXDTQLIIEKAENGDKDYVWHSVDLFLDFITIFRKLMVILA 226          
BLAST of Bax inhibitor-1 protein vs. UniProt/SwissProt
Match: sp|Q0V882|BI1_BOVIN (Bax inhibitor 1 OS=Bos taurus OX=9913 GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 3.350e-51
Identity = 109/225 (48.44%), Postives = 156/225 (69.33%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++ FKF H+    QQHLK VY++ A+ +  AA GAY+HV + F QAGLLS + S GL+  ++ T H  E    RL    GF F  G+ LGP + +   I+P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++MM+LA
Sbjct:    3 IFDRK-INFDALFKFSHITPSTQQHLKKVYASFALCMFVAAAGAYIHVVTHFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSVWLFQANLYMGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTLFRKLMMILA 226          
BLAST of Bax inhibitor-1 protein vs. UniProt/SwissProt
Match: sp|P55062|BI1_RAT (Bax inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Tmbim6 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 1.498e-50
Identity = 108/225 (48.00%), Postives = 153/225 (68.00%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + +  L+  ++ T H  E    RL    GF F  G+ LGP + +   I+P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++ V S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSLGNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCIDLFLDFVTLFRKLMLILA 226          
BLAST of Bax inhibitor-1 protein vs. UniProt/SwissProt
Match: sp|Q9D2C7|BI1_MOUSE (Bax inhibitor 1 OS=Mus musculus OX=10090 GN=Tmbim6 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.559e-50
Identity = 108/225 (48.00%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S  L+  ++ T H  E    RL    GF F  G+ LGP + +   ++P+ILPTA + T++IF  FSLSAL+ R RSYL++GG+L+S ++++++ S  N F GS  +  A LYLGL + C F+LFDTQLI+EK   GD D+IWH +DLFLD V++FR++M++LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILA 226          
BLAST of Bax inhibitor-1 protein vs. UniProt/SwissProt
Match: sp|Q66RM2|BI1_PIG (Bax inhibitor 1 OS=Sus scrofa OX=9823 GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.244e-50
Identity = 109/225 (48.44%), Postives = 154/225 (68.44%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            IF+R+ IN ++  KF H+    QQHLK VY++ A+ +  AA GAYVHV + F QAGLLS + S GL+  ++ T H  E    RL    GF F  G+ LGP + +   I+P+ILPTA + T++IF  F+LSAL+ R RSYL++GG+L+S ++++V+ S  N F GS  +  A LY+GL + C F+LFDTQLI+EK   GD D+IWH +DLF D V++FR++MM+LA
Sbjct:    3 IFDRK-INFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMVLSSLGNLFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFSDFVTLFRKLMMILA 226          
BLAST of Bax inhibitor-1 protein vs. TrEMBL
Match: A0A210PHQ6 (Bax inhibitor 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24447 PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.688e-59
Identity = 122/235 (51.91%), Postives = 168/235 (71.49%), Query Frame = 2
Query:   86 MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRE 787
            M+R   R        FKFD+L   VQ HLK VY  L+I +  A  GAYVH+++ + QAG+L+ + S GL+  +  T H KE    RL  F GF F  GM+LGPL+  V T+DP+I+ TAL+ TSVIFISFSL+ALFN +R++LYMGG LLS L+ L +   LN FIGS++I   +LY GL IFC F+L+DTQ+IVEKKR+GD+D+IWHS+DLFLD + IFRR++++L+ +++++E
Sbjct:    1 MNRHSERNQFPPPQLFKFDNLENHVQDHLKRVYGCLSISMFTAFAGAYVHLYTAWLQAGILTMLASLGLMIWLASTHHSKETETKRLGIFAGFTFFTGMSLGPLLDYVITVDPSIIVTALMGTSVIFISFSLAALFNTNRTFLYMGGFLLSALSWLCLAGLLNIFIGSRLIWEVQLYAGLFIFCAFVLYDTQMIVEKKRMGDDDYIWHSVDLFLDFIQIFRRLLIILSNKDKKKE 235          
BLAST of Bax inhibitor-1 protein vs. TrEMBL
Match: R4JGL3 (Bax inhibitor-1 protein OS=Mytilus galloprovincialis OX=29158 GN=BI1 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.131e-57
Identity = 120/220 (54.55%), Postives = 169/220 (76.82%), Query Frame = 2
Query:  131 FKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRE 787
            FKFDH+ + VQ+HLK VY TL+I +IAA VGAYVH+F+ + +A  L+ + S GL+  + LT H KE    R+A FTGF F  GM+LGP++  V  IDP+I+ TA ++T+VIF+SFSL+AL+N  R++LYMGG L+SGL+ L+++ F+N F  S+MI    L+ GL IFC F+L+DTQLIVEKKR GD+DFIWHS+DLFLD ++IFR++M++L K+ +++E
Sbjct:   17 FKFDHIERNVQEHLKKVYGTLSIAMIAAGVGAYVHLFTGLMRASFLTSLASIGLMIWLALTHHSKETQMKRMAIFTGFTFFSGMSLGPVMDWVIDIDPSIIATAFMATTVIFVSFSLAALYNTDRTFLYMGGFLMSGLSWLMLLGFMNIFFQSQMIWDLYLHAGLLIFCAFVLYDTQLIVEKKRNGDDDFIWHSVDLFLDFINIFRKLMIILGKKEKKKE 236          
BLAST of Bax inhibitor-1 protein vs. TrEMBL
Match: A0A0A0R010 (Bax inhibitor-1 OS=Azumapecten farreri OX=106299 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.032e-56
Identity = 119/235 (50.64%), Postives = 168/235 (71.49%), Query Frame = 2
Query:   86 MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRE 787
            M+R   R        FKFD+L   VQ HLK VY  L+I +  A  GAYVH+++ + QAG+L+ + S GL+F +  T H KEN   RL  F GF F  GM+LGP++  V  +DP+I+ TAL+ TSVIFISFSL+ALFN +R++LYMGG LLS L+ L +   LN FIGS +I  A++Y+GL +FC F+L+DTQ+IVE+KR+GD D+IWHS+ LFLD + IFRR++++LA ++++++
Sbjct:    1 MNRHSERNQFPPPQLFKFDNLENHVQDHLKRVYGCLSISMFTAFAGAYVHLYTAWLQAGILTMLASLGLMFWLAATHHSKENETKRLGIFAGFTFFSGMSLGPVLDYVIMVDPSIIVTALMGTSVIFISFSLAALFNNNRTFLYMGGFLLSALSWLCLAGLLNIFIGSSLIWQAQIYVGLFVFCAFVLYDTQMIVERKRMGDGDYIWHSVSLFLDFMHIFRRLLIILASKDKKKD 235          
BLAST of Bax inhibitor-1 protein vs. TrEMBL
Match: V4ABN5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_191852 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.815e-56
Identity = 118/220 (53.64%), Postives = 170/220 (77.27%), Query Frame = 2
Query:  131 FKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRE 787
            FKFD+L + VQ+HLKNVY  L IG++ AAVGAYVH+F+ + QAGLL+ I S GL+  +    H KE +  R+A F+GF F  G++LGPL+ +  TIDP+I+P+ALL T+VIFISF+L+AL+N +R++LY+GG +LSGL+ L+V S  N F  S+M+    LY GL IFC F+L+DTQLI+EK+R+GD DF+WH++DLF+D + IFRR++++L+K+ E ++
Sbjct:   13 FKFDNLEEYVQKHLKNVYGCLGIGMLTAAVGAYVHLFTNLMQAGLLTAIGSIGLMIWLASIHHSKETVGKRMAIFSGFTFLSGISLGPLLDMAMTIDPSIIPSALLGTAVIFISFTLAALYNNNRTFLYLGGFILSGLSFLMVSSLANLFFRSQMLYDLNLYGGLIIFCAFVLYDTQLIIEKRRMGDEDFVWHAVDLFIDFIQIFRRLLIILSKKEEDKK 232          
BLAST of Bax inhibitor-1 protein vs. TrEMBL
Match: A0A3P8Z0Z3 (Testis enhanced gene transcript (BAX inhibitor 1) OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 5.403e-56
Identity = 119/233 (51.07%), Postives = 171/233 (73.39%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRED 790
            +F+R  INL+S  KF  +    Q HLKNVYS+LA+ +  +A GAYVHV + +FQ GLLS + S  ++  + +T H  +    RLA  +GF F  G+ LGP++  V +I+P+I+ TA L TSVIF+ F+LSAL+ + RSYL++GG L+SGL+IL+++SFLN F+GS M+  A +YLGLAI C F+LFDTQLI+EK  +GD D+IWHS+DLFLD ++IFR++M++LA  NE+++ 
Sbjct:    3 MFDRN-INLDSLLKFSQISHSTQLHLKNVYSSLALCMFVSAAGAYVHVVTRLFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLAILSGFAFFTGLGLGPVMDYVISINPSIIVTAFLGTSVIFVCFTLSALYAQRRSYLFLGGTLMSGLSILLLVSFLNMFLGSVMLFKAHIYLGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHSVDLFLDFITIFRKLMVILA-MNEKQDS 233          
BLAST of Bax inhibitor-1 protein vs. Ensembl Cavefish
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:103036156])

HSP 1 Score: 180.644 bits (457), Expect = 6.825e-55
Identity = 117/225 (52.00%), Postives = 165/225 (73.33%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            +F+R  IN ++ FKF  + +  QQHLKNVY++LA+ +  AA GAYVHV + IFQ GLLS + S  ++  + +T H  +    RL    GF F  G+ LGP++  V TI+P+I+ TA L+TSVIF  F+LSAL+ + RSYL++GG L+SGL+IL+++SFLN F+GS M+  A +Y+GLAI C F+LFDTQLI+EK  +GD D+IWH +DLFLD V+IFR++M++LA
Sbjct:    3 VFDRN-INFDALFKFSQISRSTQQHLKNVYASLAVCMFVAAAGAYVHVVTRIFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLGILAGFAFCTGVGLGPVMDYVITINPSIIITAFLATSVIFTCFTLSALYAQRRSYLFLGGTLMSGLSILLLLSFLNIFVGSVMLFKAHVYIGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVILA 226          
BLAST of Bax inhibitor-1 protein vs. Ensembl Cavefish
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:103036156])

HSP 1 Score: 171.4 bits (433), Expect = 4.377e-51
Identity = 117/238 (49.16%), Postives = 165/238 (69.33%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHL-------------GKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            +F+R  IN ++ FKF  +              +  QQHLKNVY++LA+ +  AA GAYVHV + IFQ GLLS + S  ++  + +T H  +    RL    GF F  G+ LGP++  V TI+P+I+ TA L+TSVIF  F+LSAL+ + RSYL++GG L+SGL+IL+++SFLN F+GS M+  A +Y+GLAI C F+LFDTQLI+EK  +GD D+IWH +DLFLD V+IFR++M++LA
Sbjct:    3 VFDRN-INFDALFKFSQITGGHPGTRWSSSGSRSTQQHLKNVYASLAVCMFVAAAGAYVHVVTRIFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLGILAGFAFCTGVGLGPVMDYVITINPSIIITAFLATSVIFTCFTLSALYAQRRSYLFLGGTLMSGLSILLLLSFLNIFVGSVMLFKAHVYIGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVILA 239          
BLAST of Bax inhibitor-1 protein vs. Ensembl Cavefish
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:103036156])

HSP 1 Score: 147.902 bits (372), Expect = 1.794e-42
Identity = 108/225 (48.00%), Postives = 156/225 (69.33%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA 766
            +F+R  IN ++ FKF  + +  QQHLKNVY++LA+ +  AA GAYVHV + IFQ GLLS + S  ++  + +T H  +    RL    G    + M++         ++  I+ TA L+TSVIF  F+LSAL+ + RSYL++GG L+SGL+IL+++SFLN F+GS M+  A +Y+GLAI C F+LFDTQLI+EK  +GD D+IWH +DLFLD V+IFR++M++LA
Sbjct:    3 VFDRN-INFDALFKFSQISRSTQQHLKNVYASLAVCMFVAAAGAYVHVVTRIFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLGILAGL---LKMHI---------LNCIIIITAFLATSVIFTCFTLSALYAQRRSYLFLGGTLMSGLSILLLLSFLNIFVGSVMLFKAHVYIGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVILA 214          
BLAST of Bax inhibitor-1 protein vs. Ensembl Sea Lamprey
Match: tegt (testis enhanced gene transcript (BAX inhibitor 1) [Source:ZFIN;Acc:ZDB-GENE-030826-10])

HSP 1 Score: 173.711 bits (439), Expect = 3.452e-53
Identity = 109/214 (50.93%), Postives = 154/214 (71.96%), Query Frame = 2
Query:  155 EVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIF-QXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA--KRNERRE 787
            + +QHLKNVY+TLAI ++ AA GAYVH+++ F Q   L  ++S GLL  ++ T    +N   RL    GF F +G+ LGPL+  V  I+P+I+ TA + TS+IF  F+LSAL+ R RSYLY+GG L+SGL+ L++MS  N F GS ++  A++YLGL + C F+LFDTQLIVEK R GD DFIWHS+DLFLD + IFR++M++L   ++++R+E
Sbjct:    2 DTRQHLKNVYATLAICMLVAAAGAYVHLYTAFLQGNFLMTLVSMGLLMWLMFTPRNGQNDAKRLGILCGFAFTVGLGLGPLLDFVIAINPSIIATAFMGTSLIFGCFTLSALYARRRSYLYLGGTLMSGLSFLLMMSLFNMFYGSALLFKAQMYLGLVVMCGFVLFDTQLIVEKCRAGDKDFIWHSVDLFLDFIHIFRKLMIILTMNEKDKRKE 215          
BLAST of Bax inhibitor-1 protein vs. Ensembl Nematostella
Match: EDO45792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRN6])

HSP 1 Score: 161.77 bits (408), Expect = 5.914e-48
Identity = 114/235 (48.51%), Postives = 159/235 (67.66%), Query Frame = 2
Query:   86 MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVF-SIFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRE 787
            MD +F  + I+L +   F  L    + HLKNVYS LA  ++AAAVG+ VH+F SI + G LS I S GLL A+ +T +  +N   R     GF    G++LGPL+ +V  +DP+I+ TA  +T +IF  F++SAL+   RS LY+GG L SGL+IL+++ F+N F+GS  I    LY GL +FC F+++DTQLIVEK R GD DFIWHS+DLFLD ++IFRRIM++LA+  E ++
Sbjct:    1 MDSLFGNRRISLSALKDFSKLDNPTRHHLKNVYSCLAASMMAAAVGSSVHLFTSILKGGFLSGIASLGLLIALAVTPNNGKNQSKRFGILMGFALCCGLSLGPLMDLVIEVDPSIVVTAFFATVMIFACFTVSALWAEQRSVLYLGGTLASGLSILLLLGFVNIFVGSFFIYQLHLYGGLLLFCGFVMYDTQLIVEKHRNGDKDFIWHSVDLFLDFINIFRRIMIILAQNKESKK 235          
BLAST of Bax inhibitor-1 protein vs. Ensembl Medaka
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:101168541])

HSP 1 Score: 177.948 bits (450), Expect = 8.365e-54
Identity = 118/236 (50.00%), Postives = 164/236 (69.49%), Query Frame = 2
Query:   95 IFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFS-IFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLA-----KRNERR 784
            +F+R  IN+++ FK   +    Q HLKNVYS+LA+ +I AA G+YVHV + +F+ G+LS + S GL+F + +T H  E    RLA   GF F  G+ LGP +  V  I+P+I+ TA L TSVIF+ F+LSAL+ + RSYL++GG L+SGL+IL + S +N F GS M+  A +YLGL I C F+LFDTQLI+EK   GD D+IWH +DLFLD V+IFR++M++LA     K+ ER+
Sbjct:    3 VFDRS-INIDALFKLSQISHSTQVHLKNVYSSLALSMIVAAAGSYVHVVTRLFEGGVLSLLGSVGLMFWLAMTPHNPETEKKRLAILAGFAFLTGVGLGPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLFSVMNMFFGSLMLFKAHMYLGLLIMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTIFRKLMIILAMNDKEKKKERK 237          
BLAST of Bax inhibitor-1 protein vs. Planmine SMEST
Match: SMESG000038559.1 (SMESG000038559.1)

HSP 1 Score: 376.711 bits (966), Expect = 5.255e-132
Identity = 235/235 (100.00%), Postives = 235/235 (100.00%), Query Frame = 2
Query:   86 MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLXXXXXXXXXXXYVHVFSIFQXXXXXXXXXXXXXXXXXXTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRXXXXXXXXXXXXXNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRED 790
            MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLAIGIIAAAVGAYVHVFSIFQAGLLSFILSFGLLFAILLTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRSYLYMGGMLLSGLNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRED
Sbjct:    1 MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLAIGIIAAAVGAYVHVFSIFQAGLLSFILSFGLLFAILLTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRSYLYMGGMLLSGLNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRED 235          
The following BLAST results are available for this feature:
BLAST of Bax inhibitor-1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMBIM66.759e-4847.56transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM66.759e-4847.56transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM66.759e-4847.56transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM66.759e-4847.56transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM63.456e-4747.56transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BI-11.248e-3042.31gene:FBgn0035871 transcript:FBtr0076711[more]
BI-11.140e-2741.56gene:FBgn0035871 transcript:FBtr0076712[more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tegt1.620e-5246.67testis enhanced gene transcript (BAX inhibitor 1) ... [more]
tegt7.213e-4444.00testis enhanced gene transcript (BAX inhibitor 1) ... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
siah19.728e-4545.22siah E3 ubiquitin protein ligase 1 [Source:Xenbase... [more]
siah14.246e-4245.45siah E3 ubiquitin protein ligase 1 [Source:Xenbase... [more]
siah17.910e-4146.26siah E3 ubiquitin protein ligase 1 [Source:Xenbase... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmbim63.299e-5246.58transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim63.658e-5148.00transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim63.658e-5148.00transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim63.658e-5148.00transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim63.658e-5148.00transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IA79|BI1_PAROL2.631e-5250.44Probable Bax inhibitor 1 OS=Paralichthys olivaceus... [more]
sp|Q0V882|BI1_BOVIN3.350e-5148.44Bax inhibitor 1 OS=Bos taurus OX=9913 GN=TMBIM6 PE... [more]
sp|P55062|BI1_RAT1.498e-5048.00Bax inhibitor 1 OS=Rattus norvegicus OX=10116 GN=T... [more]
sp|Q9D2C7|BI1_MOUSE2.559e-5048.00Bax inhibitor 1 OS=Mus musculus OX=10090 GN=Tmbim6... [more]
sp|Q66RM2|BI1_PIG5.244e-5048.44Bax inhibitor 1 OS=Sus scrofa OX=9823 GN=TMBIM6 PE... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PHQ61.688e-5951.91Bax inhibitor 1 OS=Mizuhopecten yessoensis OX=6573... [more]
R4JGL35.131e-5754.55Bax inhibitor-1 protein OS=Mytilus galloprovincial... [more]
A0A0A0R0101.032e-5650.64Bax inhibitor-1 OS=Azumapecten farreri OX=106299 P... [more]
V4ABN52.815e-5653.64Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3P8Z0Z35.403e-5651.07Testis enhanced gene transcript (BAX inhibitor 1) ... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tegt6.825e-5552.00transmembrane BAX inhibitor motif containing 6 [So... [more]
tegt4.377e-5149.16transmembrane BAX inhibitor motif containing 6 [So... [more]
tegt1.794e-4248.00transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tegt3.452e-5350.93testis enhanced gene transcript (BAX inhibitor 1) ... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO457925.914e-4848.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tegt8.365e-5450.00transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor-1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000038559.15.255e-132100.00SMESG000038559.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002344 ID=SMED30002344|Name=Bax inhibitor-1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1060bp
ATTTTACTTGTTTAAATAAGTTAATTTGGTATTTTATATCATCGATAAAT
ATTTTCTTTCTCTATTTCCATATTAACAGTTGAAAATGGATAGGATCTTT
AATCGACAACCAATCAATCTAGAAAGTGCTTTTAAATTCGATCATTTAGG
TAAGGAAGTACAGCAACATTTGAAAAATGTTTATAGTACACTGGCAATTG
GAATAATTGCTGCTGCAGTTGGTGCTTATGTTCATGTCTTCAGCATTTTT
CAAGCTGGACTACTGTCATTTATTTTATCATTTGGACTTTTGTTTGCAAT
TTTACTAACAGAACACAAAAAGGAGAACATACCAATGCGATTGGCCTTTT
TCACTGGGTTTGGATTTGCAATAGGAATGAATTTGGGTCCGCTTATCAGC
GTAGTTGGAACCATTGATCCTACTATCCTACCTACTGCTCTCCTTTCGAC
TAGTGTTATCTTTATTTCATTTTCATTGAGTGCGTTGTTTAATCGAAGCC
GTTCATATTTATATATGGGAGGTATGCTTCTTTCGGGACTTAACATCTTA
GTAGTGATGAGTTTTTTGAATTTTTTCATTGGTTCTAAAATGATCATGTC
AGCGGAACTTTATTTGGGTTTGGCAATTTTTTGCTTATTTATTTTGTTTG
ATACGCAATTGATTGTCGAGAAAAAGCGACTTGGAGATAACGATTTCATT
TGGCATTCGTTAGATTTGTTTTTGGACATTGTATCGATTTTCCGTCGAAT
TATGATGTTGTTGGCCAAGAGAAACGAGCGTCGGGAAGATTAATAATTTT
TGTTCATGAACGGCTTTGTGCATAAAACTAAATGTTTGTTTCTACAATGC
GTGTTCCTTATTACTATTATTGCGATTGTTTTTTATTTGTTGGTGCTGTG
GGATTGTATTCTCGGTGTGGACATAATAAGGAATATGACATTTTTACTTT
TCTGCAATTAAATAAAAAGATTGTTCGTAATTGATTATAAAATTTTAGTG
CTGTCGCTTAATGTAAATGTAGTAAATCATTAATTTCCAATAAAGTTAAG
TCTTGAGTTC
back to top

protein sequence of SMED30002344-orf-1

>SMED30002344-orf-1 ID=SMED30002344-orf-1|Name=SMED30002344-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MIILEPMKKFKKLITTKMLSPERSIPPIYKYERLRLNNALNENEIKITLV
ERRAVGRIVGSMVPTTLISGPKFIPIANPNPVKKANRIGMFSFLCSVSKI
ANKSPNDKINDSSPA*
back to top

protein sequence of SMED30002344-orf-2

>SMED30002344-orf-2 ID=SMED30002344-orf-2|Name=SMED30002344-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MDRIFNRQPINLESAFKFDHLGKEVQQHLKNVYSTLAIGIIAAAVGAYVH
VFSIFQAGLLSFILSFGLLFAILLTEHKKENIPMRLAFFTGFGFAIGMNL
GPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRSYLYMGGMLLS
GLNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLG
DNDFIWHSLDLFLDIVSIFRRIMMLLAKRNERRED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006214Bax_inhibitor_1-related
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006214Bax inhibitor 1-relatedPFAMPF01027Bax1-Icoord: 26..226
e-value: 1.1E-40
score: 139.8
IPR006214Bax inhibitor 1-relatedPANTHERPTHR23291BAX INHIBITOR-RELATEDcoord: 7..231
NoneNo IPR availablePANTHERPTHR23291:SF34BAX INHIBITOR 1coord: 7..231
NoneNo IPR availableCDDcd10430BI-1coord: 18..229
e-value: 2.43752E-79
score: 235.194
NoneNo IPR availableTMHMMTMhelixcoord: 169..188
NoneNo IPR availableTMHMMTMhelixcoord: 142..164
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 31..48
NoneNo IPR availableTMHMMTMhelixcoord: 113..135