TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30002332
Length (bp)1587
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30002332) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30002332) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30002332) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30002332) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002332

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30002332SMESG000070267.1 SMED30002332smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gutSMED30002332SMESG000070267.1 Contig1736GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30002332SMESG000070267.1 Contig1736GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30002332SMESG000070267.1 dd_Smed_v4_2599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002332SMESG000070267.1 dd_Smed_v4_2599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002332SMESG000070267.1 dd_Smed_v4_2599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 63.929 bits (154), Expect = 4.066e-10
Identity = 72/287 (25.09%), Postives = 123/287 (42.86%), Query Frame = 3
Query:  429 CPIE--SCSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMW--HLNNN-----QNQIFIQMKEINEKLLKMTNLMTFESTAKWN---FEESFEHLKLCPVEADGKSAY-NIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELIN 1250
            CP +   C+  D+  N++ H      E +       +N QL  Q   L        KSL + ++ +++    L + I KL  EKEF + A  F K       +Q++  H++ +     Q    +QM    +    +  LM    T K      E + + L +   E +    + NI K  +   +E F  +E T    K      +W+V  +  K R A  G    I S++F TS  GY++C +   +   SG    + L   +++G+FD+ L WPF+  +T  L++
Sbjct:  222 CPFKHYGCAVTDKRRNLQQHEHSALREHMRLVL--EKNVQLEEQISDL-------HKSLEQKESKIQQ----LAETIKKL--EKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGK-----LIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLD 488          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 63.929 bits (154), Expect = 4.066e-10
Identity = 72/287 (25.09%), Postives = 123/287 (42.86%), Query Frame = 3
Query:  429 CPIE--SCSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMW--HLNNN-----QNQIFIQMKEINEKLLKMTNLMTFESTAKWN---FEESFEHLKLCPVEADGKSAY-NIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELIN 1250
            CP +   C+  D+  N++ H      E +       +N QL  Q   L        KSL + ++ +++    L + I KL  EKEF + A  F K       +Q++  H++ +     Q    +QM    +    +  LM    T K      E + + L +   E +    + NI K  +   +E F  +E T    K      +W+V  +  K R A  G    I S++F TS  GY++C +   +   SG    + L   +++G+FD+ L WPF+  +T  L++
Sbjct:  222 CPFKHYGCAVTDKRRNLQQHEHSALREHMRLVL--EKNVQLEEQISDL-------HKSLEQKESKIQQ----LAETIKKL--EKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGK-----LIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLD 488          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 63.929 bits (154), Expect = 4.066e-10
Identity = 72/287 (25.09%), Postives = 123/287 (42.86%), Query Frame = 3
Query:  429 CPIE--SCSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMW--HLNNN-----QNQIFIQMKEINEKLLKMTNLMTFESTAKWN---FEESFEHLKLCPVEADGKSAY-NIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELIN 1250
            CP +   C+  D+  N++ H      E +       +N QL  Q   L        KSL + ++ +++    L + I KL  EKEF + A  F K       +Q++  H++ +     Q    +QM    +    +  LM    T K      E + + L +   E +    + NI K  +   +E F  +E T    K      +W+V  +  K R A  G    I S++F TS  GY++C +   +   SG    + L   +++G+FD+ L WPF+  +T  L++
Sbjct:  222 CPFKHYGCAVTDKRRNLQQHEHSALREHMRLVL--EKNVQLEEQISDL-------HKSLEQKESKIQQ----LAETIKKL--EKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGK-----LIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLD 488          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.1586 bits (152), Expect = 5.725e-10
Identity = 91/449 (20.27%), Postives = 179/449 (39.87%), Query Frame = 3
Query:  213 FICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLM--NIENHMK-ICYSESVTWFYPGSENTQLVRQ-GDHL------LQDNVPHSKSLLE--------FDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEE------SFEHL--KLCPVEADGKSAYNIEKT---LMKDADEYFVNIECTPPKKKDICLQY------------LWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            + C  C  +L +     CG R+C  C++  ++ +   C    E      +       KD    R+I  + + C  ES    +QLM  ++  H+K  C+ E +    P  +   L +   DH+       +    H KS +           N+  E+ +++ Q++H  +        +F    ER      Q   L NN+++I    + I+ +  K+  L       + N+EE      S E L  ++  +E+  KSA  + +    L      +   +     +  D+ L++            +W++  +  + + A  GK   + S+ F T   GY+MC ++  +    G    + L   +++G++D  L WPFK  +T  L++  +   +      ++        +KPT       GC +   + +L +  + ++D  +I  IV
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVF------KDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNESVEKNKSI-QSLHNQIC-------SFEIEIER------QKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 477          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 61.6178 bits (148), Expect = 8.837e-10
Identity = 35/147 (23.81%), Postives = 69/147 (46.94%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW++     +   +  G+   + S  F T+  GY++CL+L  +   +G R  + L + +++G++D  L WPF+  +TF L++    E        +R  +     ++P S      GC +      L   K  + ++D  ++ CIV
Sbjct:  147 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA---FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIV 290          
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 50.0618 bits (118), Expect = 3.114e-6
Identity = 31/86 (36.05%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  999 QYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQM--CLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELIN 1250
            Q +W++D+   +T  A +G    I S  F +   GY+M  C  L  D  S+G    I L + LLKG+FD  L WPF   I   L++
Sbjct:  264 QLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKS--ISLYVLLLKGEFDPTLEWPFHRAIKISLLD 347          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 68.5514 bits (166), Expect = 9.437e-12
Identity = 39/146 (26.71%), Postives = 69/146 (47.26%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++ +F+ + + A AG+   + S  F +S  GY+MCL+L  +   +G    + L   ++KGK+D  L WPF   +T  L++    E        +R  V     ++P S      GC     +  +   S + R+D  +I  IV
Sbjct:  385 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          

HSP 2 Score: 52.373 bits (124), Expect = 1.023e-6
Identity = 41/132 (31.06%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  147 ALINSIWTTLKHKSSQN---DFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAI------SLNINTS-KDRLINRKISKMIVKCPIESCSFKDQLMNIEN-HMKICYSESV 509
            +L +S+ +TL   S +      +P + C  CK +LR  +   CG R+C  C  +  +     C    E CRA+ I       LNI  +  D    R+I  +  KCP E CS+   L + EN H   C  E V
Sbjct:   18 SLPSSLDSTLPGISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPC----EACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERV 145          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 68.5514 bits (166), Expect = 9.437e-12
Identity = 39/146 (26.71%), Postives = 69/146 (47.26%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++ +F+ + + A AG+   + S  F +S  GY+MCL+L  +   +G    + L   ++KGK+D  L WPF   +T  L++    E        +R  V     ++P S      GC     +  +   S + R+D  +I  IV
Sbjct:  385 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          

HSP 2 Score: 52.373 bits (124), Expect = 1.023e-6
Identity = 41/132 (31.06%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  147 ALINSIWTTLKHKSSQN---DFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAI------SLNINTS-KDRLINRKISKMIVKCPIESCSFKDQLMNIEN-HMKICYSESV 509
            +L +S+ +TL   S +      +P + C  CK +LR  +   CG R+C  C  +  +     C    E CRA+ I       LNI  +  D    R+I  +  KCP E CS+   L + EN H   C  E V
Sbjct:   18 SLPSSLDSTLPGISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPC----EACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERV 145          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 68.5514 bits (166), Expect = 9.571e-12
Identity = 39/146 (26.71%), Postives = 69/146 (47.26%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++ +F+ + + A AG+   + S  F +S  GY+MCL+L  +   +G    + L   ++KGK+D  L WPF   +T  L++    E        +R  V     ++P S      GC     +  +   S + R+D  +I  IV
Sbjct:  398 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDA---FRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 540          

HSP 2 Score: 52.373 bits (124), Expect = 9.677e-7
Identity = 41/132 (31.06%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  147 ALINSIWTTLKHKSSQN---DFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAI------SLNINTS-KDRLINRKISKMIVKCPIESCSFKDQLMNIEN-HMKICYSESV 509
            +L +S+ +TL   S +      +P + C  CK +LR  +   CG R+C  C  +  +     C    E CRA+ I       LNI  +  D    R+I  +  KCP E CS+   L + EN H   C  E V
Sbjct:   31 SLPSSLDSTLPGISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPC----EACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERV 158          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.118e-10
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ K + A AG+   + S  F TS  GY+MCL++  +   +G    + L   +++G  D  L WPF   +T  L++    E        +R  +     ++P S+     GC     +  + + + + R+D  +I  IV
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.118e-10
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ K + A AG+   + S  F TS  GY+MCL++  +   +G    + L   +++G  D  L WPF   +T  L++    E        +R  +     ++P S+     GC     +  + + + + R+D  +I  IV
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 70.0922 bits (170), Expect = 2.046e-12
Identity = 41/148 (27.70%), Postives = 74/148 (50.00%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYT-DEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW++     K+  A  G+   + S  F T+  GY++CL++  +   +G    + L   ++KG++D  L WPFK+ +TF L++    D V+ +    +R  V     ++P ++     GC +      LN  K  + RE+  YI CI+
Sbjct:  232 FLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFDA----FRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCII 375          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 60.077 bits (144), Expect = 5.959e-9
Identity = 45/175 (25.71%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  921 KTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK---WDREDRFYINCIV 1436
            K  M   +E F  +E T    K I     W++  +  K R A  G+   I S+ F TS  GY++C +   +   SG    + L   ++KG+FD+ L+WPFK  +T  L++    + + +    +R        ++P S      GC        L + K   + ++D  +I  +V
Sbjct:  313 KMQMTSNEERFRLVEGTSYNGKLI-----WKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDV--FRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 480          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 60.077 bits (144), Expect = 6.068e-9
Identity = 45/175 (25.71%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  921 KTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK---WDREDRFYINCIV 1436
            K  M   +E F  +E T    K I     W++  +  K R A  G+   I S+ F TS  GY++C +   +   SG    + L   ++KG+FD+ L+WPFK  +T  L++    + + +    +R        ++P S      GC        L + K   + ++D  +I  +V
Sbjct:  364 KMQMTSNEERFRLVEGTSYNGKLI-----WKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDV--FRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 531          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 60.077 bits (144), Expect = 6.424e-9
Identity = 31/144 (21.53%), Postives = 65/144 (45.14%), Query Frame = 3
Query: 1005 LWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            +W++  +  + + A  GK   + S+ F T   GY+MC ++  +    G    + L   +++G++D  L WPFK  ++  L++      +      ++        +KPT       GC +   + +L +  + ++D  +I  IV
Sbjct:  387 IWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 528          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 59.6918 bits (143), Expect = 7.365e-9
Identity = 31/144 (21.53%), Postives = 65/144 (45.14%), Query Frame = 3
Query: 1005 LWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            +W++  +  + + A  GK   + S+ F T   GY+MC ++  +    G    + L   +++G++D  L WPFK  ++  L++      +      ++        +KPT       GC +   + +L +  + ++D  +I  IV
Sbjct:  412 IWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 553          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 65.4698 bits (158), Expect = 7.805e-11
Identity = 40/146 (27.40%), Postives = 66/146 (45.21%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F  K + A AG+   I S  F TS  GY+MCL++  +   +G    + L   ++KG  D  L WPF   +T  L++    E        +R  V     ++P S+     GC     V  +   + + R+D  +I  IV
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDA---FRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 63.929 bits (154), Expect = 2.868e-10
Identity = 40/146 (27.40%), Postives = 66/146 (45.21%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F  K + A AG+   I S  F TS  GY+MCL++  +   +G    + L   ++KG  D  L WPF   +T  L++    E        +R  V     ++P S+     GC     V  +   + + R+D  +I  IV
Sbjct:  361 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDA---FRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 61.2326 bits (147), Expect = 1.266e-9
Identity = 35/147 (23.81%), Postives = 69/147 (46.94%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW++     +   +  G+   + S  F T+  GY++CL+L  +   SG +  + L + +++G++D  L WPF+  +TF L++    E        +R  +     ++P S      GC +      L   K  + ++D  ++ CIV
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA---FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIV 405          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 61.2326 bits (147), Expect = 1.266e-9
Identity = 35/147 (23.81%), Postives = 69/147 (46.94%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW++     +   +  G+   + S  F T+  GY++CL+L  +   SG +  + L + +++G++D  L WPF+  +TF L++    E        +R  +     ++P S      GC +      L   K  + ++D  ++ CIV
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA---FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIV 405          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 61.2326 bits (147), Expect = 1.266e-9
Identity = 35/147 (23.81%), Postives = 69/147 (46.94%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW++     +   +  G+   + S  F T+  GY++CL+L  +   SG +  + L + +++G++D  L WPF+  +TF L++    E        +R  +     ++P S      GC +      L   K  + ++D  ++ CIV
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA---FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIV 405          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.879e-9
Identity = 40/146 (27.40%), Postives = 66/146 (45.21%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F  K + A AG+   I S  F TS  GY+MCL++  +   +G    + L   ++KG  D  L WPF   +T  L++    E        +R  V     ++P S+     GC     V  +   + + R+D  +I  IV
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDA---FRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 1.953e-9
Identity = 72/287 (25.09%), Postives = 123/287 (42.86%), Query Frame = 3
Query:  429 CPIE--SCSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMW--HLNNN-----QNQIFIQMKEINEKLLKMTNLMTFESTAKWN---FEESFEHLKLCPVEADGKSAY-NIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELIN 1250
            CP +   C+  D+  N++ H      E +       +N QL  Q   L        KSL + ++ +++    L + I KL  EKEF + A  F K       +Q++  H++ +     Q    +QM    +    +  LM    T K      E + + L +   E +    + NI K  +   +E F  +E T    K      +W+V  +  K R A  G    I S++F TS  GY++C +   +   SG    + L   +++G+FD+ L WPF+  +T  L++
Sbjct:  222 CPFKHYGCAVTDKRRNLQQHEHSALREHMRLVL--EKNVQLEEQISDL-------HKSLEQKESKIQQ----LAETIKKL--EKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGK-----LIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLD 488          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 8.351e-9
Identity = 32/144 (22.22%), Postives = 66/144 (45.83%), Query Frame = 3
Query: 1005 LWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            +W++  +  + + A  GK   + S+ F T   GY+MC ++  +    G    + L   +++G++D  L WPFK  +T  L++  +   +      ++        +KPT       GC +   + +L +  + ++D  +I  IV
Sbjct:  419 IWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 560          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 8.858e-9
Identity = 35/147 (23.81%), Postives = 69/147 (46.94%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW++     +   +  G+   + S  F T+  GY++CL+L  +   SG +  + L + +++G++D  L WPF+  +TF L++    E        +R  +     ++P S      GC +      L   K  + ++D  ++ CIV
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA---FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIV 405          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 1.161e-8
Identity = 39/146 (26.71%), Postives = 66/146 (45.21%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F  K + A AG+   I S  F TS  GY+MCL++  +   +G    + L   ++KG  D  L WPF   +T  L++    E        +R  V     ++P ++     GC     V  +   + + R+D  +I  IV
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDA---FRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 9.528e-24
Identity = 96/391 (24.55%), Postives = 181/391 (46.29%), Query Frame = 3
Query:  210 DFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVT--WFYPGSENTQLVR--QGDHLLQDNVPHSKSLLEFDNDVKEEL----RALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTF-ESTAK------WNFEESFEHLKLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKK--------------DICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYR 1295
            D +CI+C  L+R+A    CGC YCY CI  Y+++   YCPG   EC+   ++L  +  ++  ++ +IS+++VKCP   C++  +L+ ++ H+  C  ESV       G E   L++     HL    + H++ ++ F N++K E+       K++I  L   KE  R   +   E+    +  +  L N  N I +  ++I E   +M  L+T  ES  K        F +  E +K            N  K L K+     +NI+    +++              ++ + ++W +++++ K R        ++ S++F +  + Y+ CL L    Y  G    ++    ++KG+ D+ L WP +  +T  +I    D + T +T  ++
Sbjct:   28 DLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHL---KEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKKRRTV-----TDVYSDSFQS--HNYKFCLNL----YIYGDNLGLW--CVIMKGEKDDFLEWPMRRTVTLSIIEQ--DSLKTHKTTVFQ 400          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.099e-22
Identity = 56/150 (37.33%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  207 PDFI-CIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICY--SESVTWFYPGSENTQLVRQG--DHLLQDNVPHSKSLLEFDNDVKEELRAL 641
            PD + C +CK LL NA    CGCR+C +CI  YV+R + YCPG T EC+ + +++  N   D  +NRKI+KM VKCP E+C    +L++IE H+++C   S++  +F  G    ++V Q   +HL      HSK +++  ++++ +   L
Sbjct:   22 PDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGL 171          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A226PQ48 (TNF receptor-associated factor OS=Colinus virginianus OX=9014 GN=H355_007902 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.190e-13
Identity = 87/384 (22.66%), Postives = 159/384 (41.41%), Query Frame = 3
Query:  198 DFDPD----FICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVTWFYPGSENT-QLVRQGDHLLQD------NVPHSKSLLEFDNDVKEELRALKQNI-----HKLLIEKEFSRNAFSFYKE-------RIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKW-NFEESFEHLKLCPVEADGK-----SAYNIEKTLMKDADEYFVNIE--CTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCL--LKGKFDNELIWPFKYDITFELIN 1250
            +FDP     + C IC   LR A   PCG R+C  CI + +      CP   E      I L      D    R+I  + VKCP + C  K +L ++E H+  C  E  T   P  + T Q     +H+ Q+        P+  + + +++    +      N+     + +LI ++  RN  + + +       R+ A  +Q   +       FI        L    +   +    +  NF+E+ + L+   V  D +     +    + T M +      N+E   T  + +     Y+W+++ F+   +A    +   + S  F T   GY++CL+L   +  +  R   F+SL +  ++G++D+ L WPF+  I   +++
Sbjct:   56 EFDPPLESKYECPICLMALREAVQTPCGHRFCKGCIVKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCCMKMELRHLEEHLLHC--EFTTVECPQCQGTFQKNHLKEHVTQECPRRQVCCPNCATTMAYEDKELHDQTCPLANVFCEYCNTMLIRQQMQRNELARHMQEFTQVHMRMMAQSIQSISVTATNPVPFINGLPFEPALFSHVSRAPYNCNPEVENFKETIQQLEGRLVRQDHQIRELIAKMETQNTHMAELKRTIRNLEGKITEMEAQQCNGIYIWKIENFSGLQKAQEEERPVVMHSPGFYTGKPGYKLCLRLHIQL-PNAQRCANFISLFVHTMQGEYDSHLPWPFQGTIRLSILD 430          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A3M7SUK3 (TNF receptor-associated factor 2 isoform X2 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_003303 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.512e-12
Identity = 108/473 (22.83%), Postives = 183/473 (38.69%), Query Frame = 3
Query:  186 SSQNDFDP--------DFICIICKTLLRNAY-CGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTS-KDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICY------SESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFD-------------NDVKEELRALKQNIHKLL---IEKEFSR---------------------NAFSFYKERIDA-NKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLG--CFMIDVEDILNDSKWDREDRFYINCIV 1436
            S+QN + P         + C  C  ++ NA+    CGC+YC  C+++ +       PG    C+   I         DR +  +IS +I+ C    CS+  +L    +H KI +      S  +  F    EN Q +     L   N   +K L+E D              D +E L A +    KL+   IEKE  R                     +      E  DA N V +  LN+  + +F  +  +   L K   L            +     K+  +  D      + +  +   +E  VN+E     K +     LW+++    + + A +G+     S  F TS +GY+MC ++  +   +G    + L   +L+G+ D  L WPFK  +TF LI+  T E   +    +R         +PTS+     G   F    + + +D ++ +++  +I  IV
Sbjct:   10 STQNGYPPFDSSKIDLKYKCPQCSKIIVNAHQADDCGCQYCLNCLAQILV------PG--HVCKNCGIKFQSEQKFPDRRLQNEISNLIINCSFTDCSWSGKLREYTHHYKIHFEMENKCSNCLLKF----ENRQELEMHLDLKTGNC--AKQLIECDFKKVCPFKTPLLRQDYQEHLNAYQHEHLKLVYEYIEKELKRLREFEEVGKHFVDNRTRHGVGSGGDDVSEMSDAQNSVSLGSLNSKMDMMFNNLNSLISDLTKTNRLHDKLKQENVVLRQGLTDYKI--LVQDLHKTLALAQVSLLTLEERLVNLE-----KTNYDGTLLWKINNVQERMQEAKSGRQISFYSPPFYTSRSGYKMCGRVYLNGDGNGRNSHLSLFFVILRGENDALLRWPFKQKVTFILIDQSTTESRENLIDAFRPDPNSSSFRRPTSDMNIASGLPLFCPLGKLLSSDHEYIKDNTLFIKIIV 461          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A3Q0K1I7 (TNF receptor-associated factor 3-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100179623 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.599e-12
Identity = 69/284 (24.30%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  600 LEFDNDVKEELRALKQNIHKL-LIEKEFSRNAFSFYKERID---ANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEESFEHL-KLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            L+  NDV  E+R L+  +  +  +  + +  + +  KE  D   ANK     L     +I  ++ +I EK  ++      EST+    + + E+L ++          Y++    + D D+ F  IE T           +W++  F+ + R A +G+   + S+ F TS  GY+MC ++  +    G    + L   ++KG++D  L WPF+  +T  L++   D  + S T  +R        +KPTS+     GC +    +++ DS + +ED  ++   V
Sbjct:   36 LKNSNDVSPEIRKLEVRLKAIQRMTAQQTDRSLALKKEVGDNDAANKRANTDLTQKVEEIAREIAQIKEKQNELER--NIESTSGSREQMAPENLSQMVDAFERQLGMYDVR---IADMDQRFQVIETT-----SYSGVVIWKIRDFSRRKREAVSGRTLSLYSQPFYTSRYGYKMCARVYLNGDGMGKGTHMSLFFVVMKGEYDALLPWPFRQKVTLMLLDQGMDRRHLSDT--FRPDPTSSSFKKPTSDMNIASGCPLFVAHNVIEDSSYVKEDTIFLRIHV 307          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 65.855 bits (159), Expect = 5.679e-11
Identity = 37/146 (25.34%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ + + A AG+   + S  F +S  GY+MCL+L  +   +G    + L   +++GK+D  L WPF   +T  L++    E        +R  +     ++P S      GC     +  +   S + R+D  +I  IV
Sbjct:  384 FVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 61.2326 bits (147), Expect = 1.430e-9
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ K + A AG+   + S  F TS  GY+MCL++  +   +G    + L   +++G  D  L WPF   +T  L++    E        +R  +     ++P S+     GC     +  + + + + R+D  +I  IV
Sbjct:  312 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 454          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 61.2326 bits (147), Expect = 1.469e-9
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ K + A AG+   + S  F TS  GY+MCL++  +   +G    + L   +++G  D  L WPF   +T  L++    E        +R  +     ++P S+     GC     +  + + + + R+D  +I  IV
Sbjct:  425 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 567          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 58.5362 bits (140), Expect = 1.127e-8
Identity = 39/147 (26.53%), Postives = 64/147 (43.54%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW +   + K + A  G+     S  F TS  G+++C++L       G    I L   ++KG +D  L WPFK  +TF LI+    E        +R  +     ++P S      GC +      L   K  + ++D  +I C+V
Sbjct:  371 FLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDA---FRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVV 514          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 58.5362 bits (140), Expect = 1.173e-8
Identity = 39/147 (26.53%), Postives = 64/147 (43.54%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSK--WDREDRFYINCIV 1436
            +LW +   + K + A  G+     S  F TS  G+++C++L       G    I L   ++KG +D  L WPFK  +TF LI+    E        +R  +     ++P S      GC +      L   K  + ++D  +I C+V
Sbjct:  394 FLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVD---AFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVV 537          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 5.223e-9
Identity = 32/144 (22.22%), Postives = 66/144 (45.83%), Query Frame = 3
Query: 1005 LWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            +W++  +  + + A +G+   + S+ F TS  GY+MC +   +    G    + L   +++G++D  L WPF+  +T  L++        S T  ++         +PTS+     GC +      L  + + ++D  +I  +V
Sbjct:  328 VWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDT--FKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.723e-7
Identity = 30/144 (20.83%), Postives = 63/144 (43.75%), Query Frame = 3
Query: 1005 LWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
            +W++  +  + + A +G+   + S+ F TS  GY+MC +   +    G    + L   +++G++D  L WPF+  +T  L++      + S T  +          +P  +     GC +      L  S +  +D  ++  +V
Sbjct:  271 VWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDT--FTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVV 412          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 77.7962 bits (190), Expect = 2.847e-15
Identity = 101/515 (19.61%), Postives = 183/515 (35.53%), Query Frame = 3
Query:  201 FDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEE-----------CRAQAISLNINTSKDRL-----------------------------INRKISKMIVKCPIESCSFKDQ----------LMNIENHMKICYSESVTWFYPGSEN----------TQLVRQGD---------------------HLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKL-LIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFI----------QMKEINEKL-LKMTNLMTFESTAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQ----------YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIV 1436
             DP + C +C   L++    PCG R+C  C+   + R    CP   EE           CR + + L       +L                                K++K  ++  +E C FK              ++E+H++ C    V   + G+E           T +  Q +                     H       H   LL      + E +A  +   KL  +EKE ++     Y++R +A  V   +L   Q ++ +          ++ E+ E++ L+       E   +    E+       P    G     +     +D +E+ + +      + D+ LQ          Y+W++D++  + +   +GK   I S  F     GY+ C ++  +    G    + L   L++G+FD  L WPF+  +TF+L++   D V+      +R        ++PTSN     GC +      L    + R+D  +I   V
Sbjct:   15 LDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEP-ILRGPSKCPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLL---TATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQR-EALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLD--QDRVHDIGDT-FRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKIAV 521          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 65.4698 bits (158), Expect = 2.230e-11
Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = 3
Query:  921 KTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLK--LRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPY 1256
            +T+MK  D    ++E      K    Q +W ++ +  K + A AG  + + S TF TS +GY++C    L  D    G    +F+S+  LKG FD  L WPF Y +TF L+N +
Sbjct:  287 ETIMKQVDSRVGDLE------KIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSV--LKGAFDALLKWPFHYRVTFFLLNQH 392          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 63.1586 bits (152), Expect = 1.196e-10
Identity = 33/90 (36.67%), Postives = 48/90 (53.33%), Query Frame = 3
Query:  999 QYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLK--LRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTD 1262
            Q +W ++ +  K + A AG    + S TF TS +GY++C    L  D    G    +F+S+  LKG FD  L WPF Y +TF L++   D
Sbjct:  303 QLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISV--LKGAFDALLKWPFDYRVTFVLLDQNDD 390          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 58.5362 bits (140), Expect = 3.793e-9
Identity = 105/479 (21.92%), Postives = 174/479 (36.33%), Query Frame = 3
Query:  210 DFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKY-CPGITEECRAQAI-----------SLNINTS------KDRLINRK-----ISKMIVKCPIESCSFKDQLMNIENHMKIC-----YSESVTWFYPGSENTQLVRQGD--------------------------HLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSR-------NAF-SFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFES-TAKWNFEESFEHLKLCPVE-ADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGR----EKPTSNKKFDLG--CFMIDVEDILNDSKWDREDRFYINCIV 1436
            + IC IC  ++       CG  YC  CI ++    +   CP   E+ +   I           SL +  +      K  L  ++      S   VKC +E C+ K   + +E H   C     + +     YP  +   +  + D                          H       H     E   D KE++  L + + K+  E +          NA    + E I  NK Q+  L+         + E  E+L  +   +   S T + N ++  +    C  +  DG   + I        D+Y          KK +      EV   N+ +    +     + S  F TS  GY+M LK   + Y  G    + LS+ ++KG++D  L WPF+  IT  LIN    E + S+T+        P +    E+P  N+    G  CF+  +E  LN   + ++D  +I  ++
Sbjct:   27 ELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTNTCGWRLLHCKPCNLSYPKKDEETVQHKDDCPLAFLPCRFSEIGCTFKGRESARDEHCESAVQTHLHIACETIRDNKEQISDLHKELDKVRQELQTKSCDHMKEVNAIREKHDEAIRDNKGQIEALSKEHGIASNTIHENKEQLDTLKKELGIASETIRKNRDQIAKLSTACKTQYTDGTFVWRI----CNYKDKY----------KKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLIN--QSEQWRSETVEIYPDDATPDKKHKFERPIENENVGCGYSCFISHME--LNSGDYIKDDVIFIEAVI 487          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 58.151 bits (139), Expect = 4.026e-9
Identity = 32/117 (27.35%), Postives = 63/117 (53.85%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYT----SQTLYYRNSVIHPGREKPTSNK 1340
            ++W++D F      + AG    I S  F TS+ GY+MCL++  +    G    + L + +++G +D  L WPF   IT  +++  +D++ +    S+TL  + +++    ++PTS +
Sbjct:  334 FIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILD-QSDQIDSRRPISETLVAKPNLL--AFQRPTSPR 447          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 61.6178 bits (148), Expect = 9.779e-10
Identity = 35/146 (23.97%), Postives = 67/146 (45.89%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ + + A +G+   + S  F +S  GY+MCL+L  +   +G    + L   +++ K+D  L WPF   +T  L++    E        +R  +     ++P S      GC     +  +   S + R+D  +I  IV
Sbjct:  369 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDA---FRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 61.6178 bits (148), Expect = 1.051e-9
Identity = 35/146 (23.97%), Postives = 67/146 (45.89%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F+ + + A +G+   + S  F +S  GY+MCL+L  +   +G    + L   +++ K+D  L WPF   +T  L++    E        +R  +     ++P S      GC     +  +   S + R+D  +I  IV
Sbjct:  376 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDA---FRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 60.077 bits (144), Expect = 4.043e-9
Identity = 37/146 (25.34%), Postives = 64/146 (43.84%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W +  F  K + A AG+   + S  F TS  GY+MCL++  +   +G    + L   +++G  D  L WPF   +T  L++    E        +R  V     ++P S      GC     +  +   + + R+D  +I  IV
Sbjct:  449 FIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIIDA---FRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIV 591          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 59.6918 bits (143), Expect = 4.794e-9
Identity = 35/146 (23.97%), Postives = 67/146 (45.89%), Query Frame = 3
Query: 1002 YLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGC-FMIDVEDILNDSKWDREDRFYINCIV 1436
            ++W++  F  K + A AG+   + S  F TS  GY+MCL++  +   +G    + L   +++G  D  L WPF   +T  L++    E        +R  +     ++P S+     GC     +  + + + + R++  +I  IV
Sbjct:  422 FIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIV 564          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 59.3066 bits (142), Expect = 5.954e-9
Identity = 34/147 (23.13%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  999 QYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYR----NSVIHPGREKPTSNKKFDLGCFM-IDVEDILNDSKWDREDRFYI 1424
            + +W++  F  +  A   G+H  +SS  F+T   GY+M +K   +    G    + L + L+ G FD  L WPFK  ++  +++         Q+  +R    N+  H    +  SN      CF+ +D  +   ++ + ++D  ++
Sbjct:  429 RLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLD--QSGARNHQSFNFRPDPTNTCFHQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFV 573          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000070267.1 (SMESG000070267.1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 426/435 (97.93%), Postives = 430/435 (98.85%), Query Frame = 3
Query:  144 MALINSIWTTLKHKSSQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIVFREK 1448
            MALINSIWTTLKHKSSQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRL NRKISKM+VKCPIESCSFKDQLMNIENHMKIC SESVTWFYPGS+NTQLVRQGDH  QD VPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAF+GKHKEISSETFNTSINGYQMCLK+RFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIVFREK
Sbjct:    1 MALINSIWTTLKHKSSQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLTNRKISKMVVKCPIESCSFKDQLMNIENHMKICCSESVTWFYPGSDNTQLVRQGDHFSQDIVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFSGKHKEISSETFNTSINGYQMCLKMRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIVFREK 435          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000014624.1 (SMESG000014624.1)

HSP 1 Score: 417.157 bits (1071), Expect = 2.578e-142
Identity = 214/444 (48.20%), Postives = 297/444 (66.89%), Query Frame = 3
Query:  144 MALINSIWTTLKHKSSQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWHLNNNQNQIFIQMKEINEKLLKMTNLMTFE------STAKWNFEESFEHLK---LCPVEADGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCFMIDVEDILNDSKWDREDRFYINCIVFREK 1448
            MA   SIW +LK  SSQ  FD + IC+ICKTLL+NAY GPCGCRYCYECIS Y    + YCPG   ECR++ I LN+NT+KD  INRKISKMIV+CP E+CSF D+L+N++NHMK+C                L    D ++ +    S+++    N +K EL+ LKQ ++K   EKEF  N  +F+K  IDAN++Q+W+L  NQN++  Q+KEIN+K+ ++   + F       +    NFE+S E L+   +   +  GK     E  L    +E+ VN E   P +K+IC+QYLW+ DQ NAK +   AGK KE  S+TF TS +GY++ LKL+F+VYSSGA+ P++ SLC++KGKFD+EL+WPF+YDITFELINP  D+V  SQT+Y+ NSV HPGR +P  +    LGCF++D++++LNDS+W +ED+F++NCI+   K
Sbjct:    1 MAEFKSIWPSLKCNSSQYRFDSEVICVICKTLLQNAYSGPCGCRYCYECISHYSNGPEIYCPGNLPECRSEIIILNLNTNKDTAINRKISKMIVRCPNETCSFSDELVNMDNHMKVC---------------NLGVTLDEMVNNTRLQSENI----NILKVELKELKQTMNKYQTEKEFWTNTLAFFKANIDANQMQIWNLQENQNRLCAQIKEINQKIPEIGVPVAFNIQIENMNQKYQNFEKSIEELRNYFIKQSDEVGKPK-PTEFLLNSLKNEFIVNPEPIKPNEKNICVQYLWKFDQINAKLKDTLAGKKKEFLSDTFQTSKDGYEIRLKLQFNVYSSGAKLPVYQSLCIMKGKFDHELLWPFEYDITFELINPCKDKVQKSQTIYFANSVPHPGRTRPIGSMNVGLGCFLMDLDEVLNDSEWKKEDKFFVNCIISTNK 424          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 188.348 bits (477), Expect = 8.275e-53
Identity = 134/454 (29.52%), Postives = 236/454 (51.98%), Query Frame = 3
Query:  144 MALINSIWTTLKHKS----SQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVT--WFYPG--SENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKE--RIDANKVQMWHLNNNQNQIFIQMKEINEKLL--KMTNLMTFES--TAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMK----DADEYF----VNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCF-MIDVEDILNDSKWDREDRFYINCIV 1436
            + + N+++ +  +KS    S+N+ + +FIC ICK LL  ++ GPCGCRYCY CI   V + +  CPG    C  + + L+ N   D+  + ++S + VKCP ESC ++ +L+ +E+H+++C  + +   +F  G    N +  +  DHL+ +N  H K L+ F ++++ E+  LK  + +L  E +  +      KE  ++  N  ++ H N  +  + I  + +N++L   KM + ++ +S    K   ++S++  K    + +     N E T+      DA +Y     +NIE +  K      ++LW +  F+   R A  G +  I SE+F +  NGY++C+ +  +  +      + + L +LKG FDN L WPFKY++T  + N  T  +  + TL Y +   H G  KPT N    +G + +I +ED+ NDS   R +  +I C V
Sbjct:  108 IPIANALYFSSLNKSFSFESENEINNEFICTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTEN-YEINHSNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNH--GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKV 558          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 188.348 bits (477), Expect = 8.787e-53
Identity = 134/454 (29.52%), Postives = 236/454 (51.98%), Query Frame = 3
Query:  144 MALINSIWTTLKHKS----SQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVT--WFYPG--SENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKE--RIDANKVQMWHLNNNQNQIFIQMKEINEKLL--KMTNLMTFES--TAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMK----DADEYF----VNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCF-MIDVEDILNDSKWDREDRFYINCIV 1436
            + + N+++ +  +KS    S+N+ + +FIC ICK LL  ++ GPCGCRYCY CI   V + +  CPG    C  + + L+ N   D+  + ++S + VKCP ESC ++ +L+ +E+H+++C  + +   +F  G    N +  +  DHL+ +N  H K L+ F ++++ E+  LK  + +L  E +  +      KE  ++  N  ++ H N  +  + I  + +N++L   KM + ++ +S    K   ++S++  K    + +     N E T+      DA +Y     +NIE +  K      ++LW +  F+   R A  G +  I SE+F +  NGY++C+ +  +  +      + + L +LKG FDN L WPFKY++T  + N  T  +  + TL Y +   H G  KPT N    +G + +I +ED+ NDS   R +  +I C V
Sbjct:  105 IPIANALYFSSLNKSFSFESENEINNEFICTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTEN-YEINHSNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNH--GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKV 555          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 188.348 bits (477), Expect = 1.101e-52
Identity = 131/435 (30.11%), Postives = 226/435 (51.95%), Query Frame = 3
Query:  189 SQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECISRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIESCSFKDQLMNIENHMKICYSESVT--WFYPG--SENTQLVRQGDHLLQDNVPHSKSLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKE--RIDANKVQMWHLNNNQNQIFIQMKEINEKLL--KMTNLMTFES--TAKWNFEESFEHLKLCPVEADGKSAYNIEKTLMK----DADEYF----VNIECTPPKKKDICLQYLWEVDQFNAKTRAAFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGKFDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKKFDLGCF-MIDVEDILNDSKWDREDRFYINCIV 1436
            S+N+ + +FIC ICK LL  ++ GPCGCRYCY CI   V + +  CPG    C  + + L+ N   D+  + ++S + VKCP ESC ++ +L+ +E+H+++C  + +   +F  G    N +  +  DHL+ +N  H K L+ F ++++ E+  LK  + +L  E +  +      KE  ++  N  ++ H N  +  + I  + +N++L   KM + ++ +S    K   ++S++  K    + +     N E T+      DA +Y     +NIE +  K      ++LW +  F+   R A  G +  I SE+F +  NGY++C+ +  +  +      + + L +LKG FDN L WPFKY++T  + N  T  +  + TL Y +   H G  KPT N    +G + +I +ED+ NDS   R +  +I C V
Sbjct:  136 SENEINNEFICTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTEN-YEINHSNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNH--GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKV 567          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF54.066e-1025.09TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.066e-1025.09TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.066e-1025.09TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF35.725e-1020.27TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF18.837e-1023.81TNF receptor associated factor 1 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-13.114e-636.05TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b9.437e-1226.71Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b9.437e-1226.71Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b9.571e-1226.71Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
BX901915.14.118e-1024.66pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.14.118e-1024.66pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspb62.046e-1227.70heat shock protein family B (small) member 6 [Sour... [more]
slc12a15.959e-925.71solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a16.068e-925.71solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh26.424e-921.53slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh27.365e-921.53slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf27.805e-1127.40TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf22.868e-1027.40TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf11.266e-923.81TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf11.266e-923.81TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf11.266e-923.81TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE1.879e-927.40TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN1.953e-925.09TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q13114|TRAF3_HUMAN8.351e-922.22TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P39428|TRAF1_MOUSE8.858e-923.81TNF receptor-associated factor 1 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.161e-826.71TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1019.528e-2424.55TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID85.099e-2237.33TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A226PQ481.190e-1322.66TNF receptor-associated factor OS=Colinus virginia... [more]
A0A3M7SUK33.512e-1222.83TNF receptor-associated factor 2 isoform X2 OS=Bra... [more]
A0A3Q0K1I75.599e-1224.30TNF receptor-associated factor 3-like isoform X2 O... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b5.679e-1125.34TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a1.430e-924.66TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a1.469e-924.66TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf11.127e-826.53TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf11.173e-826.53TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000074.15.223e-922.22pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.12.723e-720.83pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494642.847e-1519.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328492.230e-1134.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.196e-1036.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483943.793e-921.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487734.026e-927.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b9.779e-1023.97TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.051e-923.97TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8084.043e-925.34TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.24.794e-923.97TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000001369.25.954e-923.13TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070267.10.000e+097.93SMESG000070267.1[more]
SMESG000014624.12.578e-14248.20SMESG000014624.1[more]
SMESG000001662.18.275e-5329.52SMESG000001662.1[more]
SMESG000001662.18.787e-5329.52SMESG000001662.1[more]
SMESG000001662.11.101e-5230.11SMESG000001662.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002332 ID=SMED30002332|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1587bp
CTGCCCTTTATAAAACAAGACTAGAGAATAATTATCATTAAAATATGAAC
TTTGAAATTATTTTGTTTAAATTCATTAAGTTTTATTATTTAAATAAAAT
TTTTGAATTTAACTAATTTTCCAAAGCTACCAGATTTACTGATATGGCTC
TCATCAACAGCATATGGACGACTCTGAAACATAAATCTTCCCAAAACGAT
TTCGATCCTGATTTTATTTGTATAATTTGCAAAACGCTTTTGCGGAACGC
TTACTGTGGGCCTTGCGGATGCCGATATTGCTATGAATGTATATCTCGAT
ACGTAACCCGCACGGATAAGTATTGCCCGGGAATCACTGAGGAGTGCCGA
GCTCAGGCCATAAGCCTAAATATCAACACCAGTAAAGATAGGCTAATAAA
TCGAAAGATATCAAAAATGATTGTAAAATGTCCAATAGAAAGCTGCTCGT
TCAAGGATCAATTGATGAACATCGAAAACCACATGAAAATCTGCTACTCA
GAGTCTGTGACTTGGTTCTATCCGGGTAGCGAGAATACACAACTGGTTCG
TCAGGGCGATCATTTATTGCAGGATAATGTCCCTCATTCAAAATCGCTGT
TGGAATTCGACAACGATGTGAAAGAAGAACTTAGAGCATTAAAACAAAAT
ATTCATAAATTGTTGATTGAAAAAGAGTTTTCAAGAAATGCATTCTCGTT
TTACAAAGAAAGAATTGATGCCAATAAGGTTCAAATGTGGCATCTAAATA
ATAATCAGAATCAGATCTTTATTCAAATGAAGGAAATTAATGAGAAACTA
TTAAAAATGACAAATCTAATGACTTTTGAATCAACTGCAAAATGGAACTT
TGAAGAATCATTTGAACATTTGAAACTTTGTCCAGTCGAAGCGGATGGAA
AATCAGCTTATAATATAGAAAAAACATTAATGAAAGATGCAGATGAATAT
TTTGTAAACATTGAATGTACTCCACCAAAAAAAAAAGACATTTGCCTCCA
ATATTTGTGGGAAGTAGATCAGTTCAATGCAAAAACAAGAGCGGCTTTTG
CTGGAAAACATAAAGAAATTTCAAGTGAAACCTTCAATACCAGTATAAAC
GGCTATCAGATGTGCTTGAAGTTGCGATTTGATGTCTATTCAAGCGGTGC
CAGATATCCTATTTTTCTATCTTTATGTTTACTGAAAGGAAAATTCGACA
ACGAATTGATTTGGCCGTTCAAATACGATATAACGTTTGAGCTTATTAAT
CCGTACACTGATGAAGTTTATACTAGCCAGACGCTTTATTACCGGAACTC
CGTCATTCATCCGGGCCGTGAAAAACCGACTAGTAACAAAAAGTTTGACC
TCGGATGTTTCATGATAGATGTCGAAGACATCTTAAATGATTCCAAATGG
GATAGAGAAGACAGATTTTATATCAACTGCATTGTTTTCCGTGAAAAGTG
ATAAAACTTTTGTTTGTTGATTTTTTTTACGAATGAAAACGTCCGAATAA
AATCAGCCTATCAAATATATTTAATTTTTTTTAATATTTATTCTTAAACA
AAACGATAAAATAAAAAGGAAAGCTCGTTTTTTATAT
back to top

protein sequence of SMED30002332-orf-1

>SMED30002332-orf-1 ID=SMED30002332-orf-1|Name=SMED30002332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=436bp
MALINSIWTTLKHKSSQNDFDPDFICIICKTLLRNAYCGPCGCRYCYECI
SRYVTRTDKYCPGITEECRAQAISLNINTSKDRLINRKISKMIVKCPIES
CSFKDQLMNIENHMKICYSESVTWFYPGSENTQLVRQGDHLLQDNVPHSK
SLLEFDNDVKEELRALKQNIHKLLIEKEFSRNAFSFYKERIDANKVQMWH
LNNNQNQIFIQMKEINEKLLKMTNLMTFESTAKWNFEESFEHLKLCPVEA
DGKSAYNIEKTLMKDADEYFVNIECTPPKKKDICLQYLWEVDQFNAKTRA
AFAGKHKEISSETFNTSINGYQMCLKLRFDVYSSGARYPIFLSLCLLKGK
FDNELIWPFKYDITFELINPYTDEVYTSQTLYYRNSVIHPGREKPTSNKK
FDLGCFMIDVEDILNDSKWDREDRFYINCIVFREK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000208testis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 156..183
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 19..431
NoneNo IPR availableCDDcd16449RING-HCcoord: 26..62
e-value: 3.31346E-7
score: 44.3805
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 19..63
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 255..435
e-value: 2.8E-22
score: 81.0
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 286..432
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 6..124
e-value: 4.9E-14
score: 54.4
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 19..431
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 26..62
score: 9.406