Peptidyl-prolyl cis-trans isomerase

Overview
NamePeptidyl-prolyl cis-trans isomerase
Smed IDSMED30002330
Length (bp)797
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-prolyl cis-trans isomerase (SMED30002330) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30002330) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002330

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30002330SMESG000079924.1 dd_Smed_v4_1242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002330SMESG000079924.1 dd_Smed_v4_1242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002330SMESG000079924.1 dd_Smed_v4_1242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig52766newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig43824newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig43824uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig15985newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig15985uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 SMESG000079920.1 Contig13767newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 SMESG000079920.1 Contig13767uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig4730newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000079924.1 Contig4730uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000031764.1 Contig4730newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002330SMESG000031764.1 Contig4730uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30002330SMESG000079924.1 dd_Smed_v6_1242_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002330SMESG000079924.1 OX_Smed_1.0.22102ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIC (peptidylprolyl isomerase C [Source:HGNC Symbol;Acc:HGNC:9256])

HSP 1 Score: 160.229 bits (404), Expect = 3.200e-48
Identity = 94/217 (43.32%), Postives = 122/217 (56.22%), Query Frame = 2
Query:   50 NMLFVLGLVLINFAFIYSEENEIYK-----ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
             +L  L L +   A ++S   E ++     +T   +F++ I D          +  IGLFG + P TV NF +L  G     K   Y+G+K HRV+KDF+IQ GD+  GDGTGG+SIYG  F DENF L H   GWVSMAN GPD+N SQFFI LTK  WLDGKHVVFGKVI G   V +I E         P     I + G   ++ P+ ++ +D
Sbjct:    6 RLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGD------KDVGRIVIGLFGKVVPKTVENFVALATG----EKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSI-ELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIAD 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIB (peptidylprolyl isomerase B [Source:HGNC Symbol;Acc:HGNC:9255])

HSP 1 Score: 157.918 bits (398), Expect = 3.828e-47
Identity = 91/219 (41.55%), Postives = 118/219 (53.88%), Query Frame = 2
Query:   44 NKNMLFVLGLVLINFAFIY---------SEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
             +NM  +L   LI  +  +          E+ +  K+T   +F++ I      G     +   GLFG   P TV NF +L  G     K   Y+ +K HRV+KDF+IQ GD   GDGTGG SIYG +F DENF L H  PGWVSMAN G D+N SQFFI   K  WLDGKHVVFGKV++G   V  + E+        P   + I DCG   +E+P+ +
Sbjct:    6 ERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRI------GDEDVGRVIFGLFGKTVPKTVDNFVALATG----EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKV-ESTKTDSRDKPLKDVIIADCGKIEVEKPFAI 213          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIH (peptidylprolyl isomerase H [Source:HGNC Symbol;Acc:HGNC:14651])

HSP 1 Score: 140.198 bits (352), Expect = 7.601e-41
Identity = 75/174 (43.10%), Postives = 99/174 (56.90%), Query Frame = 2
Query:  125 ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            +  V +F+++I      G     +  I LF D+ P T  NF     G ++     + Y+G+  HRV+KDF+IQ GD +NGDGTG  SIY   F DENF L H  PG +SMAN GP +N  QFFI  +K  WLDGKHVVFGK+I G   +  I E    G  + P + + I+ CG
Sbjct:    9 VNPVVFFDVSI------GGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKI-ENVPTGPNNKPKLPVVISQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIA (peptidylprolyl isomerase A [Source:HGNC Symbol;Acc:HGNC:9253])

HSP 1 Score: 135.961 bits (341), Expect = 2.691e-39
Identity = 73/151 (48.34%), Postives = 90/151 (59.60%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTS-TPAVTIEITDCG 643
            + S  LF D  P T  NF +L+ G     K   Y+G+  HR++  F+ Q GD    +GTGG SIYG KF+DENFIL H  PG +SMAN GP++N SQFFI   K  WLDGKHVVFGKV +G N V  +     FG  +   +  I I DCG
Sbjct:   19 RVSFELFADKVPKTAENFRALSTG----EKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAM---ERFGSRNGKTSKKITIADCG 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIE (peptidylprolyl isomerase E [Source:HGNC Symbol;Acc:HGNC:9258])

HSP 1 Score: 135.576 bits (340), Expect = 3.876e-38
Identity = 71/150 (47.33%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            +  + L  D+ PMT  NF  L     T  K   ++G+  HR++  F+ Q GD  N +GTGG SIYG KFDDENFIL H  PG +SMAN GP++N SQFF+   K  WLDGKHVVFG+V +G + +  I EA    D   P   + I DCG
Sbjct:  104 RIQMLLRSDVVPMTAENFRCLC----THEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQI-EAQGSKD-GKPKQKVIIADCG 247          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-6 (Peptidyl-prolyl cis-trans isomerase 6 [Source:UniProtKB/Swiss-Prot;Acc:P52014])

HSP 1 Score: 160.614 bits (405), Expect = 8.620e-49
Identity = 89/213 (41.78%), Postives = 124/213 (58.22%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLN 691
            + FVL ++ +      S E    ++T   +F++ I      G     K  IGLFG++ P TV NF  L +    +++   Y G+K HRV+++F+IQ GD   GDGTGG SIYG +F+DENF L H  PGW+SMAN G D+N SQFFI   K  WLDGKHVVFGK+++G + V  I EA   G    P   + I + G   +E P+T+  + +N
Sbjct:    6 LFFVLAILAL------SAEARGPRVTDKVFFDMEI------GGRPVGKIVIGLFGEVVPKTVKNFVELAQ----RAEGEGYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDENFKLQHYGPGWLSMANAGEDTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREI-EATPKGAGDRPIEDVVIANAGHIPVENPFTVARAGVN 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-6 (Peptidyl-prolyl cis-trans isomerase 6 [Source:UniProtKB/Swiss-Prot;Acc:P52014])

HSP 1 Score: 160.614 bits (405), Expect = 8.620e-49
Identity = 89/213 (41.78%), Postives = 124/213 (58.22%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLN 691
            + FVL ++ +      S E    ++T   +F++ I      G     K  IGLFG++ P TV NF  L +    +++   Y G+K HRV+++F+IQ GD   GDGTGG SIYG +F+DENF L H  PGW+SMAN G D+N SQFFI   K  WLDGKHVVFGK+++G + V  I EA   G    P   + I + G   +E P+T+  + +N
Sbjct:    6 LFFVLAILAL------SAEARGPRVTDKVFFDMEI------GGRPVGKIVIGLFGEVVPKTVKNFVELAQ----RAEGEGYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDENFKLQHYGPGWLSMANAGEDTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREI-EATPKGAGDRPIEDVVIANAGHIPVENPFTVARAGVN 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-7 (Peptidyl-prolyl cis-trans isomerase 7 [Source:UniProtKB/Swiss-Prot;Acc:P52015])

HSP 1 Score: 144.821 bits (364), Expect = 4.693e-43
Identity = 81/172 (47.09%), Postives = 107/172 (62.21%), Query Frame = 2
Query:  140 WFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYK---TKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTS-TPAVTIEITDCG 643
            +F+ITI     AGK    +  + L+ D+ P T  NF +L  G K      K LH++G+K HR++ +F+IQ GD   G+GTGG SIYG KF DENF   H  PG +SMAN GP++N SQFF+   K  WLDGKHVVFG+V++G + VS + E +  G +S TP     I DCG
Sbjct:    7 FFDITI-----AGKP-TGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKV-EGN--GSSSGTPKSECLIADCG 169          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-7 (Peptidyl-prolyl cis-trans isomerase 7 [Source:UniProtKB/Swiss-Prot;Acc:P52015])

HSP 1 Score: 144.821 bits (364), Expect = 4.693e-43
Identity = 81/172 (47.09%), Postives = 107/172 (62.21%), Query Frame = 2
Query:  140 WFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYK---TKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTS-TPAVTIEITDCG 643
            +F+ITI     AGK    +  + L+ D+ P T  NF +L  G K      K LH++G+K HR++ +F+IQ GD   G+GTGG SIYG KF DENF   H  PG +SMAN GP++N SQFF+   K  WLDGKHVVFG+V++G + VS + E +  G +S TP     I DCG
Sbjct:    7 FFDITI-----AGKP-TGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKV-EGN--GSSSGTPKSECLIADCG 169          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-5 (Peptidyl-prolyl cis-trans isomerase 5 [Source:UniProtKB/Swiss-Prot;Acc:P52013])

HSP 1 Score: 143.665 bits (361), Expect = 3.546e-42
Identity = 82/186 (44.09%), Postives = 105/186 (56.45%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVF-GDTSTPAVTIEITDCGIETLERPYTMK 676
            K+T   +F++ I      G     +  IGLFG   P T  NF  L K    K K   Y G+K HRV+ DF+IQ GD   GDGTGG SIYG KF DENF L H   GW+SMAN G D+N SQFFI   K  WLDG+HVVFGK+++G + V  I +     GD   P   + I   G   ++ P++++
Sbjct:   26 KVTDKVYFDMEI------GGKPIGRIVIGLFGKTVPKTATNFIELAK----KPKGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGD--RPKQDVIIAASGHIAVDTPFSVE 199          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0071933)

HSP 1 Score: 152.14 bits (383), Expect = 2.234e-45
Identity = 81/188 (43.09%), Postives = 107/188 (56.91%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
            K+T+  +F+ITI      G     +  IGLFG   P TV NF  L      K +   Y+G+K HR++KDF+IQ GD   GDGTGG SIYG +F+DENF L H   GW+SMAN G D+N SQFFI   +  WLDG+HVVFGK++ G N V  I E         P   + I + G   +   +++  +D
Sbjct:   26 KVTEKVFFDITI------GGEPAGRIEIGLFGKTVPKTVENFKELA----LKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQI-ENSATDARDRPVKDVVIANSGTLPVSEAFSVAKAD 202          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0345504)

HSP 1 Score: 152.14 bits (383), Expect = 2.234e-45
Identity = 81/188 (43.09%), Postives = 107/188 (56.91%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
            K+T+  +F+ITI      G     +  IGLFG   P TV NF  L      K +   Y+G+K HR++KDF+IQ GD   GDGTGG SIYG +F+DENF L H   GW+SMAN G D+N SQFFI   +  WLDG+HVVFGK++ G N V  I E         P   + I + G   +   +++  +D
Sbjct:   26 KVTEKVFFDITI------GGEPAGRIEIGLFGKTVPKTVENFKELA----LKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQI-ENSATDARDRPVKDVVIANSGTLPVSEAFSVAKAD 202          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG17266 (gene:FBgn0033089 transcript:FBtr0307502)

HSP 1 Score: 131.724 bits (330), Expect = 9.992e-38
Identity = 68/146 (46.58%), Postives = 86/146 (58.90%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            LF D  P T  NF     G Y+     + Y+G   HRV+KDF+IQ GD + GDGTG  SIYG  F DENF L H +PG +SMAN G ++N  QFFI   K  +LDGKHVVFG+V+ G   +  I E    G  + P + + I+ CG
Sbjct:   37 LFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKI-ENVPTGPNNKPKLPVTISQCG 181          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG17266 (gene:FBgn0033089 transcript:FBtr0086144)

HSP 1 Score: 131.724 bits (330), Expect = 9.992e-38
Identity = 68/146 (46.58%), Postives = 86/146 (58.90%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            LF D  P T  NF     G Y+     + Y+G   HRV+KDF+IQ GD + GDGTG  SIYG  F DENF L H +PG +SMAN G ++N  QFFI   K  +LDGKHVVFG+V+ G   +  I E    G  + P + + I+ CG
Sbjct:   37 LFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKI-ENVPTGPNNKPKLPVTISQCG 181          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: ninaA (gene:FBgn0002936 transcript:FBtr0078023)

HSP 1 Score: 131.339 bits (329), Expect = 6.462e-37
Identity = 73/172 (42.44%), Postives = 103/172 (59.88%), Query Frame = 2
Query:  143 FEITIKDYYGAGKNYQD--KFSIGLFGDLAPMTVLNFASLT-KGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILS--HRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            F +T + Y     N +   + + GLFG LAP TV NF  +  +G    S    Y G++ HRVV  F++Q GD++NGDGTG +SIYG  F DE+  L+  H  PG++ MAN GPD+N  QF++    A+WLDGKH VFGKV++G +T+  I +     D   P   + I++CG
Sbjct:   23 FTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTS----YVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTD-DFPVEPVVISNCG 189          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppic (peptidylprolyl isomerase C [Source:ZFIN;Acc:ZDB-GENE-170217-1])

HSP 1 Score: 160.999 bits (406), Expect = 2.985e-48
Identity = 89/185 (48.11%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMK 676
            ++T   +F+IT+      G +   +  IGLFG++AP+TV NF SL  G     K   Y+G+K HRV+KDF+IQ GD   GDGTGG SIYG  F DENF L H   GWVSMAN GPD+N SQFFI L +A WLDGKHVVFGKV++G   V TI E     + + P     I + G   ++ P  ++
Sbjct:   68 QVTDKVFFDITV------GGHEVGRIVIGLFGEVAPLTVQNFVSLATG----EKGYGYKGSKFHRVIKDFMIQGGDFTAGDGTGGKSIYGNMFADENFRLRHLGAGWVSMANAGPDTNGSQFFITLARAPWLDGKHVVFGKVLEGMAVVHTI-ELQDTNERNLPYTECVIVNSGKIKVKEPLLVE 241          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppib (peptidylprolyl isomerase B (cyclophilin B) [Source:ZFIN;Acc:ZDB-GENE-040426-1955])

HSP 1 Score: 156.377 bits (394), Expect = 5.853e-47
Identity = 90/216 (41.67%), Postives = 119/216 (55.09%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIY---------SEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
            M F++ + LI  + ++          E+ +  K+T   +F+I I D          +  IGLFG   P T  NF  L  G     K   Y+G+K HRV+KDF+IQ GD   GDGTGG SIYG +F DENF L H  PGW+SMAN G D+N SQFFI   +  WLDGKHVVFGK+++G + V  I EA        P   + I D G   +E+P+ +
Sbjct:    1 MKFLVAVTLIVGSVVFLLFPSETEADEKKKGPKVTAKVYFDIKIGDEDAG------RIVIGLFGKTVPKTTENFLQLATG----EKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKILEGMDVVRKI-EATKTDGRDKPLKDVSIHDSGKIDVEKPFAV 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppih (peptidylprolyl isomerase H (cyclophilin H) [Source:ZFIN;Acc:ZDB-GENE-040625-127])

HSP 1 Score: 139.428 bits (350), Expect = 9.531e-41
Identity = 75/171 (43.86%), Postives = 97/171 (56.73%), Query Frame = 2
Query:  134 VAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            + +F+++I      G     +  I LF D+ P T  NF     G +K     + Y+G   HRV+KDF+IQ GD +NGDGTG  SIY   F DENF + H  PG +SMAN GP +N  QFFI  TK  WLDGKHVVFGKV+ G   +  I E    G  + P + I ++ CG
Sbjct:   12 IVFFDVSI------GGQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKI-ENVPTGPNNKPKLPIVVSQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppih (peptidylprolyl isomerase H (cyclophilin H) [Source:ZFIN;Acc:ZDB-GENE-040625-127])

HSP 1 Score: 139.428 bits (350), Expect = 9.531e-41
Identity = 75/171 (43.86%), Postives = 97/171 (56.73%), Query Frame = 2
Query:  134 VAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            + +F+++I      G     +  I LF D+ P T  NF     G +K     + Y+G   HRV+KDF+IQ GD +NGDGTG  SIY   F DENF + H  PG +SMAN GP +N  QFFI  TK  WLDGKHVVFGKV+ G   +  I E    G  + P + I ++ CG
Sbjct:   12 IVFFDVSI------GGQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKI-ENVPTGPNNKPKLPIVVSQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppifa (peptidylprolyl isomerase Fa [Source:ZFIN;Acc:ZDB-GENE-040912-52])

HSP 1 Score: 135.961 bits (341), Expect = 2.897e-39
Identity = 73/147 (49.66%), Postives = 92/147 (62.59%), Query Frame = 2
Query:  203 IGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            I LF D+ P TV NF +L  G         Y+G+  HR++ +F+ Q GD  N +GTGG SIYG KF+DENF L H   G +SMAN GP++N SQFFI   K  WLDGKHVVFG+V +G  TVS + E++   D  T    + ITDCG
Sbjct:   46 IELFADVVPKTVANFRALCTG----EHGFGYKGSVFHRIIPEFMCQGGDFTNHNGTGGKSIYGKKFNDENFKLKHTGAGILSMANSGPNTNGSQFFICTAKTEWLDGKHVVFGQVKEGMETVSLM-ESYGLHDGGT-VKKVAITDCG 186          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIC (peptidylprolyl isomerase C (cyclophilin C) [Source:NCBI gene;Acc:100494684])

HSP 1 Score: 157.918 bits (398), Expect = 2.685e-47
Identity = 82/164 (50.00%), Postives = 103/164 (62.80%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
            +  IGLFG + P TV NF +L  G     K   Y+G++ HRV+KDF+IQ GDV NGDGTGG SIYG  F DENF L H   GWVSMAN GPD+N SQFFI  T+  WL+GKHVVFGKV++G   V  I E     +   P     I + G+ T++ P+ ++  D
Sbjct:   47 RIVIGLFGKVVPKTVKNFVALATG----EKGYGYKGSRFHRVIKDFMIQGGDVTNGDGTGGKSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKHVVFGKVLEGMAVVHLI-ELQQTNERDQPLKDCVIVNSGVVTVKEPFVVEVDD 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: azin1 (antizyme inhibitor 1 [Source:Xenbase;Acc:XB-GENE-948396])

HSP 1 Score: 158.303 bits (399), Expect = 2.401e-46
Identity = 92/211 (43.60%), Postives = 116/211 (54.98%), Query Frame = 2
Query:   44 NKNMLFVLGLVLINFAFIY---------SEENEIYKITQVAWFEITIKDYYGAGKNYQD--KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
             +NM  ++   LI  + I+          E+ +  K+T   +F+I I D        +D  +  IGLFG   P TV NF +L  G     K   Y+G+K HRV+KDF+IQ GD   GDGTGG SIYG +F DENF L H  P WVSMAN G D+N SQFFI   K  WLDGKHVVFGK+++G + V  I      G    P   + I DCG
Sbjct:    6 ERNMKLLVAAALIAGSVIFLLFPGSSVADEKKKGPKVTHKVYFDIKIGD--------EDVGRVVIGLFGKTVPKTVENFVTLATG----EKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLRHYGPNWVSMANAGKDTNGSQFFITTVKTPWLDGKHVVFGKILEGKDVVEKIESTKTDG-RDKPLKDVVIADCG 203          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppih (peptidylprolyl isomerase H [Source:NCBI gene;Acc:394997])

HSP 1 Score: 136.732 bits (343), Expect = 1.705e-39
Identity = 74/171 (43.27%), Postives = 96/171 (56.14%), Query Frame = 2
Query:  134 VAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            + +F+I+I      G     +  + LF D+ P T  NF     G ++     + Y+G+  HRV+KDF+IQ GD +NGDGTG  SIY   F DENF   H  PG +SMAN GP +N  QFFI  +K  WLDGKHVVFGKVI G   +  I E    G  + P + + I  CG
Sbjct:   12 IVFFDISI------GGQEVGRMKVELFADIVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLDGKHVVFGKVIDGLLVMRKI-ENVPTGPNNKPKLPVVIAQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 138.272 bits (347), Expect = 2.281e-39
Identity = 73/145 (50.34%), Postives = 90/145 (62.07%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            L  D+ PMTV NF  L        K   Y+G+  HR++  F++Q GD  N +GTGG SIYG KFDDENFIL H  PG +SMAN G ++N SQFFI   K  WLDGKHVVFG+V++G + V  I EA   G    P   + I+DCG
Sbjct:   98 LRADIVPMTVENFRCLC----NHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQI-EAQG-GKDGKPKQKVIISDCG 236          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 139.043 bits (349), Expect = 4.029e-39
Identity = 73/145 (50.34%), Postives = 90/145 (62.07%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            L  D+ PMTV NF  L        K   Y+G+  HR++  F++Q GD  N +GTGG SIYG KFDDENFIL H  PG +SMAN G ++N SQFFI   K  WLDGKHVVFG+V++G + V  I EA   G    P   + I+DCG
Sbjct:  140 LRADIVPMTVENFRCLC----NHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQI-EAQG-GKDGKPKQKVIISDCG 278          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppib (peptidylprolyl isomerase B [Source:MGI Symbol;Acc:MGI:97750])

HSP 1 Score: 156.377 bits (394), Expect = 9.086e-47
Identity = 89/217 (41.01%), Postives = 120/217 (55.30%), Query Frame = 2
Query:   44 NKNMLFVLGLVLINFAF-------IYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
            N  +LF   L++ +  F       + +++ +  K+T   +F++ I      G     +   GLFG   P TV NF +L  G     K   Y+ +K HRV+KDF+IQ GD   GDGTGG SIYG +F DENF L H  PGWVSMAN G D+N SQFFI   K  WLDGKHVVFGKV++G + V  + E+        P   + I D G   +E+P+ +
Sbjct:    8 NMKVLFAAALIVGSVVFLLLPGPSVANDKKKGPKVTVKVYFDLQI------GDESVGRVVFGLFGKTVPKTVDNFVALATG----EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKV-ESTKTDSRDKPLKDVIIVDSGKIEVEKPFAI 213          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppic (peptidylprolyl isomerase C [Source:MGI Symbol;Acc:MGI:97751])

HSP 1 Score: 150.599 bits (379), Expect = 1.445e-44
Identity = 86/187 (45.99%), Postives = 107/187 (57.22%), Query Frame = 2
Query:  125 ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
            +T   +F++ I      G     +  IGLFG++ P TV NF +L  G     K   Y+G+  HRV+KDF+IQ GD    DGTGGMSIYG  F DENF L H   GWVSMAN GPD+N SQFFI LTK  WLDGKHVVFGKV+ G   V +I E         P     I + G   ++ P+ ++  D
Sbjct:   36 VTDKVFFDVRI------GDKDVGRIVIGLFGNVVPKTVENFVALATG----EKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSI-ELQATDGHDRPLTDCTIVNSGKIDVKTPFVVEVPD 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppih (peptidyl prolyl isomerase H [Source:MGI Symbol;Acc:MGI:106499])

HSP 1 Score: 140.198 bits (352), Expect = 5.218e-41
Identity = 75/174 (43.10%), Postives = 99/174 (56.90%), Query Frame = 2
Query:  125 ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            +  V +F+++I      G     +  I LF D+ P T  NF     G ++     + Y+G+  HRV+KDF+IQ GD +NGDGTG  SIY   F DENF L H  PG +SMAN GP +N  QFFI  +K  WLDGKHVVFGK+I G   +  I E    G  + P + + I+ CG
Sbjct:    9 VNPVVFFDVSI------GGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKI-ENVPTGPNNKPKLPVVISQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppih (peptidyl prolyl isomerase H [Source:MGI Symbol;Acc:MGI:106499])

HSP 1 Score: 140.198 bits (352), Expect = 5.218e-41
Identity = 75/174 (43.10%), Postives = 99/174 (56.90%), Query Frame = 2
Query:  125 ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            +  V +F+++I      G     +  I LF D+ P T  NF     G ++     + Y+G+  HRV+KDF+IQ GD +NGDGTG  SIY   F DENF L H  PG +SMAN GP +N  QFFI  +K  WLDGKHVVFGK+I G   +  I E    G  + P + + I+ CG
Sbjct:    9 VNPVVFFDVSI------GGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKI-ENVPTGPNNKPKLPVVISQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppih (peptidyl prolyl isomerase H [Source:MGI Symbol;Acc:MGI:106499])

HSP 1 Score: 140.198 bits (352), Expect = 5.218e-41
Identity = 75/174 (43.10%), Postives = 99/174 (56.90%), Query Frame = 2
Query:  125 ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            +  V +F+++I      G     +  I LF D+ P T  NF     G ++     + Y+G+  HRV+KDF+IQ GD +NGDGTG  SIY   F DENF L H  PG +SMAN GP +N  QFFI  +K  WLDGKHVVFGK+I G   +  I E    G  + P + + I+ CG
Sbjct:    9 VNPVVFFDVSI------GGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKI-ENVPTGPNNKPKLPVVISQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q26551|PPIB_SCHMA (Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma mansoni OX=6183 GN=CYP PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.635e-50
Identity = 95/204 (46.57%), Postives = 121/204 (59.31%), Query Frame = 2
Query:   77 LINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKS-KKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
            +I F  I SE N   K+T   +F+I +      GK    +  IGLFG   P TV NF  L+ G + K  +   Y+G+  HRV+K F+IQ GD  N DGTGG SIYG +F DENF L H   GW+SMAN GPD+N SQFFI   K  WLDGKHVVFGKV++G N V  I E+        P  +I+I  CG   +E P+++ +SD
Sbjct:   15 IICFGLIRSEANG-PKVTDKVFFDIEVD-----GKPLA-RIIIGLFGKTVPKTVENFKQLSIGTQLKDGRTASYKGSTFHRVIKSFMIQGGDFTNHDGTGGFSIYGDRFPDENFKLRHVGAGWLSMANAGPDTNGSQFFITTVKTSWLDGKHVVFGKVVEGMNIVRQI-ESETTDSRDRPVKSIKIASCGHIPVEIPFSVTNSD 210          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P80311|PPIB_BOVIN (Peptidyl-prolyl cis-trans isomerase B OS=Bos taurus OX=9913 GN=PPIB PE=1 SV=4)

HSP 1 Score: 164.851 bits (416), Expect = 3.696e-49
Identity = 94/217 (43.32%), Postives = 121/217 (55.76%), Query Frame = 2
Query:   44 NKNMLFVLGLVLINFAFIY-------SEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
            N  +LFV  LV+ +  F+         E+ +  K+T   +F++ I      G     +  IGLFG   P TV NF +L  G     K   Y+ +K HRV+KDF+IQ GD   GDGTGG SIYG +F DENF L H  PGWVSMAN G D+N SQFFI   K  WLDGKHVVFGKV++G + V  +      G    P   + I DCG   +E+P+ +
Sbjct:    8 NMKILFVAALVVGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRI------GDEDIGRVVIGLFGKTVPKTVDNFVALATG----EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVESTKTDG-RDKPLKDVTIADCGKIEVEKPFAI 213          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P24367|PPIB_CHICK (Peptidyl-prolyl cis-trans isomerase B OS=Gallus gallus OX=9031 GN=PPIB PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.646e-48
Identity = 86/190 (45.26%), Postives = 111/190 (58.42%), Query Frame = 2
Query:  104 EENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
            E  +  K+T   +F++ +      G+    +  IGLFG   P TV NF +L  G     K   ++G+K HRV+KDF+IQ GD   GDGTGG SIYG +F DENF L H  PGWVSMAN G D+N SQFFI   K  WLDGKHVVFGKV++G + V  + E         P   + I DCG   +E+P+ +
Sbjct:   26 ERKKGPKVTAKVFFDLRV------GEEDAGRVVIGLFGKTVPKTVENFVALATG----EKGFGFKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKV-ENTKTDSRDKPLKDVTIADCGTIEVEKPFAI 204          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P52014|CYP6_CAEEL (Peptidyl-prolyl cis-trans isomerase 6 OS=Caenorhabditis elegans OX=6239 GN=cyn-6 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.096e-47
Identity = 89/213 (41.78%), Postives = 124/213 (58.22%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLN 691
            + FVL ++ +      S E    ++T   +F++ I      G     K  IGLFG++ P TV NF  L +    +++   Y G+K HRV+++F+IQ GD   GDGTGG SIYG +F+DENF L H  PGW+SMAN G D+N SQFFI   K  WLDGKHVVFGK+++G + V  I EA   G    P   + I + G   +E P+T+  + +N
Sbjct:    6 LFFVLAILAL------SAEARGPRVTDKVFFDMEI------GGRPVGKIVIGLFGEVVPKTVKNFVELAQ----RAEGEGYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDENFKLQHYGPGWLSMANAGEDTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREI-EATPKGAGDRPIEDVVIANAGHIPVENPFTVARAGVN 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P45877|PPIC_HUMAN (Peptidyl-prolyl cis-trans isomerase C OS=Homo sapiens OX=9606 GN=PPIC PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.537e-47
Identity = 94/217 (43.32%), Postives = 122/217 (56.22%), Query Frame = 2
Query:   50 NMLFVLGLVLINFAFIYSEENEIYK-----ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
             +L  L L +   A ++S   E ++     +T   +F++ I D          +  IGLFG + P TV NF +L  G     K   Y+G+K HRV+KDF+IQ GD+  GDGTGG+SIYG  F DENF L H   GWVSMAN GPD+N SQFFI LTK  WLDGKHVVFGKVI G   V +I E         P     I + G   ++ P+ ++ +D
Sbjct:    6 RLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGD------KDVGRIVIGLFGKVVPKTVENFVALATG----EKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSI-ELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIAD 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A0L8G7D8 (Peptidyl-prolyl cis-trans isomerase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22038632mg PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 6.428e-78
Identity = 118/222 (53.15%), Postives = 159/222 (71.62%), Query Frame = 2
Query:   44 NKNMLFVLGLVLINFAFIYSEENEI-YKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDI 706
            NK ++  L L+LI   F Y++E++  Y IT++AWFE+ IK++ G G +Y  KF+IGLFGD  PMTV+NFA + KGYK+  + L YR + IHR+V DFVIQ+GD+  GDGTGG SIYG +F+DENFILSH++ G+VSMAN G D+N SQFFILL  ARWLD KHVVFGKV+ G +T+ TIG+      T+ P   ++IT CG   LE  Y++   ++ S +D+
Sbjct:    2 NKILVCTLSLLLI-IGFCYADEDQSNYTITELAWFEVEIKNHDGPGGDYTGKFAIGLFGDTVPMTVMNFAKIAKGYKSGKQNLQYRNSNIHRIVPDFVIQLGDITAGDGTGGRSIYGERFNDENFILSHKSAGYVSMANHGFDTNGSQFFILLNAARWLDNKHVVFGKVVVGMDTIRTIGDVKSDIGTAVPKKRVKITSCGAYVLENKYSLTEDEIVSDKDV 222          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A267GF69 (Peptidyl-prolyl cis-trans isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021795g2 PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 4.731e-77
Identity = 115/222 (51.80%), Postives = 153/222 (68.92%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENE---IYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKT-KSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDI 706
            +L VL       A    EE E    YK+T+  WFE+ IKD  G G ++  KF+IG+FG+ AP T +NF +L KG+++ K   LHY+GT +HRVV DFV+QMGDV   DGTGG SI+G  F+DE FILSHR+PGWV+MAN GPD+N SQF+I LTKARWLD  HVVFGK+++GF+ V+TIGE       + P   I I DCG+ ++++PY +   +L++T DI
Sbjct:    8 LLLVLYASAPAAAMRDKEEEEPKPTYKVTEEVWFEVEIKDLDGPGDDFTGKFTIGVFGEDAPATAMNFVALAKGWRSAKGDVLHYKGTPVHRVVPDFVVQMGDVTRKDGTGGASIFGKSFNDEPFILSHRSPGWVAMANHGPDTNGSQFYITLTKARWLDKHHVVFGKILRGFDVVNTIGEVPTNSKNAQPKRKIRIIDCGVVSIKKPYVLSKDELDATTDI 229          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: K1Q5P7 (Peptidyl-prolyl cis-trans isomerase OS=Crassostrea gigas OX=29159 GN=CGI_10027458 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.045e-76
Identity = 116/218 (53.21%), Postives = 151/218 (69.27%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDI 706
            +LFV+ +  +N        ++ + +T+ AWF++ IKDY G G++Y+ +F + +FGD  PMT +NF SL KGYK  SK L Y+ + IHR+V DF+IQMGD+  GDGTGG SIYGP F DENF LSH+  G+VSMAN G D+N SQFFILL KARWLDGKHVVFGKVIKG + V TIGE      T+ P  T++I DCGI  +E+ Y +  +   S ED+
Sbjct:    5 LLFVVLVAAVN-------AHKNFTVTEEAWFDVEIKDYDGIGEDYRGRFVVAMFGDKCPMTTMNFQSLAKGYKRGSKTLTYKRSIIHRIVPDFIIQMGDITVGDGTGGESIYGPTFVDENFELSHKAAGYVSMANHGADTNGSQFFILLNKARWLDGKHVVFGKVIKGMDVVRTIGETPTDSRTAVPKKTVKIIDCGIVGIEKKYELTEAQAESNEDL 215          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A267FAG4 (Peptidyl-prolyl cis-trans isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021795g1 PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.731e-76
Identity = 115/222 (51.80%), Postives = 152/222 (68.47%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENE---IYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKT-KSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDI 706
            +L VL       A    EE E    YK+T+  WFE+ IKD  G G ++  KF+IG+FG+ AP T +NF +L KG+++ K   LHY+GT +HRVV DFV+QMGDV   DGTGG SI+G  F+DE FILSHR+PGWV+MAN GPD+N SQF+I LTKARWLD  HVVFGK+++GF+ V+TIGE       + P   I I DCG+ ++++PY +   +L+ T DI
Sbjct:    8 LLLVLYASAPAAAMRDKEEEEPKPTYKVTEEVWFEVEIKDLDGPGDDFTGKFTIGVFGEDAPATAMNFVALAKGWRSAKGDVLHYKGTPVHRVVPDFVVQMGDVTRKDGTGGASIFGKSFNDEPFILSHRSPGWVAMANHGPDTNGSQFYITLTKARWLDKHHVVFGKILRGFDVVNTIGEVPTNSKNAQPKRKIRIIDCGVVSIKKPYVLSKDELDVTTDI 229          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A1I8HZ02 (Peptidyl-prolyl cis-trans isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007442g1 PE=3 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.515e-75
Identity = 115/203 (56.65%), Postives = 153/203 (75.37%), Query Frame = 2
Query:  101 SEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDIQ 709
            S  N  Y +T+  WFE+ +KD  G G+++  KF++ +FG+ APMT +NF SL +GYK + + LHY+ T +HRVV DFV+QMGD+  GDGTGG SIYGP+F+DE FILSHR+PGW++MAN GPD+N SQF+ILLTKARWLD KHVVFGKVIKGF+ V T+GE     DT+ P   I I DCG+  ++  Y +K S+L+ST+D++
Sbjct:   22 SAMNSNYTVTEEVWFEVRVKDMDGPGEDFTGKFTVAVFGEAAPMTTMNFVSLARGYKFRGENLHYKNTPVHRVVPDFVVQMGDITTGDGTGGTSIYGPRFNDEPFILSHRSPGWIAMANHGPDTNGSQFYILLTKARWLDNKHVVFGKVIKGFDVVKTVGEVPSDPDTAVPRKRIMIEDCGVVGIKERYELKPSELDSTDDVK 224          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppic (peptidylprolyl isomerase C [Source:NCBI gene;Acc:103037994])

HSP 1 Score: 161.384 bits (407), Expect = 6.102e-49
Identity = 88/185 (47.57%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMK 676
            K+T   +F+IT+      G +   +  IGLFG++ P+TV NF +L  G     K   Y+G+K HRV+KDF+IQ GD   GDGTGG SIYG  F DENF L H+  GWVSMAN GPD+N SQFFI   +A WLDGKHVVFGKV++G   V TI E     D + P     I + G   ++ P+ ++
Sbjct:   32 KVTDKVFFDITV------GGHEVGRIVIGLFGEVVPLTVNNFVALATG----EKGYGYKGSKFHRVIKDFMIQGGDFTAGDGTGGKSIYGKTFADENFKLKHQGTGWVSMANAGPDTNGSQFFITSARAPWLDGKHVVFGKVLEGMTVVHTI-ELQDTNDRNMPYTECVIVNSGKIEVKEPFVVE 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ENSAMXT00000040118.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001973.1:152187:156547:-1 gene:ENSAMXG00000041718.1 transcript:ENSAMXT00000040118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 4.989e-39
Identity = 77/192 (40.10%), Postives = 108/192 (56.25%), Query Frame = 2
Query:   80 INFAFIYSEENEIYKITQ----VAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            + + FIY  +   + +++    V +F ++  D      +   K +I LF  + P T  NF  L  G     K   YR +  HR++ DF+ Q GD+ N DGTGG S+YG KF+DENF + H  PG +SMAN G D+N+SQFFI L KA  LD KHV FG V  G + V  +GE  +   +  P+ TI++ DCG
Sbjct:    2 VEYHFIYKLQTLAFTLSRPNNPVVFFTVSADD------DVIGKITIELFSHIVPKTAENFRLLCTG----EKGFGYRNSVFHRIIPDFMCQGGDITNQDGTGGKSVYGGKFEDENFDVRHTGPGLLSMANRGRDTNNSQFFITLKKAEHLDFKHVAFGFVRNGMDVVKQMGE--MGSKSGKPSKTIKVVDCG 181          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ENSAMXT00000048079.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001973.1:152187:155587:-1 gene:ENSAMXG00000041718.1 transcript:ENSAMXT00000048079.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 3.112e-38
Identity = 71/150 (47.33%), Postives = 91/150 (60.67%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            K +I LF  + P T  NF  L  G     K   YR +  HR++ DF+ Q GD+ N DGTGG S+YG KF+DENF + H  PG +SMAN G D+N+SQFFI L KA  LD KHV FG V  G + V  +GE  +   +  P+ TI++ DCG
Sbjct:   24 KITIELFSHIVPKTAENFRLLCTG----EKGFGYRNSVFHRIIPDFMCQGGDITNQDGTGGKSVYGGKFEDENFDVRHTGPGLLSMANRGRDTNNSQFFITLKKAEHLDFKHVAFGFVRNGMDVVKQMGE--MGSKSGKPSKTIKVVDCG 167          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ENSAMXT00000033420.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001973.1:152187:154187:-1 gene:ENSAMXG00000041718.1 transcript:ENSAMXT00000033420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 3.122e-38
Identity = 71/150 (47.33%), Postives = 91/150 (60.67%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            K +I LF  + P T  NF  L  G     K   YR +  HR++ DF+ Q GD+ N DGTGG S+YG KF+DENF + H  PG +SMAN G D+N+SQFFI L KA  LD KHV FG V  G + V  +GE  +   +  P+ TI++ DCG
Sbjct:   23 KITIELFSHIVPKTAENFRLLCTG----EKGFGYRNSVFHRIIPDFMCQGGDITNQDGTGGKSVYGGKFEDENFDVRHTGPGLLSMANRGRDTNNSQFFITLKKAEHLDFKHVAFGFVRNGMDVVKQMGE--MGSKSGKPSKTIKVVDCG 166          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ENSAMXT00000043946.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001973.1:152187:156122:-1 gene:ENSAMXG00000041718.1 transcript:ENSAMXT00000043946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 4.220e-38
Identity = 70/148 (47.30%), Postives = 90/148 (60.81%), Query Frame = 2
Query:  200 SIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            +I LF  + P T  NF  L  G     K   YR +  HR++ DF+ Q GD+ N DGTGG S+YG KF+DENF + H  PG +SMAN G D+N+SQFFI L KA  LD KHV FG V  G + V  +GE  +   +  P+ TI++ DCG
Sbjct:    6 TIELFSHIVPKTAENFRLLCTG----EKGFGYRNSVFHRIIPDFMCQGGDITNQDGTGGKSVYGGKFEDENFDVRHTGPGLLSMANRGRDTNNSQFFITLKKAEHLDFKHVAFGFVRNGMDVVKQMGE--MGSKSGKPSKTIKVVDCG 147          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010135.1 (pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 gene:ENSPMAG00000009125.1 transcript:ENSPMAT00000010135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.434e-40
Identity = 72/146 (49.32%), Postives = 87/146 (59.59%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGE-AHVFGDTSTPAVTIEITDCG 643
            L GD+ P T  NF +L  G     K   Y+G+  HRV+ DF+ Q GD   G+GTGG SIYG KF+DENF L H  PG +SMAN GP++N SQFFI   K  WLD KHVVFGKVI G + +  +       G TS   V   + DCG
Sbjct:   24 LRGDVVPKTAENFRALCTG----EKGFGYKGSTFHRVIPDFMCQGGDFTKGNGTGGKSIYGNKFEDENFTLKHEGPGILSMANAGPNTNGSQFFICTAKTAWLDNKHVVFGKVISGLDVIKKVESYGAASGKTSKKIV---VADCG 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 120.168 bits (300), Expect = 4.955e-34
Identity = 66/151 (43.71%), Postives = 86/151 (56.95%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGE-AHVFGDTSTPAVTIEITDCG 643
            + ++ L  D+ P T  NF +L  G         Y+G+  HR++ +F+ Q GD    +GTGG+SIYG  F DENFIL H  PG +SMAN G ++N SQFFI      WLDGKHVVFG V  G + V  + +     GD       +EITDCG
Sbjct:   29 RITLKLRADVVPKTAENFRALCTG----EHGFGYKGSIFHRIIPNFMCQGGDFTRNNGTGGVSIYGTTFRDENFILKHTGPGILSMANAGKNTNGSQFFICTELTNWLDGKHVVFGHVTSGMDIVKKMEKLGSSKGDVKG---RVEITDCG 172          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 121.324 bits (303), Expect = 1.588e-31
Identity = 68/149 (45.64%), Postives = 84/149 (56.38%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGY----KTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            LF D+ P T  NF  L  G     K   K LH+R T  HR+VK+F++Q GD   G+G GG SIYG  F+DENF L H     +SMAN G D+N SQFFI    A  LDG+HVVFG+V+ G + +  I E       S P   I +  CG
Sbjct:   27 LFFDVCPKTCENFRCLCTGERGIGKITRKPLHFRSTSFHRIVKNFMVQGGDFSEGNGRGGESIYGGFFEDENFQLKHDQEFLLSMANRGKDTNGSQFFITTKPAPHLDGEHVVFGRVLSGQDLLKEI-ENQKTDANSLPYADIRVVHCG 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 110.538 bits (275), Expect = 2.070e-30
Identity = 56/120 (46.67%), Postives = 76/120 (63.33%), Query Frame = 2
Query:  224 APMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDE-NFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIG 580
            AP T  NFA L       +++ +Y GT+ HR+++ F+IQ GD     G GG SIYG  F+DE +  L H   G +SMAN GP++N SQFFI L   +WLDGKH +F +V +G +TV+ IG
Sbjct:   32 APRTCRNFAEL-------ARRGYYNGTRFHRIIRGFMIQGGDPTGTAGRGGASIYGKHFEDEIHPDLKHTGAGIISMANSGPNTNGSQFFITLGPTQWLDGKHSIFARVARGMSTVNRIG 144          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004654.1 (pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 gene:ENSPMAG00000004243.1 transcript:ENSPMAT00000004654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 1.345e-28
Identity = 57/130 (43.85%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  194 KFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGE 583
            + SI LF ++ P T  NF +L     T      YR + IHRV+  F+ Q GD  N +GTGG SIY   F+DE+F + H   G +SMAN G ++N+SQFFI L     LD KHV FG V  G + V  + E
Sbjct:   71 RISIELFANVVPRTAENFRALC----THEHGFGYRNSTIHRVIPGFMCQGGDFTNHNGTGGRSIYEKPFEDESFKILHSRAGILSMANSGRNTNTSQFFITLRATSHLDHKHVAFGAVRSGMSIVRAMEE 196          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 134.42 bits (337), Expect = 1.092e-37
Identity = 74/174 (42.53%), Postives = 98/174 (56.32%), Query Frame = 2
Query:  140 WFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG----YKTKSK-KLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGI 646
            +F+I+I      G   Q +    L+ D+ P T  NF  L +G     KTK    L Y+G+  HRV+KDF+ Q GD  N +GTGG SIY  KF+DENF + H  P  +SMAN GP++N SQ FI       LDGKHVVFG+VI+G   V  I       + + P   ++I DCG+
Sbjct:    7 FFDISI------GGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGV 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR1 (Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A; N-terminally propionylated in vivo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002562])

HSP 1 Score: 126.716 bits (317), Expect = 5.721e-37
Identity = 62/123 (50.41%), Postives = 78/123 (63.41%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTI 577
            L+ D+ P T  NF +L  G     K   Y G+  HRV+ DF++Q GD   G+GTGG SIYG KF DENF   H  PG +SMAN GP++N SQFFI      WLDGKHVVFG+V+ G++ V  +
Sbjct:   22 LYNDIVPKTAENFRALCTG----EKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKV 140          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR2 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; potential role in the secretory pathway; seamless-GFP and mCherry fusion proteins localize to the vacuole, while SWAT-GFP fusion localizes to both the endoplasmic reticulum and vacuole; suppresses toxicity of slow-folding human Z-type alpha1-antitrypsin variant associated with liver cirrhosis and emphysema [Source:SGD;Acc:S000001099])

HSP 1 Score: 127.102 bits (318), Expect = 1.401e-36
Identity = 81/205 (39.51%), Postives = 117/205 (57.07%), Query Frame = 2
Query:   53 MLFV-LGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLT-KARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTS-TPAVTIEITDCGIETLE 658
            +LF+ + ++  +   +  +++E+  ITQ  +F+I        G+    +  IGL+G + P T  NF  L+    T + K  + G+  HRV+ +F++Q GD  +G G GG SIYG  F DENF L H   G +SMAN G D+N SQFFI  T +A WLDGKHVVFG+V+ G + V+ I   HV  D +  P   ++I  CG  T E
Sbjct:   11 LLFLSVNVIASDVGELIDQDDEV--ITQKVFFDIE------HGEEKVGRIVIGLYGKVCPKTAKNFYKLST---TTNSKKGFIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYI--QHVSRDANDKPLEAVKIAKCGEWTPE 202          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR3 (Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria [Source:SGD;Acc:S000004543])

HSP 1 Score: 118.242 bits (295), Expect = 2.361e-33
Identity = 66/146 (45.21%), Postives = 83/146 (56.85%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTS-TPAVTIEITDCG 643
            L+ ++ P T  NF +L  G     K   Y+G   HR++ DF+IQ GD    +G GG SIYG KF DENF+  H   G +SMAN GP++N SQFFI      WLDGKHVVFG+V KG + V  I     +G  S  P   I I + G
Sbjct:   42 LYDNVVPKTAENFRALCTG----EKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAI---ESYGTASGKPRAEIVIEEAG 180          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR5 (Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the ER; catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002712])

HSP 1 Score: 115.161 bits (287), Expect = 9.661e-32
Identity = 65/146 (44.52%), Postives = 85/146 (58.22%), Query Frame = 2
Query:  146 EITIKDYY--GAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTI 577
            EIT K Y+    G     +  +GL+G   P TV NF  LT    ++  K+ Y  +  HRV+ +F+IQ GD  +  G GG SI+G  F DENF + H  PG +SMAN G ++N SQFFI      WLDGKHVVFG+V+ G + V  I
Sbjct:   31 EITHKVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTI---SRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYI 173          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34629 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV4])

HSP 1 Score: 160.229 bits (404), Expect = 5.860e-49
Identity = 91/213 (42.72%), Postives = 122/213 (57.28%), Query Frame = 2
Query:   62 VLGLVLINFAFIYSEENEIYK------ITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSS 682
            + G VL     ++ +E E  K      +T   +F+++I      G +   +   G+FG   P T  NF  L  G     K   Y+G+  HR++KDF+IQ GD +N DGTGG SIYG +FDDENF L H  PGW+SMAN G D+N SQFFI   K  WLDGKHVVFGKV++G + V  +   +V G  STP  T  I D G   L++P+ ++ S
Sbjct:   10 IFGAVLF---LLWPQETEAKKTNKGPLVTDKIYFDVSI------GGDKIGRIVFGIFGKTVPKTAKNFKLLATG----EKGYGYKGSIFHRIIKDFMIQGGDFINKDGTGGRSIYGDRFDDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLENVNVKG--STPVKTCMIDDSGTLPLDKPFNVEKS 207          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34613 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV5])

HSP 1 Score: 154.836 bits (390), Expect = 7.396e-47
Identity = 86/204 (42.16%), Postives = 117/204 (57.35%), Query Frame = 2
Query:   77 LINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHV-FGDTSTPAVTIEITDCGIETLERPYTMKSSD 685
            +I+  F+ S   +   +T+  +F+ITI      G     +  IGLFG   P T  NF  L  G     K   Y+ +  HRV++DF+IQ GD   GDGTGG SIYG KF DENF L H   GW+SMAN G D+N SQFFI   K  WLDG+HVVFGKV+KG + V  I ++    GD   P   +++ D G  T+++P+++   +
Sbjct:    9 VISLFFLASSAAKDPIVTKKVFFDITI------GGEKAGRIEIGLFGKAVPKTAENFFQLATG----EKGFGYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHVVFGKVLKGMDVVRKIEKSKTDHGD--RPVKEVKVADSGSLTVDKPFSVSQDE 200          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34614 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV6])

HSP 1 Score: 141.739 bits (356), Expect = 3.945e-42
Identity = 76/158 (48.10%), Postives = 95/158 (60.13%), Query Frame = 2
Query:  203 IGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDT-STPAVTIEITDCGIETLERPYTM 673
            +GLFGD AP TV NF +L      K +   Y+ +  HRV+K+F+IQ GD  N DGTGG SIYG  FDDENF L H  PGW+ MAN G ++N SQF+I   K  WLDG H  FGKV++G + V  I    V  DT   P   ++IT  G   +E PY +
Sbjct:   15 LGLFGDTAPKTVANFVALAD----KEQGFGYKDSIFHRVIKNFMIQGGDFTNKDGTGGYSIYGKYFDDENFNLKHYGPGWLCMANAGKNTNGSQFYITTIKTSWLDGSHTCFGKVLEGMDVVRRIENTRV--DTHDKPLDEVKITGIGSIPIESPYEV 166          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO41747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C4])

HSP 1 Score: 142.124 bits (357), Expect = 3.587e-40
Identity = 72/149 (48.32%), Postives = 90/149 (60.40%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYK----TKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            LF D  P T  NF +L  G K    +  K LHY+G   HR++KDF++Q GD  N +GTGG SIYG KF DE+F   H  PG +SMAN GP++N SQFFI       LDG+HVVFGKV+KG + V  +    V  D S+P     I +CG
Sbjct:   36 LFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHRIIKDFMVQGGDFSNKNGTGGESIYGEKFADEDFTYKHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELEATPV--DDSSPKSPCIIEECG 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO38777 (Peptidyl-prolyl cis-trans isomerase E [Source:UniProtKB/TrEMBL;Acc:A7SBW4])

HSP 1 Score: 134.42 bits (337), Expect = 7.249e-38
Identity = 74/174 (42.53%), Postives = 100/174 (57.47%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            ++    +F+ITI      G+    +  + L  D+ PMT  NF  L     T  K   Y+G+  HR++  F+ Q GD    +GTGG SIYG KF+DENF+L H   G +SMAN GP++N SQFF+   K  WLDGKHVVFG VI+GF+ V  + EA V   +   +  + I DCG
Sbjct:  134 RVNPRVFFDITI------GERSAGRIVMELRSDVVPMTAENFRCLC----THEKGFGYKGSSFHRIIPQFMCQGGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANSGPNTNGSQFFLTTEKTDWLDGKHVVFGNVIEGFDVVRKM-EA-VGSQSGKASKKVVIDDCG 295          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppic (peptidylprolyl isomerase C [Source:NCBI gene;Acc:101172089])

HSP 1 Score: 159.073 bits (401), Expect = 5.040e-48
Identity = 87/185 (47.03%), Postives = 112/185 (60.54%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMK 676
            ++T+  +F++T+      G +   +  IGLFG++ P TV NF  L  G     K   Y+GTK HRV+KDF+IQ GD   GDGTGG SIYG  F DENF L H    WVSMAN GPD+N SQFFIL  +A WLDGKHVVFGKV+ G + V TI E     D + P     I + G   ++ P+ ++
Sbjct:   28 RVTEKVFFDVTV------GGHEVGRIVIGLFGEVVPQTVNNFVVLATG----EKGYGYKGTKFHRVIKDFMIQGGDFTAGDGTGGHSIYGTTFADENFKLKHLGASWVSMANAGPDTNGSQFFILAARAPWLDGKHVVFGKVLDGMSVVHTI-ELQDTNDRNLPYTECVIINSGRIPVKEPFVVE 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppib (peptidylprolyl isomerase B [Source:NCBI gene;Acc:101157771])

HSP 1 Score: 154.451 bits (389), Expect = 4.112e-46
Identity = 90/219 (41.10%), Postives = 119/219 (54.34%), Query Frame = 2
Query:   44 NKNMLFVLGLVLINFAFIY---------SEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
             + M F + + +I  + I+          E+ +  K+T   +F+I I      G     +  IGLFG   P TV NF +L  G     K   Y+G+K HRV+K F+IQ GD   GDGTGG SIYG +F DENF L H   GW+SMAN G D+N SQFFI   +  WLDGKHVVFGKV++G + V  I      G    P   + I DCG   +E+P+ +
Sbjct:    6 ERRMKFFVAVTVIVGSLIFLAFPNGSSADEKKKGPKVTAKVFFDIRI------GDEDVGRVVIGLFGKTVPKTVDNFVALATG----EKGFGYKGSKFHRVIKQFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGAGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKVLEGMDVVQKIESTKTDG-RDKPLKDVIIHDCGKIEVEKPFAV 213          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppih (peptidylprolyl isomerase H [Source:NCBI gene;Acc:101166624])

HSP 1 Score: 136.346 bits (342), Expect = 1.600e-39
Identity = 76/171 (44.44%), Postives = 95/171 (55.56%), Query Frame = 2
Query:  134 VAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKG-YKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            + +F+ITI      G     +  I LF D+ P T  NF     G ++     + Y+G   HRV+KDF+IQ GD +NGDGTG  SIY   F DENF   H  PG +SMAN GP +N  QFF+  TK  WLDGKHVVFGKV+ G   +  I E    G  + P + I I  CG
Sbjct:   12 IVFFDITI------GGQDVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGCTFHRVIKDFMIQGGDFVNGDGTGVCSIYRGPFADENFKHKHSAPGLLSMANSGPGTNGCQFFLTCTKCDWLDGKHVVFGKVVDGLLIMRKI-ENVPTGPNNKPKLPILIAQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000030005.1 (peptidylprolyl isomerase E [Source:NCBI gene;Acc:101158811])

HSP 1 Score: 137.502 bits (345), Expect = 1.331e-38
Identity = 71/145 (48.97%), Postives = 90/145 (62.07%), Query Frame = 2
Query:  209 LFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            L  D+ PMT  NF  L     T  K   Y+G+  HR++  F+ Q GD  N +GTGG SIYG KFDDENF+L H  PG +SMAN GP++N SQFFI   K  WLDGKHVVFG++++G + V  + EA    D   P   + I+DCG
Sbjct:  161 LRADIVPMTAENFRCLC----THEKGFGYKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTAPGQLSMANSGPNTNGSQFFITNDKTDWLDGKHVVFGELVEGMDVVRAM-EAQGTKD-GKPKQKVIISDCG 299          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: PPIF (peptidylprolyl isomerase F [Source:NCBI gene;Acc:101156535])

HSP 1 Score: 131.724 bits (330), Expect = 1.241e-37
Identity = 72/158 (45.57%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  173 AGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTS-TPAVTIEITDCG 643
            AG     + +  L  D+ P T  NF +L  G         Y+G+  HRV+  F+ Q GD  N +GTGG SIYG KF DENF+L H  PG +SMAN GP++N SQFFI  +K  WLDG+HVVFG+V  G   +S + +   FG  S   +  I ITDCG
Sbjct:   40 AGSEPLGRVTFELSADVVPKTAENFRALCTG----EHGFGYKGSIFHRVIPKFMCQGGDFTNHNGTGGKSIYGLKFPDENFVLKHTGPGILSMANAGPNTNGSQFFICTSKTEWLDGRHVVFGRVKDG---MSVVKKVESFGSQSGRTSQKITITDCG 190          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000079924.1 (SMESG000079924.1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.048e-163
Identity = 220/220 (100.00%), Postives = 220/220 (100.00%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDIQI 712
            MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDIQI
Sbjct:    1 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDIQI 220          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000067492.1 (SMESG000067492.1)

HSP 1 Score: 307.76 bits (787), Expect = 2.005e-106
Identity = 142/220 (64.55%), Postives = 180/220 (81.82%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSSDLNSTEDIQI 712
            ML ++ L  I F F  +++++ + IT VAWFEI  +D+ G G +++ KF+IGLFGD APMTVLNF +++KG+K++S+KLHY+GT IHR+VKDFVIQMGDV   DGTGG SIYGPKF+DE FILSHR+ GWVSMAN GPD+NSSQFFILLTKARWLD KHVVFGKVIKGF+ V TIGEA    DTSTP  +I+I DCG++TL++PY +K+S+L++T DI I
Sbjct:    1 MLSIIALFTIVFTFCQAQDSKNFSITHVAWFEIEARDFDGPGDDFRGKFNIGLFGDSAPMTVLNFVAISKGHKSRSEKLHYKGTPIHRIVKDFVIQMGDVTKHDGTGGSSIYGPKFNDEEFILSHRSAGWVSMANHGPDTNSSQFFILLTKARWLDKKHVVFGKVIKGFDVVETIGEAETIKDTSTPKRSIKIIDCGVKTLDKPYVLKASELDTTTDIDI 220          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000038766.1 (SMESG000038766.1)

HSP 1 Score: 172.555 bits (436), Expect = 2.009e-53
Identity = 96/208 (46.15%), Postives = 125/208 (60.10%), Query Frame = 2
Query:   53 MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKL-HYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTM 673
            + F+  +  + F  + S++    K+T   +FEI I      GKN   K  IGLFG   P TV NF S+ +GYKT   KL  Y+G+K HRV+KDF++Q GD   GDGTGG SIYG +F DENF L+H   GW+SMAN GPDSN SQFFI +    WL+G+HVVFGKV++G N V  I E    G    P   + I +CG   +E  + +
Sbjct:    3 IAFLFSIAFLIFQLVSSKKGP--KVTDKVFFEIEI-----GGKNV-GKIVIGLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQGGDFTRGDGTGGTSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQI-ENTKTGQNDKPVSDVVIVNCGSIPVETSFAV 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052090.1 (SMESG000052090.1)

HSP 1 Score: 145.206 bits (365), Expect = 1.135e-41
Identity = 83/174 (47.70%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  122 KITQVAWFEITIKDYYGAGKNYQDKFSIGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCG 643
            ++ QV +F+I+I++          +  I L  D+ P T  NF SL+    T +K   ++G+K HR++ DF+ Q GD   GDGTGG SIYG KFDDENFIL H   G +SMAN GP++N SQFFI L K  WLDGKHVVFG V++G N    + EA V   + TP   + ITDCG
Sbjct:  145 ELPQV-YFDISIRNQQIG------RIVIQLRKDVVPRTCENFISLS----THAKGFGFKGSKFHRIIPDFMCQGGDFTMGDGTGGKSIYGMKFDDENFILRHDAAGVLSMANTGPNTNGSQFFICLNKTPWLDGKHVVFGHVVEGMNVCKKM-EA-VGSKSGTPNDPVVITDCG 305          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052204.1 (SMESG000052204.1)

HSP 1 Score: 131.724 bits (330), Expect = 3.996e-38
Identity = 69/140 (49.29%), Postives = 89/140 (63.57%), Query Frame = 2
Query:  227 PMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGE-AHVFGDTSTPAVTIEITDCG 643
            P TV NF +L  G     K   ++G+K HRV+ +F++Q GD   G+GTGG SIYG KF+DENF + H  PG +SMAN GP++N SQFFI      WLDGKHVVFG+V +G + V  + +     G TS    T+ ITDCG
Sbjct:   28 PKTVENFRALCTG----EKGFGFKGSKFHRVIPNFMLQGGDFTRGNGTGGKSIYGEKFEDENFKIKHTKPGLLSMANAGPNTNGSQFFITTVITNWLDGKHVVFGEVAEGMDIVQKVEKLGSASGKTSK---TVSITDCG 160          
The following BLAST results are available for this feature:
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIC3.200e-4843.32peptidylprolyl isomerase C [Source:HGNC Symbol;Acc... [more]
PPIB3.828e-4741.55peptidylprolyl isomerase B [Source:HGNC Symbol;Acc... [more]
PPIH7.601e-4143.10peptidylprolyl isomerase H [Source:HGNC Symbol;Acc... [more]
PPIA2.691e-3948.34peptidylprolyl isomerase A [Source:HGNC Symbol;Acc... [more]
PPIE3.876e-3847.33peptidylprolyl isomerase E [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyn-68.620e-4941.78Peptidyl-prolyl cis-trans isomerase 6 [Source:Uni... [more]
cyn-68.620e-4941.78Peptidyl-prolyl cis-trans isomerase 6 [Source:Uni... [more]
cyn-74.693e-4347.09Peptidyl-prolyl cis-trans isomerase 7 [Source:Uni... [more]
cyn-74.693e-4347.09Peptidyl-prolyl cis-trans isomerase 7 [Source:Uni... [more]
cyn-53.546e-4244.09Peptidyl-prolyl cis-trans isomerase 5 [Source:Uni... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG28522.234e-4543.09gene:FBgn0034753 transcript:FBtr0071933[more]
CG28522.234e-4543.09gene:FBgn0034753 transcript:FBtr0345504[more]
CG172669.992e-3846.58gene:FBgn0033089 transcript:FBtr0307502[more]
CG172669.992e-3846.58gene:FBgn0033089 transcript:FBtr0086144[more]
ninaA6.462e-3742.44gene:FBgn0002936 transcript:FBtr0078023[more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppic2.985e-4848.11peptidylprolyl isomerase C [Source:ZFIN;Acc:ZDB-GE... [more]
ppib5.853e-4741.67peptidylprolyl isomerase B (cyclophilin B) [Source... [more]
ppih9.531e-4143.86peptidylprolyl isomerase H (cyclophilin H) [Source... [more]
ppih9.531e-4143.86peptidylprolyl isomerase H (cyclophilin H) [Source... [more]
ppifa2.897e-3949.66peptidylprolyl isomerase Fa [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIC2.685e-4750.00peptidylprolyl isomerase C (cyclophilin C) [Source... [more]
azin12.401e-4643.60antizyme inhibitor 1 [Source:Xenbase;Acc:XB-GENE-9... [more]
ppih1.705e-3943.27peptidylprolyl isomerase H [Source:NCBI gene;Acc:3... [more]
PPIE2.281e-3950.34peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
PPIE4.029e-3950.34peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppib9.086e-4741.01peptidylprolyl isomerase B [Source:MGI Symbol;Acc:... [more]
Ppic1.445e-4445.99peptidylprolyl isomerase C [Source:MGI Symbol;Acc:... [more]
Ppih5.218e-4143.10peptidyl prolyl isomerase H [Source:MGI Symbol;Acc... [more]
Ppih5.218e-4143.10peptidyl prolyl isomerase H [Source:MGI Symbol;Acc... [more]
Ppih5.218e-4143.10peptidyl prolyl isomerase H [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26551|PPIB_SCHMA2.635e-5046.57Peptidyl-prolyl cis-trans isomerase B OS=Schistoso... [more]
sp|P80311|PPIB_BOVIN3.696e-4943.32Peptidyl-prolyl cis-trans isomerase B OS=Bos tauru... [more]
sp|P24367|PPIB_CHICK1.646e-4845.26Peptidyl-prolyl cis-trans isomerase B OS=Gallus ga... [more]
sp|P52014|CYP6_CAEEL1.096e-4741.78Peptidyl-prolyl cis-trans isomerase 6 OS=Caenorhab... [more]
sp|P45877|PPIC_HUMAN1.537e-4743.32Peptidyl-prolyl cis-trans isomerase C OS=Homo sapi... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8G7D86.428e-7853.15Peptidyl-prolyl cis-trans isomerase OS=Octopus bim... [more]
A0A267GF694.731e-7751.80Peptidyl-prolyl cis-trans isomerase OS=Macrostomum... [more]
K1Q5P71.045e-7653.21Peptidyl-prolyl cis-trans isomerase OS=Crassostrea... [more]
A0A267FAG41.731e-7651.80Peptidyl-prolyl cis-trans isomerase OS=Macrostomum... [more]
A0A1I8HZ021.515e-7556.65Peptidyl-prolyl cis-trans isomerase OS=Macrostomum... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppic6.102e-4947.57peptidylprolyl isomerase C [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000040118.14.989e-3940.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048079.13.112e-3847.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033420.13.122e-3847.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043946.14.220e-3847.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010135.11.434e-4049.32pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 g... [more]
ppifb4.955e-3443.71peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ppig1.588e-3145.64peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ppil12.070e-3046.67peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
ENSPMAT00000004654.11.345e-2843.85pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CPR61.092e-3742.53Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR15.721e-3750.41Cytoplasmic peptidyl-prolyl cis-trans isomerase (c... [more]
CPR21.401e-3639.51Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR32.361e-3345.21Mitochondrial peptidyl-prolyl cis-trans isomerase ... [more]
CPR59.661e-3244.52Peptidyl-prolyl cis-trans isomerase (cyclophilin) ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346295.860e-4942.72Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346137.396e-4742.16Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346143.945e-4248.10Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO417473.587e-4048.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387777.249e-3842.53Peptidyl-prolyl cis-trans isomerase E [Source:Uni... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppic5.040e-4847.03peptidylprolyl isomerase C [Source:NCBI gene;Acc:1... [more]
ppib4.112e-4641.10peptidylprolyl isomerase B [Source:NCBI gene;Acc:1... [more]
ppih1.600e-3944.44peptidylprolyl isomerase H [Source:NCBI gene;Acc:1... [more]
ENSORLT00000030005.11.331e-3848.97peptidylprolyl isomerase E [Source:NCBI gene;Acc:1... [more]
PPIF1.241e-3745.57peptidylprolyl isomerase F [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079924.11.048e-163100.00SMESG000079924.1[more]
SMESG000067492.12.005e-10664.55SMESG000067492.1[more]
SMESG000038766.12.009e-5346.15SMESG000038766.1[more]
SMESG000052090.11.135e-4147.70SMESG000052090.1[more]
SMESG000052204.13.996e-3849.29SMESG000052204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002330 ID=SMED30002330|Name=Peptidyl-prolyl cis-trans isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=797bp
CCGATCTGTCGTATTAGTTTTTTTTACAAATTATTACAATTAAAACAAAA
ATATGCTATTTGTTCTTGGACTTGTTTTGATAAATTTTGCATTTATTTAT
TCGGAAGAGAATGAGATTTACAAAATCACACAGGTGGCTTGGTTTGAAAT
TACAATCAAAGATTACTACGGAGCTGGAAAAAATTATCAGGACAAATTTA
GTATAGGATTATTTGGCGATCTTGCTCCTATGACAGTTTTGAATTTTGCT
TCGTTGACCAAAGGATACAAAACAAAATCGAAAAAACTTCACTATCGAGG
AACCAAGATTCATAGAGTTGTTAAGGATTTTGTTATTCAGATGGGGGACG
TTTTAAATGGCGATGGAACTGGTGGAATGAGCATTTACGGACCGAAATTT
GATGACGAAAATTTTATTTTGAGCCATAGAAATCCTGGGTGGGTATCAAT
GGCTAATTTTGGACCCGATTCTAATTCCTCTCAATTTTTTATCCTATTGA
CGAAAGCAAGATGGCTTGATGGAAAACATGTAGTTTTTGGGAAAGTGATT
AAAGGATTTAATACCGTTAGCACAATAGGCGAAGCCCACGTGTTTGGAGA
TACCTCAACGCCAGCAGTAACAATTGAAATCACAGACTGTGGCATTGAAA
CCTTAGAACGTCCCTATACGATGAAATCCAGCGATTTAAACAGTACAGAA
GATATTCAAATCTAAGAACAAGATCGTTTTTAAGTTTTTTAAATTTAGTT
TGGATTTTCAATAATAAAAAACATGAACAACTTTTGTTTAAAAAAAA
back to top

protein sequence of SMED30002330-orf-1

>SMED30002330-orf-1 ID=SMED30002330-orf-1|Name=SMED30002330-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MLFVLGLVLINFAFIYSEENEIYKITQVAWFEITIKDYYGAGKNYQDKFS
IGLFGDLAPMTVLNFASLTKGYKTKSKKLHYRGTKIHRVVKDFVIQMGDV
LNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLT
KARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIET
LERPYTMKSSDLNSTEDIQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002130Cyclophilin-type_PPIase_dom
IPR029000Cyclophilin-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPRINTSPR00153CSAPPISMRASEcoord: 53..68
score: 47.82
coord: 157..172
score: 60.76
coord: 86..98
score: 51.46
coord: 144..156
score: 55.04
coord: 129..144
score: 61.14
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00160Pro_isomerasecoord: 46..197
e-value: 1.7E-37
score: 129.1
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50072CSA_PPIASE_2coord: 48..198
score: 33.464
IPR029000Cyclophilin-like domain superfamilyGENE3DG3DSA:2.40.100.10coord: 14..198
e-value: 2.4E-59
score: 201.9
IPR029000Cyclophilin-like domain superfamilySUPERFAMILYSSF50891Cyclophilin-likecoord: 46..199
NoneNo IPR availablePANTHERPTHR11071:SF419coord: 19..211
NoneNo IPR availablePANTHERPTHR11071PEPTIDYL-PROLYL CIS-TRANS ISOMERASEcoord: 19..211
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.788