Tectonin beta-propeller repeat containing 2

Overview
NameTectonin beta-propeller repeat containing 2
Smed IDSMED30002327
Length (bp)4494
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tectonin beta-propeller repeat containing 2 (SMED30002327) t-SNE clustered cells

Violin plots show distribution of expression levels for Tectonin beta-propeller repeat containing 2 (SMED30002327) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tectonin beta-propeller repeat containing 2 (SMED30002327) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tectonin beta-propeller repeat containing 2 (SMED30002327) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002327

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30002327h1SMcG0010056 dd_Smed_v4_5998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002327h1SMcG0010056 dd_Smed_v4_5998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002327h1SMcG0010056 dd_Smed_v4_5998_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Human
Match: TECPR2 (tectonin beta-propeller repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:19957])

HSP 1 Score: 108.612 bits (270), Expect = 6.222e-23
Identity = 81/308 (26.30%), Postives = 143/308 (46.43%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKF---YLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  N +       K   I+ +KL+   D  +A G   G V +  +  +      ++ +F V   HK  I+A+ WS N  KL++GD+ G I  + +D      ++  V +  S + QL Y  K L++S    + ++         IG + R     FG   +  LCK  ++ + + RP  ++W +D++G V+ + ILK D+     K   L P + S +         SG       +LGL+S    E  +L W+E SI + D  +   ++     G I ++S
Sbjct:   36 VYLTALDTNGDYIAVGSSIGMLYLYCRHLNQMRKYNFEGKTESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRFDVTGIHKNSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCNSQLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEEKSVRQIGTQPRKSTGKFGACFIPGLCKQSDLTLYASRPGLRLWKADVHGTVQATFILK-DAFAGGVKPFELHPRLESPN---------SGSCSLPERHLGLVSCFFQEGWVLSWNEYSIYLLDTVNQATVAGLEGSGDIVSVS 333          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Human
Match: TECPR2 (tectonin beta-propeller repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:19957])

HSP 1 Score: 108.227 bits (269), Expect = 7.954e-23
Identity = 81/308 (26.30%), Postives = 143/308 (46.43%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKF---YLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  N +       K   I+ +KL+   D  +A G   G V +  +  +      ++ +F V   HK  I+A+ WS N  KL++GD+ G I  + +D      ++  V +  S + QL Y  K L++S    + ++         IG + R     FG   +  LCK  ++ + + RP  ++W +D++G V+ + ILK D+     K   L P + S +         SG       +LGL+S    E  +L W+E SI + D  +   ++     G I ++S
Sbjct:   36 VYLTALDTNGDYIAVGSSIGMLYLYCRHLNQMRKYNFEGKTESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRFDVTGIHKNSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCNSQLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEEKSVRQIGTQPRKSTGKFGACFIPGLCKQSDLTLYASRPGLRLWKADVHGTVQATFILK-DAFAGGVKPFELHPRLESPN---------SGSCSLPERHLGLVSCFFQEGWVLSWNEYSIYLLDTVNQATVAGLEGSGDIVSVS 333          

HSP 2 Score: 68.9366 bits (167), Expect = 8.759e-11
Identity = 134/636 (21.07%), Postives = 249/636 (39.15%), Query Frame = 1
Query: 2653 KLASSPNGFILWR--EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNG-IWFQITLQ--FLYQTSSTFEDNIA---SLSSGIQNKVEKMFGYSEMDTKFKKA---NLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLP-GLPALTSWAAIEFSPPNT-----LWLLHKSGELFCYFDERIIR----TVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLI-FENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKH---SWTIIEGNVSLSESESTLAEFVKPDDWELL 4479
            ++A SP+G +LW+  +KS        VT           +  K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +T  N ++W +TE          Q     +            W+      D+V E +         E +  I LG     W L I    ++   + S+ P G+   W+Q+++    ++   S F+  I    S+++  Q  VEK+        K + A     + C  S+L            N  +WI+S +         +  +++G +W           + +P G  + T WA +  S   T     LWL   S +L C    +  +    TV +P     +   +     L  L +  +VFIR  ++++ P G  W  +  +     K+ +++C +  IW       V++    + L  + S  LP W   I          VS V +  S N   +WV+   +  +V            AW ++ G  A  + +S   VW      G+L  R GV   N P GDYW  +P     V   TV+  ++++ +     LL+    +++   G    S++     E ++ D+WE++
Sbjct:  853 QVAVSPSGALLWKIEQKSNRAFACGKVT-----------IKGKRHWYEALPQAVFVALSDDTAWIIRTSGDLYLQTGLSVDRPCARAVKVDCPYPLSQITARNNVVWALTE----------QRALLYREGVSSFCPEGEQWKC-----DIVSERQ-------ALEPV-CITLGDQQTLWALDIHGNLWFRTGIISKKPQGDDDHWWQVSITDYVVFDQCSLFQTIIHATHSVATAAQAPVEKVA------DKLRMAFWSQQLQCQPSLL---------GVNNSGVWISSGKNE----FHVAKGSLIGTYW----------NHVVPRGTASATKWAFVLASAAPTKEGSFLWLCQSSKDL-CSVSAQSAQSRPSTVQLPP-EAEMRAYAACQDALWALDSLGQVFIRT-LSKSCPTGMHWTRLDLSQLGAVKLTSLACGNQHIWACDSRGGVYFRVGTQPL--NPSLMLPAW---IMIEPPVQPAGVSLVSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVW-ARCPNGDLARRYGVTDKN-PAGDYWKKIP---GSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLE-DEWEVI 1411          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Human
Match: HPS5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:HGNC Symbol;Acc:HGNC:17022])

HSP 1 Score: 80.4925 bits (197), Expect = 2.286e-14
Identity = 77/319 (24.14%), Postives = 147/319 (46.08%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHK-TLISAMCWSKNSEKLYTGDNNGFIFCTEVD--HVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
             +  TSI V+R  + LG++ G + +I +        L  ++  IS++      D  +A+  + G V +  +   +     +  Q  V S+HK   ++A+CW     +++ GD+ G +   +++    AK  +A+ ++  Q  + V+    QL Y    L+IS    +F+ +    +   IGNK R+ +  +G       C   +  +I   RP  ++W  + +G V  +   K        KL+SL  LP +T +S+  +     S +S  +  L+ L  E+ +L W+E  I IF   +  +L  S  +  IQ++++C 
Sbjct:   34 RLKCTSIAVSRKWLALGSSGGGLHLIQKEGWKHRLFLSHREGAISQVACCLHDDDYVAVATSQGLVVVWEL---NQERRGKPEQMYVSSEHKGRRVTALCWDTAILRVFVGDHAGKVSAIKLNTSKQAKAAAAFVMFPVQTITTVDSCVVQLDYLDGRLLISSLTRSFLCDTEREKFWKIGNKERDGE--YGACFFPGRCSGGQQPLIYCARPGSRMWEVNFDGEVISTHQFK--------KLLSLPPLPVITLRSEPQYDHTAGSSQSLSFPKLLHL-SEHCVLTWTERGIYIFIPQNVQVLLWS-EVKDIQDVAVCR 337          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Human
Match: HPS5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:HGNC Symbol;Acc:HGNC:17022])

HSP 1 Score: 80.4925 bits (197), Expect = 2.286e-14
Identity = 77/319 (24.14%), Postives = 147/319 (46.08%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHK-TLISAMCWSKNSEKLYTGDNNGFIFCTEVD--HVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
             +  TSI V+R  + LG++ G + +I +        L  ++  IS++      D  +A+  + G V +  +   +     +  Q  V S+HK   ++A+CW     +++ GD+ G +   +++    AK  +A+ ++  Q  + V+    QL Y    L+IS    +F+ +    +   IGNK R+ +  +G       C   +  +I   RP  ++W  + +G V  +   K        KL+SL  LP +T +S+  +     S +S  +  L+ L  E+ +L W+E  I IF   +  +L  S  +  IQ++++C 
Sbjct:   34 RLKCTSIAVSRKWLALGSSGGGLHLIQKEGWKHRLFLSHREGAISQVACCLHDDDYVAVATSQGLVVVWEL---NQERRGKPEQMYVSSEHKGRRVTALCWDTAILRVFVGDHAGKVSAIKLNTSKQAKAAAAFVMFPVQTITTVDSCVVQLDYLDGRLLISSLTRSFLCDTEREKFWKIGNKERDGE--YGACFFPGRCSGGQQPLIYCARPGSRMWEVNFDGEVISTHQFK--------KLLSLPPLPVITLRSEPQYDHTAGSSQSLSFPKLLHL-SEHCVLTWTERGIYIFIPQNVQVLLWS-EVKDIQDVAVCR 337          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Human
Match: HPS5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:HGNC Symbol;Acc:HGNC:17022])

HSP 1 Score: 61.6178 bits (148), Expect = 1.120e-8
Identity = 60/233 (25.75%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  448 VPSDHK-TLISAMCWSKNSEKLYTGDNNGFIFCTEVD--HVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
            V S+HK   ++A+CW     +++ GD+ G +   +++    AK  +A+ ++  Q  + V+    QL Y    L+IS    +F+ +    +   IGNK R+ +  +G       C   +  +I   RP  ++W  + +G V  +   K        KL+SL  LP +T +S+  +     S +S  +  L+ L  E+ +L W+E  I IF   +  +L  S  +  IQ++++C 
Sbjct:    3 VSSEHKGRRVTALCWDTAILRVFVGDHAGKVSAIKLNTSKQAKAAAAFVMFPVQTITTVDSCVVQLDYLDGRLLISSLTRSFLCDTEREKFWKIGNKERDGE--YGACFFPGRCSGGQQPLIYCARPGSRMWEVNFDGEVISTHQFK--------KLLSLPPLPVITLRSEPQYDHTAGSSQSLSFPKLLHL-SEHCVLTWTERGIYIFIPQNVQVLLWS-EVKDIQDVAVCR 223          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Celegans
Match: W09G3.6 (pep chromosome:WBcel235:I:13814756:13827988:-1 gene:WBGene00012369.1 transcript:W09G3.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09G3.6)

HSP 1 Score: 56.9954 bits (136), Expect = 1.242e-7
Identity = 45/222 (20.27%), Postives = 104/222 (46.85%), Query Frame = 1
Query:  229 IVLGTNNGNIFIINR--------SNNAIE---NILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQ--FSVPSDHKT--LISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCF-SPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKS 846
            + LGT+ G+++I +R        +N+       +   +D  IS + +  + +L +AIG + G V +        LN  +     +S P D ++   ++A+ WS + + +Y+G ++G + C  +   +   +A++    F   + Q+      ++I+ S    +++        +G K R+     G   V+     +   +++ RPNG++W +++ G+V ++
Sbjct:   58 LCLGTSTGSVYIFSRYAAKSRSRTNSGAPVPVQVFTTRDGQISTISVSPSEEL-MAIGGDSGRVSVA------QLNNGQPPTLIYSTPGDARSPDRVTALSWSADLKTVYSGHSSGTLHCHRLTSRSVFRAAHQKLMKFDGEIIQIDTLQSHVLIATSLAAHLFHVESGTIQQVGKKTRSSPAPLGACYVH----GESAFIVAARPNGRLWEANLVGVVYRT 268          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Fly
Match: CG11141 (gene:FBgn0033177 transcript:FBtr0088999)

HSP 1 Score: 93.5893 bits (231), Expect = 6.751e-19
Identity = 64/248 (25.81%), Postives = 128/248 (51.61%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAI----PFNDSL-----NYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD---HVAKTV----SAYEVYQCFSPVNQ----LAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVF 873
            N+++T +D   + + +G++ G +F  NR    ++ +  +    I+ ++++++++  +A G  +G V I  I    P +  L         + ++++   HK ++S   WSKN  KLY+GD  G +  TE+D   H++K+V     AYE+ Q    V Q    +A  ++C++    A+T  WN        +G K+R +    G +I  K  ++++ +++  RP  + W++D  G V K++I + D+V 
Sbjct:   35 NLNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKLKAEVATRITCVRVVNSVEYMVAAGCANGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLHKCVVSCCEWSKNGMKLYSGDRQGVVVLTELDYQAHLSKSVEILSEAYEIVQLS--VRQSYLLVATLYRCIVCQMDAQTSQWNIT-----QVGKKDRKQLIDCG-AIFLKKQEANKPQLVCGRPGLRFWVADAAGNVSKTVIFR-DAVL 273          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Fly
Match: CG11141 (gene:FBgn0033177 transcript:FBtr0088998)

HSP 1 Score: 93.5893 bits (231), Expect = 6.751e-19
Identity = 64/248 (25.81%), Postives = 128/248 (51.61%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAI----PFNDSL-----NYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD---HVAKTV----SAYEVYQCFSPVNQ----LAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVF 873
            N+++T +D   + + +G++ G +F  NR    ++ +  +    I+ ++++++++  +A G  +G V I  I    P +  L         + ++++   HK ++S   WSKN  KLY+GD  G +  TE+D   H++K+V     AYE+ Q    V Q    +A  ++C++    A+T  WN        +G K+R +    G +I  K  ++++ +++  RP  + W++D  G V K++I + D+V 
Sbjct:   35 NLNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKLKAEVATRITCVRVVNSVEYMVAAGCANGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLHKCVVSCCEWSKNGMKLYSGDRQGVVVLTELDYQAHLSKSVEILSEAYEIVQLS--VRQSYLLVATLYRCIVCQMDAQTSQWNIT-----QVGKKDRKQLIDCG-AIFLKKQEANKPQLVCGRPGLRFWVADAAGNVSKTVIFR-DAVL 273          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Fly
Match: CG11141 (gene:FBgn0033177 transcript:FBtr0345799)

HSP 1 Score: 93.5893 bits (231), Expect = 6.751e-19
Identity = 64/248 (25.81%), Postives = 128/248 (51.61%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAI----PFNDSL-----NYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD---HVAKTV----SAYEVYQCFSPVNQ----LAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVF 873
            N+++T +D   + + +G++ G +F  NR    ++ +  +    I+ ++++++++  +A G  +G V I  I    P +  L         + ++++   HK ++S   WSKN  KLY+GD  G +  TE+D   H++K+V     AYE+ Q    V Q    +A  ++C++    A+T  WN        +G K+R +    G +I  K  ++++ +++  RP  + W++D  G V K++I + D+V 
Sbjct:   35 NLNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKLKAEVATRITCVRVVNSVEYMVAAGCANGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLHKCVVSCCEWSKNGMKLYSGDRQGVVVLTELDYQAHLSKSVEILSEAYEIVQLS--VRQSYLLVATLYRCIVCQMDAQTSQWNIT-----QVGKKDRKQLIDCG-AIFLKKQEANKPQLVCGRPGLRFWVADAAGNVSKTVIFR-DAVL 273          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Zebrafish
Match: tecpr2 (tectonin beta-propeller repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060503-358])

HSP 1 Score: 109.383 bits (272), Expect = 2.415e-23
Identity = 79/307 (25.73%), Postives = 143/307 (46.58%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISG--KSKFYLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  + +    L  K   I+ +KL+   D  +A+G   G V    +         ++ +F V   HK+ I+A+ WS N  KL++GD+ G +  + VD      +   +++  S + QL Y  K L++S    + ++         +G+K R     FG      LCK  ++ V + RP  ++W +D+ G V ++ +LKP  +F  D             + F       G   S+  LG+IS  + E  +L W+E S+ + D  +  I+    + G I ++S
Sbjct:   36 VYLTALDSNSDYIAIGSSIGMLYLYCRRVSQMNKYNLEGKCEAITAVKLLSCFDDLVAVGTASGRVAFFQLVSPLPGRNKQLRRFDVVGLHKSTITALAWSANGMKLFSGDDKGKVVYSAVDLDQGVCNPVVLFEEPSAIVQLEYSQKVLLVSSYQRSMLFYTQEQSHQQLGSKPRKSNGKFGACFQPALCKQSDLVVYAARPGLRLWRTDVRGRVGETHVLKP--LFNQD---------VPHFELFPRSGPTGGYRPSERQLGMISCFLKEGWVLSWNEYSVYVVDCTNQVIIGGLESSGDIVSVS 331          

HSP 2 Score: 62.7734 bits (151), Expect = 3.373e-9
Identity = 117/572 (20.45%), Postives = 227/572 (39.69%), Query Frame = 1
Query: 2653 KLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIG-NGIWFQITLQ--------FLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLP-GLPALTSWA-----AIEFSPPNTLWLLHKSGELFCYFDERI-IRTVTI---PTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEP---FGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVP 4302
            ++A SP+G +LW+ +   ++ Y         KV    +  K++W   + +   + + ++ A ++   G L +  G+S+  P  +S  V+    +  +    G++W ++E          + VF  +  +        +W+      D V E +       G E I  I LG  N  W L      ++   V+++ P G +  W+Q+++          L+QT       +A+++     +V +      +   F   +     S I +++  V          WI S  RN       +  +++G +W          ++ +P G  + T WA     A+     + LWL     +LFC +D+ + +R  TI   P +   ++++S     L  L    +V IR  ++ +   G  W  +  +   + +  ++SC    +W    N + Y   +     + S  LP + +  ++ +  A     V+I  S N   +W +         +  +  +P     AW +I G  A  + +S    W V  A G +  R G+   N P GDYW  +P
Sbjct:  801 QVALSPSGSLLWKVEQKTMTAYA------CGKVT---IKGKRHWYKALDDTAFVALGDDTAWIIRTNGDLYIQTGLSADRPCARSVKVDCPCPMAQMAARGGVVWALSE---------QRGVFYREGLNSYCA-EGEHWK-----YDTVSESQ-------GLEPI-CIALGENNTVWALDTSGNLWFRTGVTAKKPQGEDDHWWQVSITDYVVFDQGSLFQTLIQATQTVATVTRAPVERVAE-----RLRVAFLSQHSQCQPSLISVNISGV----------WIASG-RNE---FHVAKGSLIGTYW----------RSTVPRGTASATKWAFVFSSAVPAKEGSFLWLGQSRKDLFCIWDQDLQMRPFTIQFPPDV--EMMQLSACRDALWGLDHYGRVHIRT-LSASCSTGMHWSLLDLSQLGHVRFLSLSCGSQNVWACDTNGMVYFR-VGTQPLNPSMMLP-AWICIESPEQPAGHY-LVKIQTSPNDRMLWALDNRGNVLVRIGITEEMPV--GTAWEHIPGLQACQLVLSMRTAW-VRLANGQVARRYGITEKN-PAGDYWKKIP 1301          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Zebrafish
Match: tecpr2 (tectonin beta-propeller repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060503-358])

HSP 1 Score: 108.997 bits (271), Expect = 2.998e-23
Identity = 79/307 (25.73%), Postives = 143/307 (46.58%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISG--KSKFYLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  + +    L  K   I+ +KL+   D  +A+G   G V    +         ++ +F V   HK+ I+A+ WS N  KL++GD+ G +  + VD      +   +++  S + QL Y  K L++S    + ++         +G+K R     FG      LCK  ++ V + RP  ++W +D+ G V ++ +LKP  +F  D             + F       G   S+  LG+IS  + E  +L W+E S+ + D  +  I+    + G I ++S
Sbjct:   36 VYLTALDSNSDYIAIGSSIGMLYLYCRRVSQMNKYNLEGKCEAITAVKLLSCFDDLVAVGTASGRVAFFQLVSPLPGRNKQLRRFDVVGLHKSTITALAWSANGMKLFSGDDKGKVVYSAVDLDQGVCNPVVLFEEPSAIVQLEYSQKVLLVSSYQRSMLFYTQEQSHQQLGSKPRKSNGKFGACFQPALCKQSDLVVYAARPGLRLWRTDVRGRVGETHVLKP--LFNQD---------VPHFELFPRSGPTGGYRPSERQLGMISCFLKEGWVLSWNEYSVYVVDCTNQVIIGGLESSGDIVSVS 331          

HSP 2 Score: 63.5438 bits (153), Expect = 2.154e-9
Identity = 117/572 (20.45%), Postives = 227/572 (39.69%), Query Frame = 1
Query: 2653 KLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIG-NGIWFQITLQ--------FLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLP-GLPALTSWA-----AIEFSPPNTLWLLHKSGELFCYFDERI-IRTVTI---PTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEP---FGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVP 4302
            ++A SP+G +LW+ +   ++ Y         KV    +  K++W   + +   + + ++ A ++   G L +  G+S+  P  +S  V+    +  +    G++W ++E          + VF  +  +        +W+      D V E +       G E I  I LG  N  W L      ++   V+++ P G +  W+Q+++          L+QT       +A+++     +V +      +   F   +     S I +++  V          WI S  RN       +  +++G +W          ++ +P G  + T WA     A+     + LWL     +LFC +D+ + +R  TI   P +   ++++S     L  L    +V IR  ++ +   G  W  +  +   + +  ++SC    +W    N + Y   +     + S  LP + +  ++ +  A     V+I  S N   +W +         +  +  +P     AW +I G  A  + +S    W V  A G +  R G+   N P GDYW  +P
Sbjct:  751 QVALSPSGSLLWKVEQKTMTAYA------CGKVT---IKGKRHWYKALDDTAFVALGDDTAWIIRTNGDLYIQTGLSADRPCARSVKVDCPCPMAQMAARGGVVWALSE---------QRGVFYREGLNSYCA-EGEHWKY-----DTVSESQ-------GLEPI-CIALGENNTVWALDTSGNLWFRTGVTAKKPQGEDDHWWQVSITDYVVFDQGSLFQTLIQATQTVATVTRAPVERVAE-----RLRVAFLSQHSQCQPSLISVNISGV----------WIASG-RNE---FHVAKGSLIGTYW----------RSTVPRGTASATKWAFVFSSAVPAKEGSFLWLGQSRKDLFCIWDQDLQMRPFTIQFPPDV--EMMQLSACRDALWGLDHYGRVHIRT-LSASCSTGMHWSLLDLSQLGHVRFLSLSCGSQNVWACDTNGMVYFR-VGTQPLNPSMMLP-AWICIESPEQPAGHY-LVKIQTSPNDRMLWALDNRGNVLVRIGITEEMPV--GTAWEHIPGLQACQLVLSMRTAW-VRLANGQVARRYGITEKN-PAGDYWKKIP 1251          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Zebrafish
Match: hps5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:ZFIN;Acc:ZDB-GENE-070410-80])

HSP 1 Score: 75.0998 bits (183), Expect = 6.198e-13
Identity = 67/308 (21.75%), Postives = 136/308 (44.16%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEV--DHVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVIS--------VRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNIL 1062
             +  T + V+R  + LGT+ G + +I R     + IL  K+  I+++      +  IA+  + G V +  +            + SV  +H+ + ++++CW   + +++ GD  G + C       + K  SA+ ++  Q  + V+    QL Y    L+IS  +  ++ +    +   +GNK R+ +  FG   + +       +++          RP  +IW +  +G V  +   K      P      LP V+ +++  F     + +S  +  L+   D+N +L W++++I IF   SG +L
Sbjct:   33 RIKCTCLSVSRKWLALGTSAGGLHLIQRDGWKQKLILTHKEGSITQVSCCPHDEDFIAVATSQGLVVVWELHLE---RRGRPERASVSWEHRGVTVTSLCWDTVALRVFAGDMGGKVSCVRAGSSKLGKG-SAFVIFPVQTVTTVDSRVVQLGYTDGHLVISSLSRCYLCDTEREKFWRVGNKERDGE--FGACFLTQGLAGQRGQLVGCPAPLLFCARPGSRIWEASFSGEVLSTHQFKQLLAVPP------LPLVSCKNEPHFNPTQTNPQSLAFPRLLQFGDQN-LLTWTDSAIYIFTPHSGQVL 327          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Xenopus
Match: TECPR2 (tectonin beta-propeller repeat containing 2 [Source:NCBI gene;Acc:100495806])

HSP 1 Score: 118.627 bits (296), Expect = 5.459e-26
Identity = 82/308 (26.62%), Postives = 152/308 (49.35%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLK-KDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLI-SLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
            V +T++D N D I +G++ G +++  R  + ++   L+ K   IS +KL+   D  +A+G   G V +  +         ++ +F V   HK+ I+A+ WS N  KL++GD+ G I  +++D      +   + +  S V QL Y  K L++S +    ++         +G + R     +G   +  LCK  ++++ + RP  ++W SD++G V+ + ILK   +F   +   L P V + +K  F   V+S K   + GL+   + E  +L W E SI + D  +  ++    + G I ++S  N
Sbjct:   35 VYLTALDANSDFIAVGSSIGMLYLYCRHTSQMKKYSLEGKTESISVVKLLSCFDDLVAVGTVSGRVAVFQLVSPLPGRNKQLRRFDVLGIHKSNITALAWSPNGMKLFSGDDRGKIIQSDLDFDKGLCNPSLILEELSSVVQLDYSQKVLLVSTTQRCLLFYTEEKAVKQVGTQPRKSNGKYGACFIPGLCKQSDLKLFASRPGLRLWKSDVHGCVQSTFILK--DMFKGLEQFELYPRVETSNKDSF---VLSEK---HFGLLYCFLHEGWVLSWDEYSIYLIDTVNQAVIGGLESSGDIVSVSCTN 334          

HSP 2 Score: 69.3218 bits (168), Expect = 5.104e-11
Identity = 128/631 (20.29%), Postives = 241/631 (38.19%), Query Frame = 1
Query: 2653 KLASSPNGFILWR-EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIG-NGIWFQITLQ--------FLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDR-NILGHHWIDCFSVLQNPKNRLP-GLPALTSWAAIEFSPP-----NTLWLLHKSGELFCYFD---ERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPDDWELL 4479
            ++A SP+G +LW+ E+  + +   G   I            K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +T  N ++W +TE          Q     +      +     W+      DL+ E +         E +  + LG  +  WIL      ++   ++++NP G +  W+Q+ +          L+QT       +A+++   Q  VEK+    ++   F         S + ++   V          WITS +       F   R N++G +W           N +P G  + T WA +  S       N LW+     +LFC  D        TV +P     IV +S     +  L     VFIR  +++  P G  W ++  +      + ++SC +  IW    + V Y   +     + S  LP W   I          ++ + ++ S N   +W +      YV             W ++ G  A  + VS   VW      G++  R G+   N   GDYW  +P     +   TV+  ++++ + +   LL+          ++ + +S L      D+WE++
Sbjct:  840 QVAVSPSGALLWKVEQRSDKAFACGKVTIKG----------KRHWYEALPQAAFVALSDDTAWIIRTNGDLYLQTGLSVDRPCARAVKVDCPCPLSQITARNHVVWALTE----------QRGLLFREGVNSFSPEGEAWKC-----DLISERQ-------ALEPV-CVTLGDQDTVWILDASGNLWFRSGITAKNPQGEDDHWWQVNITDYVVFDHYTLFQTLLQATQTVATVA---QAPVEKV--ADKLRMTFWSQQPQGQPSLLGVNSSGV----------WITSGKNE-----FHVARGNLVGTYW----------HNIVPRGTASTTKWATVSASASPTAEGNILWISQSRKDLFCLSDLNPPYRPSTVQLPP-ETEIVHLSACGDAVWALDNHGGVFIRT-LSKTCPTGMHWTKLDLSQLGPVTLCSLSCGNQHIWACDTSGVIYFR-VGTQPLNPSMMLPAW---IMIEPPIQPVGINLIGVYSSPNDKMLWTLDNRCNVYVRVGITEEMPVGVDWEHVPGLQACQLAVSMRTVW-ARCPNGDIARRYGITEKNS-AGDYWKKIP---GNMAWFTVTPLDELWAVGNTGYLLQRLTKTYSHYPNIPKHDSVLVNSDFEDEWEVI 1396          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Xenopus
Match: TECPR2 (tectonin beta-propeller repeat containing 2 [Source:NCBI gene;Acc:100495806])

HSP 1 Score: 118.242 bits (295), Expect = 7.000e-26
Identity = 82/308 (26.62%), Postives = 152/308 (49.35%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLK-KDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLI-SLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
            V +T++D N D I +G++ G +++  R  + ++   L+ K   IS +KL+   D  +A+G   G V +  +         ++ +F V   HK+ I+A+ WS N  KL++GD+ G I  +++D      +   + +  S V QL Y  K L++S +    ++         +G + R     +G   +  LCK  ++++ + RP  ++W SD++G V+ + ILK   +F   +   L P V + +K  F   V+S K   + GL+   + E  +L W E SI + D  +  ++    + G I ++S  N
Sbjct:   35 VYLTALDANSDFIAVGSSIGMLYLYCRHTSQMKKYSLEGKTESISVVKLLSCFDDLVAVGTVSGRVAVFQLVSPLPGRNKQLRRFDVLGIHKSNITALAWSPNGMKLFSGDDRGKIIQSDLDFDKGLCNPSLILEELSSVVQLDYSQKVLLVSTTQRCLLFYTEEKAVKQVGTQPRKSNGKYGACFIPGLCKQSDLKLFASRPGLRLWKSDVHGCVQSTFILK--DMFKGLEQFELYPRVETSNKDSF---VLSEK---HFGLLYCFLHEGWVLSWDEYSIYLIDTVNQAVIGGLESSGDIVSVSCTN 334          

HSP 2 Score: 64.3142 bits (155), Expect = 1.616e-9
Identity = 128/632 (20.25%), Postives = 239/632 (37.82%), Query Frame = 1
Query: 2653 KLASSPNGFILWR-EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIG-NGIWFQITLQ--------FLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDR-NILGHHWIDCFSVLQNPKNRLP-GLPALTSWAAIEFSPPNTL-----WLLHKS-GELFCYFD---ERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPDDWELL 4479
            ++A SP+G +LW+ E+  + +   G   I            K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +T  N ++W +TE          Q     +      +     W+      DL+ E +         E +  + LG  +  WIL      ++   ++++NP G +  W+Q+ +          L+QT       +A+++   Q  VEK+    ++   F         S + ++   V          WITS +       F   R N++G +W           N +P G  + T WA +  S   T      W  H     LFC  D        TV +P     IV +S     +  L     VFIR  +++  P G  W ++  +      + ++SC +  IW    + V Y   +     + S  LP W   I          ++ + ++ S N   +W +      YV             W ++ G  A  + VS   VW      G++  R G+   N   GDYW  +P     +   TV+  ++++ + +   LL+          ++ + +S L      D+WE++
Sbjct:  754 QVAVSPSGALLWKVEQRSDKAFACGKVTIKG----------KRHWYEALPQAAFVALSDDTAWIIRTNGDLYLQTGLSVDRPCARAVKVDCPCPLSQITARNHVVWALTE----------QRGLLFREGVNSFSPEGEAWKC-----DLISERQ-------ALEPV-CVTLGDQDTVWILDASGNLWFRSGITAKNPQGEDDHWWQVNITDYVVFDHYTLFQTLLQATQTVATVA---QAPVEKV--ADKLRMTFWSQQPQGQPSLLGVNSSGV----------WITSGKNE-----FHVARGNLVGTYW----------HNIVPRGTASTTKWATVSASASPTAEGSLKWTCHPDIKNLFCLSDLNPPYRPSTVQLPP-ETEIVHLSACGDAVWALDNHGGVFIRT-LSKTCPTGMHWTKLDLSQLGPVTLCSLSCGNQHIWACDTSGVIYFR-VGTQPLNPSMMLPAW---IMIEPPIQPVGINLIGVYSSPNDKMLWTLDNRCNVYVRVGITEEMPVGVDWEHVPGLQACQLAVSMRTVW-ARCPNGDIARRYGITEKNS-AGDYWKKIP---GNMAWFTVTPLDELWAVGNTGYLLQRLTKTYSHYPNIPKHDSVLVNSDFEDEWEVI 1311          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Xenopus
Match: TECPR2 (tectonin beta-propeller repeat containing 2 [Source:NCBI gene;Acc:100495806])

HSP 1 Score: 117.857 bits (294), Expect = 8.591e-26
Identity = 82/308 (26.62%), Postives = 152/308 (49.35%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLK-KDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLI-SLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
            V +T++D N D I +G++ G +++  R  + ++   L+ K   IS +KL+   D  +A+G   G V +  +         ++ +F V   HK+ I+A+ WS N  KL++GD+ G I  +++D      +   + +  S V QL Y  K L++S +    ++         +G + R     +G   +  LCK  ++++ + RP  ++W SD++G V+ + ILK   +F   +   L P V + +K  F   V+S K   + GL+   + E  +L W E SI + D  +  ++    + G I ++S  N
Sbjct:   35 VYLTALDANSDFIAVGSSIGMLYLYCRHTSQMKKYSLEGKTESISVVKLLSCFDDLVAVGTVSGRVAVFQLVSPLPGRNKQLRRFDVLGIHKSNITALAWSPNGMKLFSGDDRGKIIQSDLDFDKGLCNPSLILEELSSVVQLDYSQKVLLVSTTQRCLLFYTEEKAVKQVGTQPRKSNGKYGACFIPGLCKQSDLKLFASRPGLRLWKSDVHGCVQSTFILK--DMFKGLEQFELYPRVETSNKDSF---VLSEK---HFGLLYCFLHEGWVLSWDEYSIYLIDTVNQAVIGGLESSGDIVSVSCTN 334          

HSP 2 Score: 64.3142 bits (155), Expect = 1.614e-9
Identity = 128/632 (20.25%), Postives = 239/632 (37.82%), Query Frame = 1
Query: 2653 KLASSPNGFILWR-EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIG-NGIWFQITLQ--------FLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDR-NILGHHWIDCFSVLQNPKNRLP-GLPALTSWAAIEFSPPNTL-----WLLHKS-GELFCYFD---ERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPDDWELL 4479
            ++A SP+G +LW+ E+  + +   G   I            K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +T  N ++W +TE          Q     +      +     W+      DL+ E +         E +  + LG  +  WIL      ++   ++++NP G +  W+Q+ +          L+QT       +A+++   Q  VEK+    ++   F         S + ++   V          WITS +       F   R N++G +W           N +P G  + T WA +  S   T      W  H     LFC  D        TV +P     IV +S     +  L     VFIR  +++  P G  W ++  +      + ++SC +  IW    + V Y   +     + S  LP W   I          ++ + ++ S N   +W +      YV             W ++ G  A  + VS   VW      G++  R G+   N   GDYW  +P     +   TV+  ++++ + +   LL+          ++ + +S L      D+WE++
Sbjct:  792 QVAVSPSGALLWKVEQRSDKAFACGKVTIKG----------KRHWYEALPQAAFVALSDDTAWIIRTNGDLYLQTGLSVDRPCARAVKVDCPCPLSQITARNHVVWALTE----------QRGLLFREGVNSFSPEGEAWKC-----DLISERQ-------ALEPV-CVTLGDQDTVWILDASGNLWFRSGITAKNPQGEDDHWWQVNITDYVVFDHYTLFQTLLQATQTVATVA---QAPVEKV--ADKLRMTFWSQQPQGQPSLLGVNSSGV----------WITSGKNE-----FHVARGNLVGTYW----------HNIVPRGTASTTKWATVSASASPTAEGSLKWTCHPDIKNLFCLSDLNPPYRPSTVQLPP-ETEIVHLSACGDAVWALDNHGGVFIRT-LSKTCPTGMHWTKLDLSQLGPVTLCSLSCGNQHIWACDTSGVIYFR-VGTQPLNPSMMLPAW---IMIEPPIQPVGINLIGVYSSPNDKMLWTLDNRCNVYVRVGITEEMPVGVDWEHVPGLQACQLAVSMRTVW-ARCPNGDIARRYGITEKNS-AGDYWKKIP---GNMAWFTVTPLDELWAVGNTGYLLQRLTKTYSHYPNIPKHDSVLVNSDFEDEWEVI 1349          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Xenopus
Match: hps5 (Hermansky-Pudlak syndrome 5 [Source:NCBI gene;Acc:100036709])

HSP 1 Score: 59.6918 bits (143), Expect = 3.999e-8
Identity = 62/315 (19.68%), Postives = 133/315 (42.22%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEVD--HVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKT-FFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISI 1104
             +  T + V+R  + LG++ G + +I R       IL  K+  IS++      +  +A+  + G V +  +   +     +  +  V ++H+   ++A+CW     +++ GD+ G +   +++     K   A+ ++  Q  + V+    QL Y    L+IS    +++ +    +   IGNK R+ +         +     +  +   RP  ++W  +  G V+ +   K        +L+S  P      +    +D+            +  + E+ +L W++ +I IF   +  +L  S  +  IQ+ISI
Sbjct:   34 RLKCTCLSVSRKWLALGSSGGGLNLIQRDGWKQRLILTHKEGAISRVSCCGHDEDYVAVATSQGIVVVWEL---NQERRGKPERIYVSTEHRGRKVTALCWDTTVLRVFVGDHLGKVTAIKLNSSKQGKVAPAFVMFPVQIITTVDSRVVQLDYLDGKLLISSRTRSYLCDTEREKFWKIGNKERDGEYGACFFPAGRNLAGQQPLIYCARPGSRMWEVNFEGEVQSTHQFK--------QLLSSPPLPIIHPRLDLQYDSTQRPPQSLAFAKLLYLSEHSVLTWTDRAIYIFIPQNVQVLLWS-EVRDIQDISI 336          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Xenopus
Match: hps5 (Hermansky-Pudlak syndrome 5 [Source:NCBI gene;Acc:100036709])

HSP 1 Score: 59.6918 bits (143), Expect = 4.192e-8
Identity = 62/315 (19.68%), Postives = 133/315 (42.22%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEVD--HVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKT-FFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISI 1104
             +  T + V+R  + LG++ G + +I R       IL  K+  IS++      +  +A+  + G V +  +   +     +  +  V ++H+   ++A+CW     +++ GD+ G +   +++     K   A+ ++  Q  + V+    QL Y    L+IS    +++ +    +   IGNK R+ +         +     +  +   RP  ++W  +  G V+ +   K        +L+S  P      +    +D+            +  + E+ +L W++ +I IF   +  +L  S  +  IQ+ISI
Sbjct:   34 RLKCTCLSVSRKWLALGSSGGGLNLIQRDGWKQRLILTHKEGAISRVSCCGHDEDYVAVATSQGIVVVWEL---NQERRGKPERIYVSTEHRGRKVTALCWDTTVLRVFVGDHLGKVTAIKLNSSKQGKVAPAFVMFPVQIITTVDSRVVQLDYLDGKLLISSRTRSYLCDTEREKFWKIGNKERDGEYGACFFPAGRNLAGQQPLIYCARPGSRMWEVNFEGEVQSTHQFK--------QLLSSPPLPIIHPRLDLQYDSTQRPPQSLAFAKLLYLSEHSVLTWTDRAIYIFIPQNVQVLLWS-EVRDIQDISI 336          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Mouse
Match: Tecpr2 (tectonin beta-propeller repeat containing 2 [Source:MGI Symbol;Acc:MGI:2144865])

HSP 1 Score: 112.849 bits (281), Expect = 4.763e-26
Identity = 84/315 (26.67%), Postives = 150/315 (47.62%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFA----PDKLMSLL------PCVTSQSKTFFFDNVISGKSKFYLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  N ++   +  K   I+ +KL+   D  +A G   G V +  +  +      ++ +F V   HKT I+A+ WS N  KL++GD+ G I  + +D      S++ V +  S + QL Y  K L++S    + ++         IG++ R     FG   +  LCK  ++ + + RP  ++W +D++G V+ + ILK   VFA    P +L   L       C++ +                +LGL+S    E  +L W+E SI + D  +   ++    LG I ++S
Sbjct:   36 VYLTALDTNGDYIAVGSSIGMLYLYCRHLNQMKKYNVDGKMESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRFDVTGVHKTSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCSSHLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEEKAVKQIGSQPRKSTGKFGACFIPGLCKQSDLTLYAARPGLRLWKADVHGTVQATYILK--DVFAGGVTPFELYPRLEPSDGGSCISPEK---------------HLGLVSCFFREGWVLSWNEYSIYLLDTVNQATVAGLEGLGDIVSVS 333          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Mouse
Match: Tecpr2 (tectonin beta-propeller repeat containing 2 [Source:MGI Symbol;Acc:MGI:2144865])

HSP 1 Score: 113.62 bits (283), Expect = 1.392e-24
Identity = 84/306 (27.45%), Postives = 149/306 (48.69%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPD-KLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  N ++   +  K   I+ +KL+   D  +A G   G V +  +  +      ++ +F V   HKT I+A+ WS N  KL++GD+ G I  + +D      S++ V +  S + QL Y  K L++S    + ++         IG++ R     FG   +  LCK  ++ + + RP  ++W +D++G V+ + ILK   VFA       L P +          + IS +   +LGL+S    E  +L W+E SI + D  +   ++    LG I ++S
Sbjct:   36 VYLTALDTNGDYIAVGSSIGMLYLYCRHLNQMKKYNVDGKMESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRFDVTGVHKTSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCSSHLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEEKAVKQIGSQPRKSTGKFGACFIPGLCKQSDLTLYAARPGLRLWKADVHGTVQATYILK--DVFAGGVTPFELYPRLEPSDG----GSCISPEK--HLGLVSCFFREGWVLSWNEYSIYLLDTVNQATVAGLEGLGDIVSVS 333          

HSP 2 Score: 63.5438 bits (153), Expect = 2.669e-9
Identity = 124/601 (20.63%), Postives = 233/601 (38.77%), Query Frame = 1
Query: 2653 KLASSPNGFILWR--EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNG-IWFQITLQ--FLYQTSSTFE---DNIASLSSGIQNKVEKMFGYSEMDTKFKKA---NLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNT-----LWLLHKSGELFCYFDERIIR----TVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLI-FENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLK 4386
            ++A SP+G +LW+  +KS        VT           +  K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +   N ++W +TE          Q     +            W+      D+V E +         E +  I LG  +  W L I    ++   V  + P G+   W+Q+++    ++   S F+       S+++  Q  VEK+        K + A     + C  S+L   KS          +WI+S +         +  +++G +W         P+    G  + T WA +  SP  T     LWL   S +L C    + ++    TV +P     +   +     L  L +  +VFIR  ++++ P G  W ++  +     ++ +++C +  IW       V++    + L  + S  LP W   I          V+ V +  S N   +W +   +  +V             W ++ G  A  + +S   VW      G+L  R G+   N P GDYW  +P     V   TV+  ++++ + S   LL+
Sbjct:  866 QMAVSPSGALLWKIEQKSNRAFACGKVT-----------IKGKRHWYEALPQAVFVALSDDTAWIIRTNGDLYLQTGLSVDRPCARAVKVDCPYPLSQIAARNSVVWALTE----------QRALLYREGVSSFCPEGEQWKC-----DIVSERQT-------LEPV-CITLGDQHTLWALDIHGKLWFRTGVVPKKPQGDDDHWWQVSITDYVVFDQCSLFQTIMHATHSVATAAQAPVEKVA------DKLRMAFWSQQLQCQPSLLGVNKSG---------VWISSGKNE----FHVAKGSLIGTYWNTVV-----PR----GTASATKWAFVLASPAPTQDGSSLWLCQSSKDL-CIISAQNVQCRPSTVQLPP-DAEMRTYAACQDALWALDSLGQVFIRT-LSKSCPTGMHWTKLDLSQLGTVRLTSLACGNQHIWACDSRGGVYFRVGTQPL--NPSLMLPAW---IMIEPPVQLAGVTLVSVHSSPNDQMLWALDSRWNVHVRTGITEEMPVGTDWEHVPGLQACQLALSTRTVW-ARCPNGDLARRYGITDKN-PAGDYWKKIP---GSVSCFTVTSSDELWAVGSSGCLLQ 1391          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Mouse
Match: Tecpr2 (tectonin beta-propeller repeat containing 2 [Source:MGI Symbol;Acc:MGI:2144865])

HSP 1 Score: 113.62 bits (283), Expect = 1.392e-24
Identity = 84/306 (27.45%), Postives = 149/306 (48.69%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPD-KLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  N ++   +  K   I+ +KL+   D  +A G   G V +  +  +      ++ +F V   HKT I+A+ WS N  KL++GD+ G I  + +D      S++ V +  S + QL Y  K L++S    + ++         IG++ R     FG   +  LCK  ++ + + RP  ++W +D++G V+ + ILK   VFA       L P +          + IS +   +LGL+S    E  +L W+E SI + D  +   ++    LG I ++S
Sbjct:   36 VYLTALDTNGDYIAVGSSIGMLYLYCRHLNQMKKYNVDGKMESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRFDVTGVHKTSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCSSHLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEEKAVKQIGSQPRKSTGKFGACFIPGLCKQSDLTLYAARPGLRLWKADVHGTVQATYILK--DVFAGGVTPFELYPRLEPSDG----GSCISPEK--HLGLVSCFFREGWVLSWNEYSIYLLDTVNQATVAGLEGLGDIVSVS 333          

HSP 2 Score: 63.5438 bits (153), Expect = 2.669e-9
Identity = 124/601 (20.63%), Postives = 233/601 (38.77%), Query Frame = 1
Query: 2653 KLASSPNGFILWR--EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNG-IWFQITLQ--FLYQTSSTFE---DNIASLSSGIQNKVEKMFGYSEMDTKFKKA---NLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNT-----LWLLHKSGELFCYFDERIIR----TVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLI-FENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLK 4386
            ++A SP+G +LW+  +KS        VT           +  K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +   N ++W +TE          Q     +            W+      D+V E +         E +  I LG  +  W L I    ++   V  + P G+   W+Q+++    ++   S F+       S+++  Q  VEK+        K + A     + C  S+L   KS          +WI+S +         +  +++G +W         P+    G  + T WA +  SP  T     LWL   S +L C    + ++    TV +P     +   +     L  L +  +VFIR  ++++ P G  W ++  +     ++ +++C +  IW       V++    + L  + S  LP W   I          V+ V +  S N   +W +   +  +V             W ++ G  A  + +S   VW      G+L  R G+   N P GDYW  +P     V   TV+  ++++ + S   LL+
Sbjct:  866 QMAVSPSGALLWKIEQKSNRAFACGKVT-----------IKGKRHWYEALPQAVFVALSDDTAWIIRTNGDLYLQTGLSVDRPCARAVKVDCPYPLSQIAARNSVVWALTE----------QRALLYREGVSSFCPEGEQWKC-----DIVSERQT-------LEPV-CITLGDQHTLWALDIHGKLWFRTGVVPKKPQGDDDHWWQVSITDYVVFDQCSLFQTIMHATHSVATAAQAPVEKVA------DKLRMAFWSQQLQCQPSLLGVNKSG---------VWISSGKNE----FHVAKGSLIGTYWNTVV-----PR----GTASATKWAFVLASPAPTQDGSSLWLCQSSKDL-CIISAQNVQCRPSTVQLPP-DAEMRTYAACQDALWALDSLGQVFIRT-LSKSCPTGMHWTKLDLSQLGTVRLTSLACGNQHIWACDSRGGVYFRVGTQPL--NPSLMLPAW---IMIEPPVQLAGVTLVSVHSSPNDQMLWALDSRWNVHVRTGITEEMPVGTDWEHVPGLQACQLALSTRTVW-ARCPNGDLARRYGITDKN-PAGDYWKKIP---GSVSCFTVTSSDELWAVGSSGCLLQ 1391          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Mouse
Match: Hps5 (HPS5, biogenesis of lysosomal organelles complex 2 subunit 2 [Source:MGI Symbol;Acc:MGI:2180307])

HSP 1 Score: 78.5666 bits (192), Expect = 3.302e-14
Identity = 72/295 (24.41%), Postives = 134/295 (45.42%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEVDHV--AKTVSAY------EVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIF 1038
             +  TSI V+R  + LG+  G + +I +        L  ++  IS++      D  +A+  + G V +  +   +     +  +  V S+HK   ++A+CW     +++ GD+ G +   +++ +  AK  +A+       V    S V QL Y    L++S    +F+ +    +   IGNK R+ +  +G       C   +  VI   RP  ++W  + +G V  +   K        KL+S+  LP +T++S+  +   V S +S  +  L+ L  E+ +L W+E  I IF
Sbjct:   34 RLRCTSIAVSRKWLALGSTGGGLNLIQKDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWEL---NQERRGKPERIHVSSEHKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAAFVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLCDTEREKFWKIGNKERHGE--YGACFFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFK--------KLLSMPPLPVITARSEPQYDHTVGSSQSLAFPKLLHL-SEHCVLTWTEKGIYIF 314          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Mouse
Match: Hps5 (HPS5, biogenesis of lysosomal organelles complex 2 subunit 2 [Source:MGI Symbol;Acc:MGI:2180307])

HSP 1 Score: 78.5666 bits (192), Expect = 5.108e-14
Identity = 71/295 (24.07%), Postives = 135/295 (45.76%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEVDHV--AKTVSAYEVYQCF------SPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIF 1038
             +  TSI V+R  + LG+  G + +I +        L  ++  IS++      D  +A+  + G V +  +   +     +  +  V S+HK   ++A+CW     +++ GD+ G +   +++ +  AK  +A+ ++         S V QL Y    L++S    +F+ +    +   IGNK R+ +  +G       C   +  VI   RP  ++W  + +G V  +   K        KL+S+  LP +T++S+  +   V S +S  +  L+ L  E+ +L W+E  I IF
Sbjct:   34 RLRCTSIAVSRKWLALGSTGGGLNLIQKDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWEL---NQERRGKPERIHVSSEHKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAAFVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLCDTEREKFWKIGNKERHGE--YGACFFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFK--------KLLSMPPLPVITARSEPQYDHTVGSSQSLAFPKLLHL-SEHCVLTWTEKGIYIF 314          
BLAST of Tectonin beta-propeller repeat containing 2 vs. UniProt/SwissProt
Match: sp|O15040|TCPR2_HUMAN (Tectonin beta-propeller repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=TECPR2 PE=1 SV=4)

HSP 1 Score: 108.227 bits (269), Expect = 3.820e-22
Identity = 81/308 (26.30%), Postives = 143/308 (46.43%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKF---YLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  N +       K   I+ +KL+   D  +A G   G V +  +  +      ++ +F V   HK  I+A+ WS N  KL++GD+ G I  + +D      ++  V +  S + QL Y  K L++S    + ++         IG + R     FG   +  LCK  ++ + + RP  ++W +D++G V+ + ILK D+     K   L P + S +         SG       +LGL+S    E  +L W+E SI + D  +   ++     G I ++S
Sbjct:   36 VYLTALDTNGDYIAVGSSIGMLYLYCRHLNQMRKYNFEGKTESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRFDVTGIHKNSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCNSQLVLEEPSSIVQLDYSQKVLLVSTLQRSLLFYTEEKSVRQIGTQPRKSTGKFGACFIPGLCKQSDLTLYASRPGLRLWKADVHGTVQATFILK-DAFAGGVKPFELHPRLESPN---------SGSCSLPERHLGLVSCFFQEGWVLSWNEYSIYLLDTVNQATVAGLEGSGDIVSVS 333          

HSP 2 Score: 68.9366 bits (167), Expect = 4.206e-10
Identity = 134/636 (21.07%), Postives = 249/636 (39.15%), Query Frame = 1
Query: 2653 KLASSPNGFILWR--EKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNG-IWFQITLQ--FLYQTSSTFEDNIA---SLSSGIQNKVEKMFGYSEMDTKFKKA---NLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLP-GLPALTSWAAIEFSPPNT-----LWLLHKSGELFCYFDERIIR----TVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLI-FENRVFYNENIKALLFDVSKKLP-WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG-YVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKH---SWTIIEGNVSLSESESTLAEFVKPDDWELL 4479
            ++A SP+G +LW+  +KS        VT           +  K++W   + +   + + ++ A ++   G L +  G+S   P  ++  V+    ++ +T  N ++W +TE          Q     +            W+      D+V E +         E +  I LG     W L I    ++   + S+ P G+   W+Q+++    ++   S F+  I    S+++  Q  VEK+        K + A     + C  S+L            N  +WI+S +         +  +++G +W           + +P G  + T WA +  S   T     LWL   S +L C    +  +    TV +P     +   +     L  L +  +VFIR  ++++ P G  W  +  +     K+ +++C +  IW       V++    + L  + S  LP W   I          VS V +  S N   +WV+   +  +V            AW ++ G  A  + +S   VW      G+L  R GV   N P GDYW  +P     V   TV+  ++++ +     LL+    +++   G    S++     E ++ D+WE++
Sbjct:  853 QVAVSPSGALLWKIEQKSNRAFACGKVT-----------IKGKRHWYEALPQAVFVALSDDTAWIIRTSGDLYLQTGLSVDRPCARAVKVDCPYPLSQITARNNVVWALTE----------QRALLYREGVSSFCPEGEQWKC-----DIVSERQ-------ALEPV-CITLGDQQTLWALDIHGNLWFRTGIISKKPQGDDDHWWQVSITDYVVFDQCSLFQTIIHATHSVATAAQAPVEKVA------DKLRMAFWSQQLQCQPSLL---------GVNNSGVWISSGKNE----FHVAKGSLIGTYW----------NHVVPRGTASATKWAFVLASAAPTKEGSFLWLCQSSKDL-CSVSAQSAQSRPSTVQLPP-EAEMRAYAACQDALWALDSLGQVFIRT-LSKSCPTGMHWTRLDLSQLGAVKLTSLACGNQHIWACDSRGGVYFRVGTQPL--NPSLMLPAW---IMIEPPVQPAGVSLVSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVW-ARCPNGDLARRYGVTDKN-PAGDYWKKIP---GSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLE-DEWEVI 1411          
BLAST of Tectonin beta-propeller repeat containing 2 vs. UniProt/SwissProt
Match: sp|Q6NLL1|Y1411_DROME (WD repeat-containing protein CG11141 OS=Drosophila melanogaster OX=7227 GN=CG11141 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.767e-18
Identity = 64/248 (25.81%), Postives = 128/248 (51.61%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAI----PFNDSL-----NYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD---HVAKTV----SAYEVYQCFSPVNQ----LAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVF 873
            N+++T +D   + + +G++ G +F  NR    ++ +  +    I+ ++++++++  +A G  +G V I  I    P +  L         + ++++   HK ++S   WSKN  KLY+GD  G +  TE+D   H++K+V     AYE+ Q    V Q    +A  ++C++    A+T  WN        +G K+R +    G +I  K  ++++ +++  RP  + W++D  G V K++I + D+V 
Sbjct:   35 NLNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKLKAEVATRITCVRVVNSVEYMVAAGCANGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLHKCVVSCCEWSKNGMKLYSGDRQGVVVLTELDYQAHLSKSVEILSEAYEIVQLS--VRQSYLLVATLYRCIVCQMDAQTSQWNIT-----QVGKKDRKQLIDCG-AIFLKKQEANKPQLVCGRPGLRFWVADAAGNVSKTVIFR-DAVL 273          
BLAST of Tectonin beta-propeller repeat containing 2 vs. UniProt/SwissProt
Match: sp|Q9UPZ3|HPS5_HUMAN (Hermansky-Pudlak syndrome 5 protein OS=Homo sapiens OX=9606 GN=HPS5 PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.098e-13
Identity = 77/319 (24.14%), Postives = 147/319 (46.08%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHK-TLISAMCWSKNSEKLYTGDNNGFIFCTEVD--HVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
             +  TSI V+R  + LG++ G + +I +        L  ++  IS++      D  +A+  + G V +  +   +     +  Q  V S+HK   ++A+CW     +++ GD+ G +   +++    AK  +A+ ++  Q  + V+    QL Y    L+IS    +F+ +    +   IGNK R+ +  +G       C   +  +I   RP  ++W  + +G V  +   K        KL+SL  LP +T +S+  +     S +S  +  L+ L  E+ +L W+E  I IF   +  +L  S  +  IQ++++C 
Sbjct:   34 RLKCTSIAVSRKWLALGSSGGGLHLIQKEGWKHRLFLSHREGAISQVACCLHDDDYVAVATSQGLVVVWEL---NQERRGKPEQMYVSSEHKGRRVTALCWDTAILRVFVGDHAGKVSAIKLNTSKQAKAAAAFVMFPVQTITTVDSCVVQLDYLDGRLLISSLTRSFLCDTEREKFWKIGNKERDGE--YGACFFPGRCSGGQQPLIYCARPGSRMWEVNFDGEVISTHQFK--------KLLSLPPLPVITLRSEPQYDHTAGSSQSLSFPKLLHL-SEHCVLTWTERGIYIFIPQNVQVLLWS-EVKDIQDVAVCR 337          
BLAST of Tectonin beta-propeller repeat containing 2 vs. UniProt/SwissProt
Match: sp|P59438|HPS5_MOUSE (Hermansky-Pudlak syndrome 5 protein homolog OS=Mus musculus OX=10090 GN=Hps5 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.939e-13
Identity = 71/295 (24.07%), Postives = 135/295 (45.76%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEVDHV--AKTVSAYEVYQCF------SPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVI-SVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSL--LPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIF 1038
             +  TSI V+R  + LG+  G + +I +        L  ++  IS++      D  +A+  + G V +  +   +     +  +  V S+HK   ++A+CW     +++ GD+ G +   +++ +  AK  +A+ ++         S V QL Y    L++S    +F+ +    +   IGNK R+ +  +G       C   +  VI   RP  ++W  + +G V  +   K        KL+S+  LP +T++S+  +   V S +S  +  L+ L  E+ +L W+E  I IF
Sbjct:   34 RLRCTSIAVSRKWLALGSTGGGLNLIQKDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWEL---NQERRGKPERIHVSSEHKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAAFVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLCDTEREKFWKIGNKERHGE--YGACFFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFK--------KLLSMPPLPVITARSEPQYDHTVGSSQSLAFPKLLHL-SEHCVLTWTEKGIYIF 314          
BLAST of Tectonin beta-propeller repeat containing 2 vs. TrEMBL
Match: A0A2C9KT90 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054481 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.735e-31
Identity = 86/306 (28.10%), Postives = 160/306 (52.29%), Query Frame = 1
Query:  199 VTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLK--KDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD-HVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKI-SIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISI 1104
            +T ID N   I LG+N G IF+ +R ++ I+        DVI S ++L H +D  IA G   G V +  +P   S+   ++ +F V   H+  ++ + WS N  KLY+GD NG +  TE+D +  +  S+  + +  + + QL Y H+ L++S    +F+   +   +I +IG+K+R     FG   +  LCK+D+ ++ + RP  ++W++D+ G+V  +II         D + S +P +   S        ++G S+F  G +  +  N+I+ WS +++V+ D  +  +++    L  I + ++
Sbjct:   59 LTCIDANSHFIALGSNVGIIFLFDRKHHTIQKFKSANTSDVITS-VRLHHGIDDLIATGTASGDVTVFCMPGITSIQKKQLQKFDVLGLHRHYVTCLEWSTNGMKLYSGDKNGQVVTTEIDFYKGQCSSSILLIEATTEIIQLDYRHRALLVSTRHRSFIIRLDLKSEIVNIGSKDRKIPGPFGACFIPGLCKTDDAKLYAARPGCRLWLADMKGVVSNTIIFS-------DPMSSSIPEIPLLSVGRL---QMAGPSEFQFGNLKWLGNNQIVTWSSSALVVLDPEANRVVAKQGRLSGIVDAAV 353          

HSP 2 Score: 93.9745 bits (232), Expect = 2.804e-15
Identity = 135/643 (21.00%), Postives = 255/643 (39.66%), Query Frame = 1
Query: 2551 HVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTE-LDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITL-QFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWL-LHKSGELFCYFDERIIRT-VTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFGYVYFS----------AW------VPFVNS---------FAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHS 4392
            HV F  TD  ++  Y+S  + K    +    + ++++ SP+G I+WR       ++ GV    T   +R    LK  W   +++++ + +D++ A  V K G++ +  G+S   P  +S  V     +  +    G++W +TE L +   + +S H    Q    D        R +P                    L   + +    + W + +    ++C  VS ENP+G+G W+Q+ L +++ Q  +T +         +   V K F  +++      + L+N     LI+         G   +W+    RN   +L     ++ G+ W+     L  P    P +P     A I       +W  L K+ E++ +   R   T + + + +     ISV       LT +  V +R G+  + P GS W ++  +   + K  ++SC+   +W +    V Y          +    P         D N             N N +W+  E FG + F+           W      + +V +           W ++ G  A  + ++N  VW +  + G +F R G+    +P GDYW  +P I    I ++ S  ++++ I+   +L++ S
Sbjct:  899 HVWF--TDKSENIYYSSMGSPKGVVWRKATGKANQISVSPSGHIVWR-------LHHGVVHAGTKINLRHPEGLK--WVEAIKDVETMCVDDKTAWYVKKTGEVMMQKGLSHDRPCYKSVEVKCPYRLKHIVCRQGIVWAITEGLKLVVRTGISNHCPEGQDWLLDN-------RDLPPY------------------LFSHVAIDHERIGWAIDLVGQIWFCDGVSQENPLGSGFWWQLPLSEYILQDETTLD---------MIKAVAKKFDPTKL------SYLLNTNRGGLITA--------GTQGVWLALDFRN---VLQVCRGSVQGYLWL-----LAQPSQISPSVPWKHICANISHLDWGLVWAQLTKTSEIYTFKQARSKATMIPVTSSHEEFTCISVSPVAAWALTDKGAVKVRAGMGPHCPQGSSWVDLDISQLGDAKFVHLSCNSLYVWAVEAEGVIYQR--------IGAGAP---------DEN-------------NLNPVWLPIETFGDIVFTRVHVGPLDWMVWAIDNRRLIYVRAGIKEDMPIGLEWIHVPGIQAIDLALTNSGVWAL-TSNGEIFFRFGIS-KERPYGDYWKKIPGI---FIKISASAADELWGINRECQLMQCS 1439          
BLAST of Tectonin beta-propeller repeat containing 2 vs. TrEMBL
Match: A0A2T7PFY7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07752 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.172e-30
Identity = 91/307 (29.64%), Postives = 163/307 (53.09%), Query Frame = 1
Query:  199 VTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDV---IISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD-HVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFN-RKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISI 1104
            +T ID N   I LGTN G  F+ NR++N+++   LK +    +I+ +KL H +D  +A+G+  G+V I  IP   S+   ++ +F V S H+  ++ + WS N  KL++GD  G + CTEVD +  +  S   + +  + + QL YDHK L++S  + +F+   + N + + IG ++R  +  FG   +  LCK+D+ ++ +VRP  +IW+SDI+G V  + + K + + A  K + LL    +       D        F  G I +  E +++ ++   + I +     +++     G I +I+I
Sbjct:   90 LTCIDANDSYIALGTNIGLTFLYNRNDNSVQR--LKSETSNEVITCIKLHHGVDHQLAVGMASGAVCIFLIPGYISVFKKQLQKFEVQSVHRHYVTCVEWSTNGMKLFSGDKTGNVVCTEVDFYQGQCKSVVLLVEPPTEIVQLHYDHKVLVVSTRSRSFVCRLDTNCQLVQIGQQDRKVQGSFGACFIPGLCKTDDAKLYAVRPGCRIWLSDIHGTVCNTFMFK-EKINAGMKEIPLLQPSKAVGAALTQD--------FQFGRIYIYREKQVVTFNPMMLFILNPEQNCVVAGQNRFGGIVDIAI 385          

HSP 2 Score: 75.485 bits (184), Expect = 1.073e-9
Identity = 110/527 (20.87%), Postives = 198/527 (37.57%), Query Frame = 1
Query: 2362 SEEDVQ-IPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQ-NKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPN----TLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLI 3924
            S E VQ IP   AE  K +    +   +N W          +  + S+ ++   IW TD    L+             Y++    K    + +     ++A SP+G I+WR   G V   T +T        R    LK  W   +++++ I +D+  A  +   G++ +  G+S   P  +S SV I   V  V    G++W +TE                +    D     T W        LV + E E           +  +    + W + +    ++   V+  NP G+G W+Q+ L   +    T  D I S++      K+  +  Y             N    I+  V+           LW++   +N+   L     ++ G+    C+S  Q PK     +   T W  ++ S  +     +W    +GELF          + IP+     V ++V    +  LT    V++R G+  + P+G++W  +      N  + ++SC+ + +W +
Sbjct:  884 STEAVQVIPSTTAESDKNISEATLYRLANNWSEFTA-----SANIYSLALSGTHIWFTDKSDNLY-------------YSAIGEMKGVLWRKVGDPASQIAVSPSGHIVWRLHKGRVFAGTKITH-------RRPEGLK--WVEAVRDVRFISVDDHCAWYIKTNGEVMMQRGLSKERPCFRSLSVEIPQAVKHVIARYGVVWAITE----------SLTLMVRVGITDDTPQGTDW--------LVVKREME------PSFFFNASIDNEGIGWAVDVIGQIWFTDQVTPSNPAGSGNWWQVPLSKYFIQDPTTLDIIRSIARKFDPQKLSHILSY-------------NRGGLIVAGVQG----------LWVSLEFQNT---LHVCRGSVQGY----CWSPAQ-PKQ----MAVATVWRQVQASIAHVQWGVVWAQQVNGELFV-MSPNSQDAILIPS--KEFVSMAVNELSVWGLTAGGDVYVRSGVGPHCPHGTEWLPLDLTQLGNACLVHLSCNSSFVWSV 1321          
BLAST of Tectonin beta-propeller repeat containing 2 vs. TrEMBL
Match: K1PQU1 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10004300 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.091e-28
Identity = 91/331 (27.49%), Postives = 169/331 (51.06%), Query Frame = 1
Query:  118 EHESVEWXXXXXXXXXXXXXXXXXNVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKD-VIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHV-AKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISI 1104
            EH S++++L  IP+ ++K  L   ++ +  +D N D I LGTN G I++ +R    IE +    +  +I+ + L   L+  +AIG   G VYI  +P +      ++ +F V   HK  ++   WS N  KL+TGD+ G + CTE D    +  SA  + +  S V QL + HK L++S    T ++  +    + +G K+R     FG   +  +CK ++ ++ + RP  +IW +D+NG+V ++ + K       + L S  P +    K     + +S   +F  G +SL  E  ++ W+++S+ +      +++ S   LG + ++++
Sbjct:   25 EHRSLDYLLSQIPRRAQKGLLTTCDLILKCVDANADYIALGTNVGVIYLFDRKKELIEKLKTHSNNDVITTIALHTGLESQVAIGTEKGVVYIFQLPSHIPGQNKKLQEFVVQGLHKARVTCSKWSLNGMKLFTGDDQGLVVCTEFDAFQGQCKSAVVLSEAGSSVVQLDHGHKSLLVSTKQRTVIYKMD-ESTVQVGQKDRKIAGQFGACFIPAMCKPEDAQLYACRPGARIWKADMNGLVSQTYLYK-------ELLNSTHPEIQLLFKNGIPASRVSADHQF--GPLSLYMEKYLVTWNDSSMYVLCPEDNSVVGSQRALGAVVDVAV 345          

HSP 2 Score: 87.0409 bits (214), Expect = 3.294e-13
Identity = 133/648 (20.52%), Postives = 253/648 (39.04%), Query Frame = 1
Query: 2620 FWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDG----NFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNT--LWLLHKSGELFCYFD--ERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNE-NIKA----------LLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWV---ITE--PFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIE--GNVSLSE--SESTLAEFVKPDDWELL 4479
            F  Q  N     +A S +G I+WR      +VY G TKI    V +    +K  W   ++E++ I +DE MA  +   G++ +  G+S   P  ++  +     +  +  + G++  VT+               CQ    DG     +   +W      K L  +  QE        L  +I  G   + W L +    ++   V+ E P G+G W+++ +  +     +  D + SL+     +              K A+L++  ++ LI+         G   +W+    +N    + +  R ++  H  D   +         G+ +   W ++     N   +W L  +G+++ +    E+  + ++ P+    I+ +      + +L     +FIR G+  +NP G DW  +  +   +  + +ISC    +W +    + Y    +KA          L  D+ K+   S  +F +  +  K      ++   NR  ++    +TE  P G               W ++ G  A  + VS+  VW +    G +  R G+   N P GDYW  VP +      ++VS  +Q++ +    +L K     ++   N +L +   + +       D WELL
Sbjct:  997 FKWQKANGYAKMVAVSHSGSIVWRLYKD--TVYAG-TKI----VAKHPEGMK--WIEAVREVQYISVDETMAWYIKTNGEVVMQKGLSRDRPCFKALKIACDHKLIEIACYRGVVIGVTD--------------QCQLVYRDGISKDCWEGKWW------KQLKCKSSQEM-------LFSAISFGVDGVLWALDVLGRIWFTTGVTMETPTGDGKWWEVPVSEIVVKDVSGIDALRSLAQKFDPQ--------------KLASLLSSQNAGLITA--------GRCGVWVCPEFKN----MIQICRGVIQGHLWDVAEIR--------GIASSVIWKSVSAQASNDGFIWALQPNGDIYTFSAGLEKCSQLLS-PSYKKPIICLCTSRDAVWVLMEDGAIFIRSGVRPSNPQGVDWCRLDLSQLGDTVLTSISCGTLNVWAVDNQGIVYQRIGVKAPTSHSLNAAWLPVDMGKQ---STTVFTHIATGPKD---FMVWAIDNRRQVYARRGVTENMPIGE-------------EWVHVPGTLATQLTVSDTCVWAL-NPNGEILCRYGISLKN-PTGDYWRKVPGV---FYQISVSDSDQMWGVSKEGQLYKRYTKCLKKGSNSALDQLLPKRSSVSMSSDDGWELL 1549          
BLAST of Tectonin beta-propeller repeat containing 2 vs. TrEMBL
Match: A0A210PM88 (Tectonin beta-propeller repeat-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10429 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 6.029e-26
Identity = 81/306 (26.47%), Postives = 160/306 (52.29%), Query Frame = 1
Query:  199 VTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKK--DVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTV-SAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNF--NRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            +T ID N D I LG+N G +F+ ++    +E+ L  +  +  IS ++L   LD  +AIG N G VYI  +P +      ++ QF V + H + ++++ WS N  KL++GD  G + CT+VD   K   S+  + +  S + QL + HK L++S    +F++  +F  ++   +G K+R     +G   +  LC  +  ++ + RP  ++W + I+GIV  + + K D +  P + + ++P    Q++    + + S   +F  G + L  +  ++ WS + + + +  +  +++S   LG +  ++
Sbjct:   58 LTCIDANEDFIALGSNVGLVFVFDQKKRTVEHKLRTESNNDTISVVQLHKGLDNHVAIGTNGGIVYIFQLPSSLPGQNKQLQQFVVQNLHHSSVTSLAWSLNGMKLFSGDRKGLVVCTDVDFYEKQCGSSISLEEKQSEIVQLHHAHKSLLVSTLHRSFVYRPHFPDSKLTQVGKKDRKILGNYGACFIPGLCNPEHAQLYAARPGLRVWKAGIDGIVLNTNLFK-DLLSQPHRDVPIIP-YEGQTR----NQLKSSDQQF--GTLLLYRDKYLVTWSSSHLYLLNPDNNTVVASQARLGVLVGVA 355          

HSP 2 Score: 75.485 bits (184), Expect = 1.110e-9
Identity = 89/432 (20.60%), Postives = 170/432 (39.35%), Query Frame = 1
Query: 3127 LGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSW----AAIEFSPPNTLWLLHKSGELFCYFDER-IIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKN---KDSNAKKVSAVQIFKSANRN-CIWVIT---EPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLK 4386
            +G   L   + LG   + W + +     +   VS + P+G   W+Q+ +  +     T  D++ SL+        K F   ++      A+L++     LI+         G G +W+ S  +N+  I      N+ GH W             + G  +  +W    A++       +W +  +G++F         + V  P+   R+V +S     +  LT    VFIR G+  ++P G++W ++      +  + ++SC    +W +  + V Y          +  K P +  + +     DS     +      S  ++  +W I    + +     +  +P   S  W ++ G  A+ I +S  NVW +    G +  R GV   N P GDYW  V   T   I ++ S  + ++ I+    + +
Sbjct: 1169 VGEDVLFSYVALGDNGVGWGIDLLGRILFIAGVSKDTPMGQECWWQVPVSGILTEDLTALDSLRSLA--------KKFDPQKL------AHLLSTQRGGLITA--------GMGGVWVCSEFKNTLQICR---GNMEGHSWRGV---------NMAGFTSSIAWKILSASVSSYKHGLVWCVQPNGDVFTLSTSTGHTKNVESPSPRHRLVGLSACPEAVWGLTENGFVFIRDGVRPDHPQGTEWVKLDLLQLGDVHLVSVSCGHTNVWALDSDGVVYQR--------IGVKAPSTHSLIQAWLPVDSGTSSGTTFSQISSGPKDWMVWAIDNRRQVYTRTGITDRMPIGTS--WVHVPGTLAQQITISERNVWAL-NPVGEILCRYGVSPEN-PTGDYWRKV---TGTFIHISTSASDDIWAINQDGHIYR 1551          
BLAST of Tectonin beta-propeller repeat containing 2 vs. TrEMBL
Match: A0A0L8GZ84 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025654mg PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 6.708e-25
Identity = 87/321 (27.10%), Postives = 160/321 (49.84%), Query Frame = 1
Query:  199 VTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKK-DVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVD-HVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNF-NRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN--IFKMPIASSNKI 1146
            +T I  N + I LGTN G +F+ NR+   +E +  +K D +++ +K+ H +D  +A G + G +Y+  IP +   N     +FSV   H T ++ + WS N  KL++GD  G + CTEVD    +  S+  + +  S + QL+Y  + L++S S    +   +  N  I +G K R     +G   +  LCK  + ++ + RP  ++W+S+I+G+V+ + I K   +    + + LL      S     DN+     +F   L    D  +I+ W++ ++ + D     ++      G I +++I +  IF +   SS ++
Sbjct:  200 LTCIAANGEYICLGTNVGLVFMFNRNKRCLERLRCEKNDELVTCVKIQHGIDYQVAAGTSMGGLYMFNIPSDLVANRKLPQRFSVQDVHSTPLTCLEWSPNGMKLFSGDKKGVVVCTEVDFQKGRCQSSVLLTEFLSEIVQLSYFQRALLVSTSMRALICRTDRDNEIIQVGQKKRKIPGNYGACFIPMLCKLADAQLYAGRPGQRVWMSNIDGVVQATHIFK--HLTTDCREIPLLHYNHYHST----DNLAVTDQQFG-HLCPYGDSRQIVTWNKKALFLLDPGKNVVIGKQDQFGHIIDVAINSKEIFVLTRTSSRQV 513          

HSP 2 Score: 92.8189 bits (229), Expect = 7.063e-15
Identity = 136/658 (20.67%), Postives = 245/658 (37.23%), Query Frame = 1
Query: 2599 SNSTEKLFWIQ---------DLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLL-------WITSTERNSPCILFESDRNIL-GHHWIDCFSVLQNPKNRLPGLPALTSW----AAIEFSPPNTLWLLHKSGELFCYFDE-RIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFK----NKDSNAKKVSAVQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFA--WTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTII---EGNVSLSESESTLAEFVKPDDWELL 4479
            ++ +E LF+ Q          ++L   ++A S +G I WR     V V  GV+        R     KQ   +  +++  I +D +    +   G++ V   +S   P  +S+ +    ++  +   N +IW +T+          +    C+A   D +     W       +    E            + +I LG  N+ W +      ++C NV+ E+P G G+W+Q+     +    T  D + S++  +    +K+                   S +LIS        RG GL+       W   + RN    + +  ++I+ GHHW      +  P     G+   +SW    A         +W  H +GE+  +  E R  + V+ P++    + IS     L  L T   +++R  +    P G +W  +      N    ++SC  + IW +      Y++      F V    P S  +F       D     +    +        +W I +    VY    +    S    W  + G PA  + +S   VW +    G +  R GV  AN+  GDYW  +P +      ++ S  N+++ I    +L +H    I     +   +     L +    DDWE++
Sbjct: 1204 TDRSENLFYRQTDSMSGAWHKVDLYAHQIAVSRSGNIFWRLYQNTVYVAIGVS-------ARKPEGKKQVEAI--RDVAYIAVDNDCGWYIKVNGEIAVHKKLSRERPAYRSQKIPCEYNLIQLACLNQVIWGLTK----------EGQLVCRAGVSDQHPEGDEWCKYEGPSNWHVPE------------MMNIALGDNNIGWCVDTQGRVWFCTNVTREHPFGQGMWYQVAFSDYFMMDPTMTDMMRSVAERLD--PQKL-------------------SQLLIS-------PRGGGLIAATHVGTWFVPSYRN----VIQVCKSIMQGHHW-----TITPPL----GMAISSSWRLVSAGAYTEEHEYIWAQHVNGEMVIFSPEARHFKMVSQPSITNHFICISASEDSLWGLATNGTIYVRSAVRSTCPEGINWVRLDLEQLGNNFFTHLSCGSDCIWAVDNKGSVYHK------FGVH---PPSHTVFTPVWLQVDPEPNGICFTHVIAGPENWMVWAI-DNRKQVYMRDGISDKMSIGTKWCQVTGTPANQLSISKLTVWAL-NPEGEILHRLGVSIANR-GGDYWKKIPGV---FSFLSASPSNELWAISKELQLYRHHTKFIYRKRQSAMPAAPADLLDQSTMDDDWEIV 1774          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Cavefish
Match: tecpr2 (tectonin beta-propeller repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060503-358])

HSP 1 Score: 104.375 bits (259), Expect = 6.052e-22
Identity = 82/312 (26.28%), Postives = 145/312 (46.47%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENI-LLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPD-KLMSLLPCVTSQSKTFFFDNVISGKSKFY------LGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNIS 1101
            V +T++D N D I +G++ G +++  R  + +    L  K   I+ +KL+   D  +A+G   G V +  +         ++ +F V   HK+ I+A+ WS N  KL++GD+ G +  + VD      +   + +  S V QL Y  K L++S    + ++         +G K R +   FG      LCK  ++ V + RP  ++W +D+ G V+++ +LKP  +F  D     L P               SG +  Y      LGL+S  + +  +L W+E S+ I D  +  I+    + G I ++S
Sbjct:   36 VYLTALDSNSDFIAVGSSIGMLYLYCRRVSQMNKYNLEGKSEAITVVKLLSCFDDLVAVGTASGRVALFQLVSQLPGRNKQLRRFDVVGLHKSTITALAWSANGMKLFSGDDKGKVVYSAVDLDQGVCNPVVLLEEPSAVVQLEYSQKVLLVSTCQRSLLFYTQEQSLQQLGTKPR-KNGKFGACFQPGLCKQSDLLVYAARPGLRLWRTDVRGRVQETHVLKP--LFNQDVPQFELFP--------------RSGPTGAYRPTERQLGLVSCFLKDGWVLSWNEYSVYIVDCTNQVIVGGLESSGDIVSVS 330          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Cavefish
Match: hps5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:NCBI gene;Acc:103045684])

HSP 1 Score: 67.3958 bits (163), Expect = 1.113e-10
Identity = 65/312 (20.83%), Postives = 134/312 (42.95%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEV--DHVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISI-------VNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTS-----QSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNIL 1062
             +  T I ++R  + LGT+ G + +I R       IL  K+  I+++      +  IA+  ++G V +  +            +  V  +H+ + I+A+CW   + +++ GD  G + C       + K  SA+ ++  Q  + V+    QL Y    L++S  +  ++ +    +   +GNK R+ +  +G          +  L  +    +   RP  ++W ++ NG            V +  +   LL C  S     + +  +  +    +S  +  L++  D+N +L W++++I IF   SG +L
Sbjct:   32 RLKCTCIAISRKWLALGTSAGGLHLIQRDGWKQRLILTHKEGSITQVACCPHDEDFIAVATSEGLVVVWELQLE---RRGRPERACVSWEHRGMAITALCWDTATLRVFIGDTAGKVSCLRAGSSKLGKG-SAFVIFPVQTVTTVDSRVVQLGYLEGRLLVSSLSRCYLCDTEREKFWRVGNKERDGE--YGACFCPQQQTGLRGLPGATGHLLYCARPGSRVWEANFNG-----------EVLSTHQFKQLLACPASPLISYKGEPQYIPDQKHPQSLAFPRLLNFSDQN-LLTWTDSAIYIFTPQSGQVL 325          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Cavefish
Match: hps5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:NCBI gene;Acc:103045684])

HSP 1 Score: 67.3958 bits (163), Expect = 1.388e-10
Identity = 65/312 (20.83%), Postives = 134/312 (42.95%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEV--DHVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISI-------VNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTS-----QSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNIL 1062
             +  T I ++R  + LGT+ G + +I R       IL  K+  I+++      +  IA+  ++G V +  +            +  V  +H+ + I+A+CW   + +++ GD  G + C       + K  SA+ ++  Q  + V+    QL Y    L++S  +  ++ +    +   +GNK R+ +  +G          +  L  +    +   RP  ++W ++ NG            V +  +   LL C  S     + +  +  +    +S  +  L++  D+N +L W++++I IF   SG +L
Sbjct:   69 RLKCTCIAISRKWLALGTSAGGLHLIQRDGWKQRLILTHKEGSITQVACCPHDEDFIAVATSEGLVVVWELQLE---RRGRPERACVSWEHRGMAITALCWDTATLRVFIGDTAGKVSCLRAGSSKLGKG-SAFVIFPVQTVTTVDSRVVQLGYLEGRLLVSSLSRCYLCDTEREKFWRVGNKERDGE--YGACFCPQQQTGLRGLPGATGHLLYCARPGSRVWEANFNG-----------EVLSTHQFKQLLACPASPLISYKGEPQYIPDQKHPQSLAFPRLLNFSDQN-LLTWTDSAIYIFTPQSGQVL 362          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Cavefish
Match: hps5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:NCBI gene;Acc:103045684])

HSP 1 Score: 67.0106 bits (162), Expect = 1.405e-10
Identity = 65/312 (20.83%), Postives = 134/312 (42.95%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTL-ISAMCWSKNSEKLYTGDNNGFIFCTEV--DHVAKTVSAYEVY--QCFSPVN----QLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISI-------VNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTS-----QSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNIL 1062
             +  T I ++R  + LGT+ G + +I R       IL  K+  I+++      +  IA+  ++G V +  +            +  V  +H+ + I+A+CW   + +++ GD  G + C       + K  SA+ ++  Q  + V+    QL Y    L++S  +  ++ +    +   +GNK R+ +  +G          +  L  +    +   RP  ++W ++ NG            V +  +   LL C  S     + +  +  +    +S  +  L++  D+N +L W++++I IF   SG +L
Sbjct:   69 RLKCTCIAISRKWLALGTSAGGLHLIQRDGWKQRLILTHKEGSITQVACCPHDEDFIAVATSEGLVVVWELQLE---RRGRPERACVSWEHRGMAITALCWDTATLRVFIGDTAGKVSCLRAGSSKLGKG-SAFVIFPVQTVTTVDSRVVQLGYLEGRLLVSSLSRCYLCDTEREKFWRVGNKERDGE--YGACFCPQQQTGLRGLPGATGHLLYCARPGSRVWEANFNG-----------EVLSTHQFKQLLACPASPLISYKGEPQYIPDQKHPQSLAFPRLLNFSDQN-LLTWTDSAIYIFTPQSGQVL 362          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Sea Lamprey
Match: tecpr2 (tectonin beta-propeller repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060503-358])

HSP 1 Score: 107.842 bits (268), Expect = 1.247e-23
Identity = 74/312 (23.72%), Postives = 142/312 (45.51%), Query Frame = 1
Query:  199 VTSIDVNRDLIVLGTNNGNIFIINRSNNAIE----NILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAET---FMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSS-SFNLGKIQNISICN 1110
            +T +D + + + LGTN G +F+  R  + ++    NI +K D I + ++L+  LD  +A+G   G V +  +         ++++F V   H   + A+ WS N  KL++GD  G + CT +D      +++ V++  S V QL Y  + L++S    +   F       R+  +G K R      G   +  LCK  ++ + + RP  ++W +D+ G VK + I +      P  +      +T++          +G+  F L    L  +  ++ WS + + + D  +  ++ S     G +   + CN
Sbjct:   43 LTVLDASSEYLALGTNVGQVFLYCRRRHRLQKLDNNIEVKYDPITA-VRLLTCLDDLVAVGTATGRVVLFQLASLLPGRNKQLHRFEVAGQHSVSVVALAWSTNGMKLFSGDERGKVVCTSIDFELGVCNSFLVHEECSGVVQLDYAQRTLLVSTGQRSVLCFPETGQATRQ--VGTKPRKCTEPLGACFIPGLCKPADLTLHAARPGLRLWRADMAGAVKATYIFRDVLALDPRPVQ-----LTARPTVAAGGGGGAGERAFGLLRPFLPTQGLLMSWSPSGLYVLDPTNKAVVGSLELGAGDLVAAACCN 346          

HSP 2 Score: 59.6918 bits (143), Expect = 6.000e-9
Identity = 55/279 (19.71%), Postives = 106/279 (37.99%), Query Frame = 1
Query: 2440 SNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNG-IWFQITL 3273
            S  W+ H GP          + V++R +W  D + VLH               + +   L W Q       ++A SP+G +LW+ +      +      +  K         ++W   +  +  + + ++ A VV   G L V  G+S   P  +   VN +  +  V    G++W +T     NT+ + +   +    + +       W    +++    ++  E         +  I LG  +  W+L      ++   V+S+ P G G  W+Q+ L
Sbjct:  787 SECWMRHAGP----GSLAAGLAVSERHLWCVDGRGVLHCAPV-----------APAPAGLLW-QKYEEGVRQVAVSPSGMLLWKVEHKSSKAFAASKATMRGK---------RHWYEALTRVSHVALGDDSAWVVNVSGHLYVQTGLSGERPCARPVQVNNSPPLLQVAARAGVVWGITSQP--NTTLMCREGVSSLCPEGE------RW----VIEQACVQQGLE---------VVCIALGDDHTGWVLDAQGRLWFRTGVTSQTPAGEGDHWWQVCL 1019          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Medaka
Match: ENSORLT00000040374.1 (pep primary_assembly:ASM223467v1:22:2175661:2181114:1 gene:ENSORLG00000029647.1 transcript:ENSORLT00000040374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 7.879e-26
Identity = 78/311 (25.08%), Postives = 147/311 (47.27%), Query Frame = 1
Query:  193 VSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIE--NILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISG--KSKFYLGLIS-LIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICN 1110
            V +T++D + D + +G++ G +++  R    +   N+  K D I + +KL+   D  +A+G   G V +  +         ++ +F V   HK  ++ + WS N  KL++GD+ G +  + +D          + +  S V Q+ Y H+ L++S    + ++       + +G K R     FG   +  LCK  +++V + RP  ++W SD+ G V+ + +LKP           L      Q + F   + +     +   LGL+S  + E  IL W+E SI +FD  +  I+ +  + G I ++S C+
Sbjct:   37 VYLTALDCSGDFLAVGSSIGMLYLYCRRQEHMNKYNLEGKCDAI-TAVKLLSCFDDLVAVGTASGRVAVFQLVSPLPGRNKQLRRFDVVGLHKGSVTCLTWSTNGMKLFSGDDKGRVVFSALDLDQGVCKPELLLEESSGVVQMEYRHQMLLVSTQHRSLLYCPQTQEVLQLGTKPRKSSGRFGACFLPALCKQSDLQVYAARPGLRLWRSDVRGKVEDTRLLKP-----------LFNTQVPQFELFPRPDPVGAYRPADRQLGLLSCFLREGWILSWNEYSIYVFDCINEVIVGALESSGDIVSVSSCD 335          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Medaka
Match: hps5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:NCBI gene;Acc:101167115])

HSP 1 Score: 62.7734 bits (151), Expect = 3.264e-9
Identity = 60/301 (19.93%), Postives = 128/301 (42.52%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHK-TLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCF---------SPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNIL 1062
             +  T + V+R  + LGT+ G + +I + +   + IL  K+  I+ +      +  +A+  + G V +  +            + SV  +H+   I+A+CW  ++ +++ GD+ G +  T +   +  +     +  F         S V QL      L++S  +  ++ +    +   +GNK R+ +        +K        +   RP  +IW ++ NG V  +   K      P      LP +T + +  +     + +S  +  L+   D+N +L W++++I +F   +G +L
Sbjct:   34 RLKCTCLAVSRKWLALGTSAGGLHLIQKEDWKQKLILTHKEGSIAHVACCPHDEDFVAVATSQGLVVVWELHLE---RRGRPERVSVSWEHRGQTITALCWDTSTLRVFVGDSGGKV--TSLRAGSSKLGKGSAFVIFPVQTVTTVDSRVVQLGCQDGRLLVSSLSRCYLADTEREKFWRVGNKERDGEYGACFYSHSKGLLGQSPLLYCARPGSRIWEANFNGEVLSTHQFKQLLACPP------LPLITYREEPRYSPEQRTPQSLAFPKLLLFGDQN-LLTWTDSAIYVFIPQNGQVL 322          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Medaka
Match: hps5 (HPS5 biogenesis of lysosomal organelles complex 2 subunit 2 [Source:NCBI gene;Acc:101167115])

HSP 1 Score: 62.3882 bits (150), Expect = 3.560e-9
Identity = 60/301 (19.93%), Postives = 128/301 (42.52%), Query Frame = 1
Query:  190 NVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHK-TLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCF---------SPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNIL 1062
             +  T + V+R  + LGT+ G + +I + +   + IL  K+  I+ +      +  +A+  + G V +  +            + SV  +H+   I+A+CW  ++ +++ GD+ G +  T +   +  +     +  F         S V QL      L++S  +  ++ +    +   +GNK R+ +        +K        +   RP  +IW ++ NG V  +   K      P      LP +T + +  +     + +S  +  L+   D+N +L W++++I +F   +G +L
Sbjct:   34 RLKCTCLAVSRKWLALGTSAGGLHLIQKEDWKQKLILTHKEGSIAHVACCPHDEDFVAVATSQGLVVVWELHLE---RRGRPERVSVSWEHRGQTITALCWDTSTLRVFVGDSGGKV--TSLRAGSSKLGKGSAFVIFPVQTVTTVDSRVVQLGCQDGRLLVSSLSRCYLADTEREKFWRVGNKERDGEYGACFYSHSKGLLGQSPLLYCARPGSRIWEANFNGEVLSTHQFKQLLACPP------LPLITYREEPRYSPEQRTPQSLAFPKLLLFGDQN-LLTWTDSAIYVFIPQNGQVL 322          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Planmine SMEST
Match: SMESG000064457.1 (SMESG000064457.1)

HSP 1 Score: 1968.74 bits (5099), Expect = 0.000e+0
Identity = 1008/1019 (98.92%), Postives = 1015/1019 (99.61%), Query Frame = 1
Query: 1432 KNWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSSIKINPCNRLRKENRKIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFENXXXXXXXXXXXXXXXXXXXXXXXXLYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNXXXXXXXXXXXXXXXXQSTESYDALMSSNSFTDKGKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPD--DWELLS 4482
            +NWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQS+IKINPCNRLRKENRKIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFE+RSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPIST+DIPDGISTQSTESYDALMSSNSFTDK KLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEK EEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDN+ASLS+GIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSA+QIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPD  DWELLS
Sbjct:   60 ENWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSNIKINPCNRLRKENRKIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFEDRSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPISTVDIPDGISTQSTESYDALMSSNSFTDKDKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKGEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNVASLSTGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAIQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPDDYDWELLS 1078          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Planmine SMEST
Match: SMESG000064457.1 (SMESG000064457.1)

HSP 1 Score: 1964.89 bits (5089), Expect = 0.000e+0
Identity = 1008/1020 (98.82%), Postives = 1015/1020 (99.51%), Query Frame = 1
Query: 1432 KNWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSSIKINPCNRLRKENRKIEVVNFDESGDLT-GQKIKDNSETYQEKKTSSAIFENXXXXXXXXXXXXXXXXXXXXXXXXLYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNXXXXXXXXXXXXXXXXQSTESYDALMSSNSFTDKGKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPD--DWELLS 4482
            +NWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQS+IKINPCNRLRKENRKIEVVNFDESGDLT GQKIKDNSETYQEKKTSSAIFE+RSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPIST+DIPDGISTQSTESYDALMSSNSFTDK KLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEK EEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDN+ASLS+GIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSA+QIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPD  DWELLS
Sbjct:   60 ENWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSNIKINPCNRLRKENRKIEVVNFDESGDLTVGQKIKDNSETYQEKKTSSAIFEDRSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPISTVDIPDGISTQSTESYDALMSSNSFTDKDKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKGEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNVASLSTGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAIQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPDDYDWELLS 1079          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Planmine SMEST
Match: SMESG000064457.1 (SMESG000064457.1)

HSP 1 Score: 1922.52 bits (4979), Expect = 0.000e+0
Identity = 988/999 (98.90%), Postives = 994/999 (99.50%), Query Frame = 1
Query: 1495 MRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSSIKINPCNRLRKENRKIEVVNFDESGDLT-GQKIKDNSETYQEKKTSSAIFENXXXXXXXXXXXXXXXXXXXXXXXXLYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNXXXXXXXXXXXXXXXXQSTESYDALMSSNSFTDKGKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPD--DWELLS 4482
            MRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQS+IKINPCNRLRKENRKIEVVNFDESGDLT GQKIKDNSETYQEKKTSSAIFE+RSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPIST+DIPDGISTQSTESYDALMSSNSFTDK KLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEK EEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDN+ASLS+GIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSA+QIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPD  DWELLS
Sbjct:    1 MRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSNIKINPCNRLRKENRKIEVVNFDESGDLTVGQKIKDNSETYQEKKTSSAIFEDRSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPISTVDIPDGISTQSTESYDALMSSNSFTDKDKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKGEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNVASLSTGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAIQIFKSANRNCIWVITEPFGYVYFSAWVPFVNSFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWINVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTLAEFVKPDDYDWELLS 999          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Planmine SMEST
Match: SMESG000064457.1 (SMESG000064457.1)

HSP 1 Score: 1697.56 bits (4395), Expect = 0.000e+0
Identity = 876/892 (98.21%), Postives = 885/892 (99.22%), Query Frame = 1
Query: 1432 KNWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSSIKINPCNRLRKENRKIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFENXXXXXXXXXXXXXXXXXXXXXXXXLYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNXXXXXXXXXXXXXXXXQSTESYDALMSSNSFTDKGKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFG 4107
            +NWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQS+IKINPCNRLRKENRKIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFE+RSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPIST+DIPDGISTQSTESYDALMSSNSFTDK KLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEK EEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDN+ASLS+GIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSA+QIFKSANRNCIW   + + 
Sbjct:   60 ENWFNKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSNIKINPCNRLRKENRKIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFEDRSIFSSSKFNESESSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTKECLESNDIPDEEHNNYCNISSPISTVDIPDGISTQSTESYDALMSSNSFTDKDKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKDQKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKLCSMTVNKRMIWMTDTKSVLHVGFKNTDDEKGEEYNSNSTEKLFWIQDLNLRTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVTMQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLVTTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKDLVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPIGNGIWFQITLQFLYQTSSTFEDNVASLSTGIQNKVEKMFGYSEMDTKFKKANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGHHWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFDERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSDWREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLPWSELIFKNKDSNAKKVSAIQIFKSANRNCIWFCVDLYS 951          
BLAST of Tectonin beta-propeller repeat containing 2 vs. Planmine SMEST
Match: SMESG000064450.1 (SMESG000064450.1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 442/446 (99.10%), Postives = 445/446 (99.78%), Query Frame = 1
Query:   94 MSDSIKICEHESVEWXXXXXXXXXXXXXXXXXNVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICNIFKMPIASSNKISTSNYQDPDKLVYEIWILRQPICENDSKLVRLSFVPLITTRLQIDPFYFCSQAKISANNDSQQAICVKEPNIGKVDDKNEKLQDKSEITTDNEKT 1431
            MSDSIKICEHESVEWILKLIPKFSKKSFLKKLNVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFG+SIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAP+KLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICNIFKMPIASSNKISTSNYQDPDKLVYEIWILRQPICENDSKLVRLSFVPLITTRLQIDPFYFCSQAKISANNDSQQAICVKEPNIGK DD+NEKLQDKSEITTDNEKT
Sbjct:    1 MSDSIKICEHESVEWILKLIPKFSKKSFLKKLNVSVTSIDVNRDLIVLGTNNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYILAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFCTEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRKISIGNKNRNEKNVFGVSIVNKLCKSDEMEVISVRPNGKIWISDINGIVKKSIILKPDSVFAPEKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLIDENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICNIFKMPIASSNKISTSNYQDPDKLVYEIWILRQPICENDSKLVRLSFVPLITTRLQIDPFYFCSQAKISANNDSQQAICVKEPNIGKADDENEKLQDKSEITTDNEKT 446          
The following BLAST results are available for this feature:
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TECPR26.222e-2326.30tectonin beta-propeller repeat containing 2 [Sourc... [more]
TECPR27.954e-2326.30tectonin beta-propeller repeat containing 2 [Sourc... [more]
HPS52.286e-1424.14HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
HPS52.286e-1424.14HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
HPS51.120e-825.75HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
W09G3.61.242e-720.27pep chromosome:WBcel235:I:13814756:13827988:-1 gen... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG111416.751e-1925.81gene:FBgn0033177 transcript:FBtr0088999[more]
CG111416.751e-1925.81gene:FBgn0033177 transcript:FBtr0088998[more]
CG111416.751e-1925.81gene:FBgn0033177 transcript:FBtr0345799[more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tecpr22.415e-2325.73tectonin beta-propeller repeat containing 2 [Sourc... [more]
tecpr22.998e-2325.73tectonin beta-propeller repeat containing 2 [Sourc... [more]
hps56.198e-1321.75HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TECPR25.459e-2626.62tectonin beta-propeller repeat containing 2 [Sourc... [more]
TECPR27.000e-2626.62tectonin beta-propeller repeat containing 2 [Sourc... [more]
TECPR28.591e-2626.62tectonin beta-propeller repeat containing 2 [Sourc... [more]
hps53.999e-819.68Hermansky-Pudlak syndrome 5 [Source:NCBI gene;Acc:... [more]
hps54.192e-819.68Hermansky-Pudlak syndrome 5 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tecpr24.763e-2626.67tectonin beta-propeller repeat containing 2 [Sourc... [more]
Tecpr21.392e-2427.45tectonin beta-propeller repeat containing 2 [Sourc... [more]
Tecpr21.392e-2427.45tectonin beta-propeller repeat containing 2 [Sourc... [more]
Hps53.302e-1424.41HPS5, biogenesis of lysosomal organelles complex 2... [more]
Hps55.108e-1424.07HPS5, biogenesis of lysosomal organelles complex 2... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O15040|TCPR2_HUMAN3.820e-2226.30Tectonin beta-propeller repeat-containing protein ... [more]
sp|Q6NLL1|Y1411_DROME6.767e-1825.81WD repeat-containing protein CG11141 OS=Drosophila... [more]
sp|Q9UPZ3|HPS5_HUMAN1.098e-1324.14Hermansky-Pudlak syndrome 5 protein OS=Homo sapien... [more]
sp|P59438|HPS5_MOUSE3.939e-1324.07Hermansky-Pudlak syndrome 5 protein homolog OS=Mus... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KT902.735e-3128.10Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7PFY71.172e-3029.64Uncharacterized protein OS=Pomacea canaliculata OX... [more]
K1PQU11.091e-2827.49Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A210PM886.029e-2626.47Tectonin beta-propeller repeat-containing protein ... [more]
A0A0L8GZ846.708e-2527.10Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tecpr26.052e-2226.28tectonin beta-propeller repeat containing 2 [Sourc... [more]
hps51.113e-1020.83HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
hps51.388e-1020.83HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
hps51.405e-1020.83HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tecpr21.247e-2323.72tectonin beta-propeller repeat containing 2 [Sourc... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000040374.17.879e-2625.08pep primary_assembly:ASM223467v1:22:2175661:218111... [more]
hps53.264e-919.93HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
hps53.560e-919.93HPS5 biogenesis of lysosomal organelles complex 2 ... [more]
back to top
BLAST of Tectonin beta-propeller repeat containing 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064457.10.000e+098.92SMESG000064457.1[more]
SMESG000064457.10.000e+098.82SMESG000064457.1[more]
SMESG000064457.10.000e+098.90SMESG000064457.1[more]
SMESG000064457.10.000e+098.21SMESG000064457.1[more]
SMESG000064450.10.000e+099.10SMESG000064450.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002327 ID=SMED30002327|Name=Tectonin beta-propeller repeat containing 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4494bp
TAAAATTTTAAAGTTCATATAAATGACTCAATTTTTAATGAATTCGAAAT
ATACTGCTTAAATATTATTTATTATTTCGAAAACTGTATAATAATGTCAG
ATTCTATAAAAATCTGTGAACACGAATCTGTGGAGTGGATTTTAAAACTA
ATTCCTAAATTCTCGAAAAAGTCTTTTTTAAAAAAATTAAATGTTTCAGT
TACATCAATCGATGTCAATAGAGATTTGATTGTTCTCGGAACAAATAATG
GAAATATATTTATTATTAATCGTTCGAACAATGCAATTGAAAATATATTA
TTAAAAAAAGACGTAATAATTAGTAAATTAAAATTAATACATACTTTGGA
CTTATCTATTGCAATTGGATTAAATGATGGATCTGTTTATATTCTTGCCA
TTCCATTTAATGATTCTTTGAATTATTCTGAAATGAATCAATTTAGTGTT
CCAAGTGATCACAAGACTTTAATTTCTGCAATGTGTTGGAGTAAAAATTC
AGAAAAACTTTATACAGGAGATAACAATGGATTTATTTTTTGCACTGAAG
TTGATCATGTTGCGAAAACTGTGTCAGCTTATGAAGTTTATCAATGCTTT
TCACCAGTCAACCAATTAGCGTATGATCATAAATGTTTAATCATATCATG
TAGCGCCGAAACATTTATGTGGAATTTCAATTTTAATAGGAAAATTTCGA
TTGGAAACAAAAATAGAAACGAGAAAAATGTATTTGGTATATCTATTGTC
AACAAATTATGCAAAAGTGATGAAATGGAAGTTATTAGTGTTAGGCCAAA
TGGAAAAATATGGATAAGCGATATTAATGGGATTGTTAAAAAGTCGATTA
TCTTGAAACCTGATTCGGTGTTTGCTCCTGATAAATTGATGAGTCTTCTT
CCATGTGTCACATCTCAAAGCAAAACTTTTTTTTTCGACAATGTTATTTC
AGGAAAATCAAAATTTTATTTGGGCTTAATTAGTCTCATTGATGAAAACG
AAATATTATTATGGTCAGAAAACTCCATAGTTATTTTTGATATTTGCTCC
GGAAATATTTTATCTTCATCATTTAATCTTGGCAAAATTCAAAATATTTC
AATTTGTAACATATTTAAAATGCCAATTGCTAGCTCGAATAAGATTTCTA
CTTCAAATTATCAAGACCCAGACAAACTGGTATATGAAATTTGGATTCTT
CGACAACCAATTTGTGAGAATGATAGCAAATTAGTTCGACTTTCATTTGT
CCCTTTAATAACTACAAGGTTGCAGATTGATCCTTTTTATTTCTGTTCAC
AAGCCAAAATTTCCGCCAATAACGATAGTCAACAAGCAATTTGTGTTAAA
GAACCAAATATTGGTAAAGTTGATGATAAAAATGAAAAGCTTCAAGACAA
ATCCGAAATTACTACAGACAATGAAAAAACAAAAAATTGGTTCAACAAGA
TCGGTGTTACGAAGCAGATAGATATTGTTGAAACTCTTAATGATATGAGA
TCTAATATGTTAGAATTTACAAATAAAACTAAAGAAGTTTTTAAACAAGG
CCAAGCAATTTTAAACGATGAAAGTGAACTTGTTGTAGAACAAGCTAATG
AATTAACCGAAGAAGGAGTTGTGATTAATTTCGAACATTCCAATTTATCT
ACTGAAAACTCTAGTATCAACTTAGATCCTTCTCTTGAAGTACAATCAAG
TATAAAAATTAATCCTTGTAATCGCCTACGCAAAGAAAACAGAAAAATAG
AAGTTGTTAATTTTGACGAAAGTGGTGATCTTACTGGTCAAAAAATAAAA
GATAATTCTGAAACATATCAAGAGAAAAAAACTTCTTCGGCAATATTTGA
AAATCGAAGCATTTTTTCATCATCCAAATTCAATGAGTCCGAAAGTAGTG
AAGATGATTCATATGAAAGATCAGAATTATATCTTAATATTATTGGTCGT
CCTTTAAACATAAACTCCTATTCTGAAAATAATTTCTGTCATCCTAATGG
CGAAGAAATTGTTGCCGGTGATGCAGATTTATTAAATACCAAAGAGTGTT
TAGAATCGAATGATATTCCGGATGAAGAACATAACAACTATTGTAATATA
TCTAGTCCTATAAGTACAATAGATATACCAGATGGGATTAGTACCCAGTC
GACTGAATCTTATGACGCTTTGATGAGTAGTAATTCTTTTACTGATAAAG
GCAAATTAATAAAAGAATTATCCAACAATCCAAATCCAATCATGACAAAT
GATCTTATTGAAAATGAAAGAGACCATGATTTATCATTTACGATTAAAAA
CACTCTCGAAGATGTTTTAGATTATTCTCAAATTCAAAAGGATCAAAAAC
CTCTACAAATTTCAGAAGAAGACGTCCAAATACCTCATAAAAATGCTGAA
CTTAAAAAAATTGTTCTTTCGAATTTAATTCTCCTCCAAAGTAATAAATG
GATAAGTCATCGTGGCCCTGTCCTTCCTAACAATGTCAAGCTATGTTCAA
TGACTGTTAATAAGCGCATGATTTGGATGACCGATACTAAATCAGTTTTA
CATGTCGGTTTTAAGAATACTGACGATGAGAAAAGTGAGGAATACAATTC
AAATTCGACAGAAAAATTATTTTGGATCCAAGATTTAAATTTACGCACTG
ATAAATTAGCTTCATCACCTAACGGATTTATTTTGTGGCGTGAAAAAAGC
GGAGAAGTATCAGTCTATACTGGTGTTACTAAAATTCTGACTTCAAAAGT
CGTCAGAGATAAAGTATTGCTCAAACAATATTGGGAGGTAACAATGCAAG
AAATCAAGGACATTGATATCGACGAAGAAATGGCTGTCGTTGTTACTAAA
AAGGGTCAATTAAAAGTTATCAATGGGATTTCAAGTAGAACTCCATATAA
ACAATCAAAATCTGTTAATATTACAGGACATGTTACTTTGGTAACCACGT
TTAATGGTTTAATTTGGTGCGTAACTGAATTGGACGTTGCAAACACATCG
AAATTGTCGCAACATGTTTTTGCCTGTCAAGCCAAAGACGAAGATGGAAA
TTTCAATAGCACATACTGGCGTACTGTTCCTTTATTGAAGGATTTAGTGA
AAGAAGAAGAACAAGAATTTGGTGGTTTGGGAGGCAGTGAATTAATCAAG
TCCATACATTTGGGAACCGGTAACTTAGCATGGATCTTGACAATCGATAA
TATGTGTTTTTACTGTCAAAATGTATCTTCAGAAAATCCTATCGGGAATG
GAATTTGGTTTCAGATTACTTTGCAATTTCTGTACCAAACATCTTCGACC
TTTGAAGATAATATTGCATCTTTGTCATCTGGTATTCAGAATAAGGTTGA
AAAAATGTTCGGTTACTCGGAAATGGATACAAAATTTAAAAAAGCAAACC
TGATGAATTGTACTTCATCGATTTTAATATCAGTAAAATCTGTACCCAAA
AGAGCTAGAGGAAATGGATTACTTTGGATTACATCCACTGAAAGAAATTC
ACCGTGCATTTTATTTGAGTCTGATAGAAATATTCTTGGCCATCATTGGA
TAGATTGTTTTTCTGTTCTCCAGAATCCAAAAAATAGATTACCTGGATTG
CCTGCTTTAACATCTTGGGCTGCCATTGAATTTTCTCCTCCAAATACGTT
ATGGCTTTTACACAAATCCGGAGAGCTGTTTTGTTATTTTGATGAAAGAA
TTATTAGAACAGTCACCATTCCTACGTTATATGGTAGAATTGTTAAAATT
TCTGTACGAAATACAATATTGTGTATTCTTACAACTCAATCAAAGGTTTT
CATTAGAATCGGAATAACAGAAAATAATCCATATGGCTCAGACTGGAGAG
AAATTAAAAGAGCCTGGAATAAGAATGAAAAAATTAAAAACATTTCGTGT
TCTGATAATGAAATATGGCTAATTTTTGAGAATCGAGTTTTTTACAACGA
GAATATTAAAGCGTTACTGTTTGATGTATCGAAAAAATTGCCATGGAGTG
AACTCATTTTTAAAAACAAAGATTCCAATGCTAAAAAAGTATCCGCTGTT
CAGATTTTCAAATCTGCAAATAGAAATTGCATTTGGGTAATTACCGAGCC
TTTTGGTTATGTTTATTTTTCTGCTTGGGTACCATTTGTCAACAGTTTTG
CGTGGACTTATATTCTAGGCCCCCCTGCTGAGAGTATTCGTGTGTCAAAT
GAAAATGTTTGGATTGTTGAGCAAGCAACCGGAAATTTATTTGTACGCTG
TGGAGTCGATTGGGCCAATCAGCCCATGGGCGATTATTGGATTAATGTGC
CTCTTATTACTAAACCTGTGATAGGGATGACAGTTTCATTGGATAATCAA
GTTTTTGTCATCGATTCTTTTAATCGGCTTCTTAAGCATAGCTGGACCAT
TATCGAAGGAAATGTTTCGCTTTCAGAGTCCGAATCTACATTAGCAGAAT
TTGTGAAACCCGATGACTGGGAACTTTTGTCTTAAAATTATGAA
back to top

protein sequence of SMED30002327-orf-1

>SMED30002327-orf-1 ID=SMED30002327-orf-1|Name=SMED30002327-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1464bp
MSDSIKICEHESVEWILKLIPKFSKKSFLKKLNVSVTSIDVNRDLIVLGT
NNGNIFIINRSNNAIENILLKKDVIISKLKLIHTLDLSIAIGLNDGSVYI
LAIPFNDSLNYSEMNQFSVPSDHKTLISAMCWSKNSEKLYTGDNNGFIFC
TEVDHVAKTVSAYEVYQCFSPVNQLAYDHKCLIISCSAETFMWNFNFNRK
ISIGNKNRNEKNVFGISIVNKLCKSDEMEVISVRPNGKIWISDINGIVKK
SIILKPDSVFAPDKLMSLLPCVTSQSKTFFFDNVISGKSKFYLGLISLID
ENEILLWSENSIVIFDICSGNILSSSFNLGKIQNISICNIFKMPIASSNK
ISTSNYQDPDKLVYEIWILRQPICENDSKLVRLSFVPLITTRLQIDPFYF
CSQAKISANNDSQQAICVKEPNIGKVDDKNEKLQDKSEITTDNEKTKNWF
NKIGVTKQIDIVETLNDMRSNMLEFTNKTKEVFKQGQAILNDESELVVEQ
ANELTEEGVVINFEHSNLSTENSSINLDPSLEVQSSIKINPCNRLRKENR
KIEVVNFDESGDLTGQKIKDNSETYQEKKTSSAIFENRSIFSSSKFNESE
SSEDDSYERSELYLNIIGRPLNINSYSENNFCHPNGEEIVAGDADLLNTK
ECLESNDIPDEEHNNYCNISSPISTIDIPDGISTQSTESYDALMSSNSFT
DKGKLIKELSNNPNPIMTNDLIENERDHDLSFTIKNTLEDVLDYSQIQKD
QKPLQISEEDVQIPHKNAELKKIVLSNLILLQSNKWISHRGPVLPNNVKL
CSMTVNKRMIWMTDTKSVLHVGFKNTDDEKSEEYNSNSTEKLFWIQDLNL
RTDKLASSPNGFILWREKSGEVSVYTGVTKILTSKVVRDKVLLKQYWEVT
MQEIKDIDIDEEMAVVVTKKGQLKVINGISSRTPYKQSKSVNITGHVTLV
TTFNGLIWCVTELDVANTSKLSQHVFACQAKDEDGNFNSTYWRTVPLLKD
LVKEEEQEFGGLGGSELIKSIHLGTGNLAWILTIDNMCFYCQNVSSENPI
GNGIWFQITLQFLYQTSSTFEDNIASLSSGIQNKVEKMFGYSEMDTKFKK
ANLMNCTSSILISVKSVPKRARGNGLLWITSTERNSPCILFESDRNILGH
HWIDCFSVLQNPKNRLPGLPALTSWAAIEFSPPNTLWLLHKSGELFCYFD
ERIIRTVTIPTLYGRIVKISVRNTILCILTTQSKVFIRIGITENNPYGSD
WREIKRAWNKNEKIKNISCSDNEIWLIFENRVFYNENIKALLFDVSKKLP
WSELIFKNKDSNAKKVSAVQIFKSANRNCIWVITEPFGYVYFSAWVPFVN
SFAWTYILGPPAESIRVSNENVWIVEQATGNLFVRCGVDWANQPMGDYWI
NVPLITKPVIGMTVSLDNQVFVIDSFNRLLKHSWTIIEGNVSLSESESTL
AEFVKPDDWELLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0032527protein exit from endoplasmic reticulum
GO:0006914autophagy
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 2..245
e-value: 3.5E-9
score: 38.5
NoneNo IPR availablePANTHERPTHR23287RUBY-EYE2-LIKE PROTEINcoord: 17..965
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 32..297