SMED30002312

Overview
NameSMED30002312
Smed IDSMED30002312
Length (bp)1692
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002312 (SMED30002312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002312 (SMED30002312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002312

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30002312h1SMcG0009363 SmedASXL_004932SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002312h1SMcG0009364 SmedASXL_004932SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30002312h1SMcG0009363 dd_Smed_v4_31771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002312h1SMcG0009363 dd_Smed_v4_31771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002312h1SMcG0009363 dd_Smed_v4_31771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002312 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000621:2238..3928 +8257
Homology
BLAST of SMED30002312 vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 51.2174 bits (121), Expect = 1.722e-6
Identity = 41/168 (24.40%), Postives = 70/168 (41.67%), Query Frame = 1
Query:  127 FASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTFNA------FWKLVNKTTNIQEKS---------RFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNF 585
            F+  T  HG   +    A   R  WI+++ ++    I+ FIT+L  +L+  V TE          PTV IC   P+    K+      +  +S   D +N+      F    + T + Q+++         R +   Y     +    +D+ V C Y NA  CN+++F
Sbjct:   15 FSCWTSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVNTETTLQFAERTFPTVTICHLNPW----KLSETKSVDPDMSALIDAYNSDSSSAQFGLPASLTADRQQQASKWTLMYSERLNEKQYNDAADIAYSYDDMVVSCTY-NAKTCNITDF 177          
BLAST of SMED30002312 vs. TrEMBL
Match: A0A1I8J7S3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.201e-11
Identity = 91/398 (22.86%), Postives = 150/398 (37.69%), Query Frame = 1
Query:  139 TKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRPVI-------------FNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMI--EDLS-VCAKIDIP----LDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHS--TRISGFKQFMTTINLNIRIQNEFLVKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWIDDGSCISPCTSKSYS-WSNIN 1263
            T AHGF ++   E  + R LW++I+         H I + + +L + V  E   N+ PF +P V  CP+ PY +     R +               ++++  AF     FW    +     E +R+S+  Y  E  +        ++C +     C   N  I  + LS  C  + +         + S   L ++   F     +P      +   +     Y  Y         HS   ++S  + ++ +  +         VK  C  NP P+ +L + + +  F+YTK  C  VK Q  I   C C SE   +P+          P+CH++    I+Y      P   + NK T Q     V   +F   W    +   PC   +YS WS  N
Sbjct:    2 TTAHGFYKL-RVENKAVRRLWMLIICCALIAFGVHIILLAINYLQYIVTVETKYNSEPFVLPDVTFCPNQPYHESVWCRRDLACTQDSNATIPSLGGDLSVQTAFRNTYNFWTAAGEGFIAPEIARYSLRKYTVEANMTRNPVTTVLYCNFRGET-CGPWNMTIFFDPLSEACVTVSMTDRRVFQAGEQSALDLMLFSFIFVQNPSVPYYKAITNMERFDFNFGYSMYVHPPNTVPDHSQDVQVSETRNYVISAGIERSKSINSPVKK-CAENPSPLTLLQF-DKLRSFAYTKDACESVKAQEIIVGRCSCLSEKYLVPSS----LASTKPYCHEIDPSLIQY------PYTTVANK-TVQYIDRYVASTNFTLCWNATVNLTLPC---NYSYWSKWN 381          
BLAST of SMED30002312 vs. TrEMBL
Match: A0A267EAK0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003120g1 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.005e-10
Identity = 85/383 (22.19%), Postives = 153/383 (39.95%), Query Frame = 1
Query:  109 KKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDR-PVI--FNMTLSGAFDTFNAFWKLVNKT-TNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNF----------------MIEDLSVCAKIDIPLDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGF---KQFMTTINLNIRIQNEFLVKNSCLSNP--EPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHD 1182
            KK L  F  +T AHGF ++    ++  RI+W++I+   F G   H I++   F    V TE+   +  F  P + IC  + ++ L + +R P I   N  +        +FW   N++ + I      S+  Y  E  +   S+++ + C +   + C+  NF                    L V  + D  L         +N    F ++   L     Y+  +  ++       Q K   P      + GF   +   T + L      E +V   C      +P++ +     + Q+ Y+   C +   QN++ ++C+C SE LP+P    NIT   + FCH +++   E LK          + +++ +     CHD
Sbjct:   38 KKLLKQFCESTSAHGFHKIFQGSSILHRIVWLLIIITAFSGFSAHLISLFSRFNEGPVNTEISVYSTNFVFPDISICATSHFS-LRRYERNPKIRSLNKPIKELVSDIRSFWDPNNESDSEINGDLLNSLKSYLHEVNITKQSQEMILHCDFAGTI-CSYINFTEYIDPNYFSCFTFSPRERHLLVGGERDGGLSVIMYVGDMMN----FISEEDSLR----YSKGFRAVI-------QEKGTRPEM----LEGFYVQEHACTYVQLGY---TEEVVLRKCAEEESLQPLEFVDRYGKVTQYRYSVRDCQVNLYQNFLNESCRCVSEILPLPAKFRNITRHNITFCHHINE---ERLKQSRGA----KSNDSSSVREKQECHD 389          
BLAST of SMED30002312 vs. TrEMBL
Match: A0A1I8GT86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.409e-9
Identity = 31/97 (31.96%), Postives = 56/97 (57.73%), Query Frame = 1
Query:   85 DESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAP--YAKLFK 369
            DE ++ S+   L  FA +T AHGF ++A +   +G  LW++ +   + GL +H  T+++ F +H V T ++   VPF+ P + +C   P  Y+++ K
Sbjct:   21 DEERKASVSVSLLSFADSTTAHGFSRLAGSSGRTGSGLWLLFLLAAYAGLCYHTATLVLKFQSHPVSTSLIAE-VPFQYPDIYLCSANPVGYSRITK 116          
BLAST of SMED30002312 vs. TrEMBL
Match: A0A1I8I9S9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.449e-9
Identity = 77/334 (23.05%), Postives = 136/334 (40.72%), Query Frame = 1
Query:  127 FASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVD--RPVIFNMTLSG--AFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWY----SFFTDASYLPNTTFYNS--KYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLV---------------------KNSCL--SNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIP 1029
            F  TT AHGFL +    ++  RI+W +++ + FGG   H  T++  +L++ + TE+  + V FE P V +C    Y     +D   P I  +T S   +   +N FW  +N T    +             Q + L +DL +  KY+  V      + I   +    I   ++  + +L+  NV        F  A+  P     NS    M ++ + +  Y   +  P      ++G +  ++  N    + N F+V                     K  C   SN  P+++L+    +  + YT+S C  ++ Q Y+ + C C S    +P
Sbjct:   41 FFVTTTAHGFLHI-VQNSIYLRIVWALLIVIAFGGFGLHLSTLVEKYLSYPLTTEIRYSEVEFEFPDVTVCLTTKYRHCLNIDVRDPRIGLVTNSTVPSLGNYN-FWSALNNTFTFWK-------------QAYGLKDDLLI--KYST-VGMRSYTYEINITNRRTDIATGIEYKQKALNLDNVVAYDDPELFRCATVRPKNRAINSVNDAMGLILSIFDQYIGNKTTPLIDRAWVAGVRVTLSEPNARPNLINSFIVPPGTIKHTKVSMTRQEKRKTPKQDCYESSNDLPIQVLNPDGTLSSYRYTQSDCRELELQKYVMRKCGCVSNFKLVP 356          
BLAST of SMED30002312 vs. TrEMBL
Match: A0A1I8J7I0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.726e-9
Identity = 77/333 (23.12%), Postives = 134/333 (40.24%), Query Frame = 1
Query:  127 FASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVD--RPVIFNMTLSGAFDTFN-AFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWY----SFFTDASYLPNTTFYNS--KYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLV---------------------KNSCL--SNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIP 1029
            F  TT AHGFL +    ++  RI+W +++ + FGG   H  T++  +L++ + TE+  + V FE P V +C    Y     +D   P I  +T S      N  FW  +N T    +             Q + L +DL +  KY+  V      + I   +    I   ++  + +L+  NV        F  A+  P     NS    M ++ + +  Y   +  P      ++G +  ++  N    + N F+V                     K  C   SN  P+++L+    +  + YT+S C  ++ Q Y+ + C C S    +P
Sbjct:   41 FFVTTTAHGFLHI-VQNSIYLRIVWALLIVIAFGGFGLHLSTLVEKYLSYPLTTEIRYSEVEFEFPDVTVCLTTKYRHCLNIDVRDPRIGLVTNSTVPSLGNYHFWSALNNTFTFWK-------------QAYGLKDDLLI--KYST-VGMRGYTYEINITNRRTDIATGIEYKQKALNLDNVVAYDDPELFRCATVRPKDRAINSVNDAMGLILSIFDQYIGNKTTPLIDRAWVAGVRVTLSEPNARPNLINSFIVPPGTIKHTKVSMTRQEKRKTPKQDCYESSNDLPIQVLNPDGTLSSYRYTQSDCRELELQKYVMRKCGCVSNFKLVP 356          
BLAST of SMED30002312 vs. Ensembl Nematostella
Match: EDO37453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR1])

HSP 1 Score: 48.9062 bits (115), Expect = 5.399e-6
Identity = 28/114 (24.56%), Postives = 53/114 (46.49%), Query Frame = 1
Query:   85 DESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEM-VNNAVPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTF 423
            +E  R ++   ++ F   T AHGF ++A  ++   R+ W+ ++   FG        +LMI+L+    T++ + +A     P V +C        F + R       L+G+F+ F
Sbjct:    5 EEKCRQTVSGLIWDFFGQTTAHGFGKIANAKSRLRRMFWVCLVMAAFGMFSLQIYDLLMIYLSRPTGTQIWMKHAPSIAFPAVTLCN-------FNIVRRSQITSELAGSFENF 111          
BLAST of SMED30002312 vs. Planmine SMEST
Match: SMESG000079503.1 (SMESG000079503.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 434/436 (99.54%), Postives = 435/436 (99.77%), Query Frame = 1
Query:    7 MKNNDNLDKTDGSHLSTFSSTAELVFDESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLVKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWIDDGSCISPCTSKSYSWSNINAVSWPTVTFTNTPNRFL 1314
            MKNNDNLDKTDGSHLSTFSSTAELVFDESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLVKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWIDDGSCISPCTSKSYSWSNINAVSWPTVTFTNTPN+ L
Sbjct:    1 MKNNDNLDKTDGSHLSTFSSTAELVFDESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLVKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWIDDGSCISPCTSKSYSWSNINAVSWPTVTFTNTPNKIL 436          

HSP 2 Score: 168.703 bits (426), Expect = 1.530e-45
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = 3
Query: 1305 QILISDIQSNINQKMAKYNVTENDLVYSTIKTTSDIISNRKLGSFKIVPQTPSGLKITESENYPLTNFLSTIGSILVLWVGXXXXXXXXXXXXXXXXXXXXCDCGKSN 1628
            +ILISDIQSNINQKMAKYNVTENDLVYSTIKTTSDIISNRKLGSFKIVPQTPSGLKITESENYPLTNFLSTIGSILVLWVGISIINIIEFFEMIFNIFRIICDCGKSN
Sbjct:  434 KILISDIQSNINQKMAKYNVTENDLVYSTIKTTSDIISNRKLGSFKIVPQTPSGLKITESENYPLTNFLSTIGSILVLWVGISIINIIEFFEMIFNIFRIICDCGKSN 541          
BLAST of SMED30002312 vs. Planmine SMEST
Match: SMESG000079502.1 (SMESG000079502.1)

HSP 1 Score: 371.318 bits (952), Expect = 3.068e-122
Identity = 176/420 (41.90%), Postives = 269/420 (64.05%), Query Frame = 1
Query:   25 LDKTDGSHLSTFSSTAELVFDESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLVKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPI--NILNNKETAQLTSSSVCHDHFLNSWIDDGSCISPCTSKSYSWSNINAVSWP 1278
            + + D + + + SS +++ F  ++ +S+K+  Y +ASTT  HGFLQ+ TT+ ++G+I+W+  M +   GL +HF+T+L+  L HEVQTEM  +  P+E P+++ICP+ PY  LF  ++ +I N+T    F  FN FW  VN+TT I+ KSR S APYA E Q   L+ED  + CKYN   KCN   FM++DLS C KIDIP  T     + LN+++++  D+S   +  F ++K +   R +++T+Q+K+EYP+F++ RI G +Q M  I L+IR+Q  F V +SC  NP   +ILS+ +   QF+YT+SLC+M+KKQ  +  NC C+SE LPI + +    I+ +PFCHK+S+GFI +L    N    ++   KE+ +L  +S CHD++L+ W DDG+C   CT+KSYS   +    WP
Sbjct:    5 ISQEDTNSVISLSSKSDINFQNNRTSSVKEYFYEWASTTTTHGFLQIVTTKTITGKIIWLTFMIVAISGLSYHFVTLLIGHLNHEVQTEMSKDVTPYETPSLVICPEIPYVNLFNTEKAIISNLTFLDIFQLFNNFWSTVNQTTEIKTKSRLSFAPYAYELQQLVLAEDFQLICKYNAEQKCNSFTFMVQDLSNCIKIDIPTSTVTQPFNSLNIFFAYNFDSSRDSSVAFLDNKDIIAERKSFITFQSKDEYPDFNTNRIFGIRQQMAAIYLDIRVQQLFQVGDSCFVNPSNYEILSFDSKKTQFAYTQSLCMMLKKQASVKDNCGCYSETLPIESTTQYSKIEQIPFCHKMSRGFINFLIGNANLTLYSLTLEKESIKLIQNSKCHDNYLSIWQDDGTCKPKCTTKSYSTGYVLYNQWP 424          

HSP 2 Score: 70.4774 bits (171), Expect = 1.305e-12
Identity = 35/81 (43.21%), Postives = 54/81 (66.67%), Query Frame = 3
Query: 1317 SDIQSNIN----QKMAKYNVTENDLVYSTIKTTSDIISNRKLGSFKIVPQTPSGLKITESENYPLTNFLSTIGSILVLWVG 1547
            SDIQ  IN    +K AKYN++ ++   S ++   +++   K+G+FK++P    GL+I E E+YPL NFLS+ G+IL LW+G
Sbjct:  434 SDIQGAINMTLMKKAAKYNLSLSEFRLSALQQLEELVI-YKMGAFKVMPSRQYGLQIIEKESYPLANFLSSFGAILGLWIG 513          
BLAST of SMED30002312 vs. Planmine SMEST
Match: SMESG000013072.1 (SMESG000013072.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.620e-19
Identity = 99/404 (24.50%), Postives = 169/404 (41.83%), Query Frame = 1
Query:  127 FASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEM-VNNAVPFEMPTVIICPDAPY----AKLFK---------VDRPVIFNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKY-NNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQLNVWYSFF------TDASYLPNTTFYNSKYMYILRTAYLTY-QAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFL---VKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWIDD---GSCISPCTSKSYSWS 1254
            F   T AHGF +V     +  RI+WI IM +T  GL+   + +L   LA  +  E+ + +   F MP V ICP   +     KL            D  V+ N++    F   +  W ++    +  +  R+SI   +Q   L     D+ V   Y    V  N  +F++        I  P D    +L+++   +          D  Y   + F +S  +  +R+    +       P F +  +   +  +  + +    +NE+    + N C +N  P++I      I +F YT+S CL ++KQ YI++NC C SE L +P   + I   ++P CH++S   I           ++       L  +  CHD FL S+  D    +C  PC S ++++ 
Sbjct:   39 FCLKTNAHGFFKVIEDTKIM-RIIWICIMCVTVSGLLALIVVLLERLLASNLNAEVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWNILGFEADANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIY--ESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIE---RNEYYLYEINNKCQNNNSPLRI-RQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLP---EEIPETVIP-CHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYD 431          
BLAST of SMED30002312 vs. Planmine SMEST
Match: SMESG000032618.1 (SMESG000032618.1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.767e-16
Identity = 97/416 (23.32%), Postives = 178/416 (42.79%), Query Frame = 1
Query:   76 LVFDESKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRI-LWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRP---VIFNMTLSGAFDTFNAFWK--LVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVF-CKYNNAVKCNV----SNFMIEDLSVCAKIDIPLDTTKT----SLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFL-----VKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPN-YSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDH-FLNSWIDDGSCISPCTSKSYSWSN 1257
            +  +  K   +K++L  F  TT AHGF+++   +     I  WI+++ L+     +H   + + +    + T++  +    + P+V IC D P   L+  +       +N +          FW    VN+T  I   S  S+ P+  +   F +   L VF C   +   C      S F++ +  +CA +D+    T      S S + +W S   +       T+ N   +YI          K + P   S+  +G+    TT N  I +Q  F+      +N CL   + ++I  +   I   +Y++ LC M+  QN ++  C+C S  L IP  +S ++  +   FCH +    +         +N+ + +   QL +   C+++ + NS +D  SCI  C +  Y+ +N
Sbjct:    1 MALESGKSELLKEELVEFLETTTAHGFIRLVLFKHRKIVITFWIVVIILSIVAFAYHLYVLSLRYTGVPLSTKLAFSPFNQDWPSVTICFDNP--NLYGGNSTNYIPYYNNSFQNVSSLVREFWSSPYVNQTDQISLLSLQSLIPFGMKSGAF-VDPVLPVFKCVTYSDGNCRQILKHSRFVMNN-KICATVDLQESNTTNNVIHSFSIIYLWMSSTLNTYVSGWPTWDNFVSVYI--------HGKWQLP---SSSTAGYAIPDTTGNAYIYLQKTFINMESTKRNPCLDVADNVEISDFDGQIRSLNYSQQLCKMINIQNQLWDKCQCISSNLLIPGRFSRHLNENQNIFCHHIHSNLL---------LNMTDFQHLNQLKAKLSCYENVYFNSPVD--SCIQYCNNAIYNGNN 390          
BLAST of SMED30002312 vs. Planmine SMEST
Match: SMESG000032616.1 (SMESG000032616.1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.609e-16
Identity = 98/411 (23.84%), Postives = 177/411 (43.07%), Query Frame = 1
Query:   91 SKRNSIKKQLYYFASTTKAHGFLQVATTEALSGRI-LWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNAVPFEMPTVIICPDAPYAKLFKVDRP---VIFNMTLSGAFDTFNAFWK--LVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVF-CKYNNAVKCNV----SNFMIEDLSVCAKIDIPLDTTKT----SLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFL-----VKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPN-YSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDH-FLNSWIDDGSCISPCTSKSYSWSN 1257
            SK   +K++L  F  TT AHGF+++   +     I  WI+++ L+     +H   + + +    + T++  +    + P+V IC D P   L+  +       +N +          FW    VN+T  I   S  S+ P+  +   F +   L VF C   +   C      S F++ +  +CA +D+    T      S S + +W S   +       T+ N   +YI          K + P   S+  +G+    TT N  I +Q  F+      +N CL   + ++I  +   I   +Y++ LC M+  QN ++  C+C S  L IP  +S ++  +   FCH +    +         +N+ + +   QL +   C+++ + NS +D  SCI  C +  Y+ +N
Sbjct:    6 SKSELLKEELVEFLETTTAHGFIRLVLFKHRKIVITFWIVVIILSIVAFAYHLYVLSLRYTGVPLSTKLAFSPFNQDWPSVTICFDNP--NLYGGNSTNYIPYYNNSFQNVSSLVREFWSSPYVNQTDQISLLSLQSLIPFGMKSGAF-VDPVLPVFKCVTYSDGNCRQILKHSRFVMNN-KICATVDLQESNTTNNVIHSFSIIYLWMSSTLNTYVSGWPTWDNFVSVYI--------HGKWQLP---SSSTAGYAIPDTTGNAYIYLQKTFINMESTKRNPCLDVADNVEISDFDGQIRSLNYSQQLCKMINIQNQLWDKCQCISSNLLIPGRFSRHLNENQNIFCHHIHSNLL---------LNMTDFQHLNQLKAKLSCYENVYFNSPVD--SCIQYCNNAIYNGNN 390          
The following BLAST results are available for this feature:
BLAST of SMED30002312 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
del-41.722e-624.40DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
back to top
BLAST of SMED30002312 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J7S33.201e-1122.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EAK01.005e-1022.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GT861.409e-931.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I9S98.449e-923.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J7I08.726e-923.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30002312 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374535.399e-624.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002312 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002312 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079503.11.530e-4599.54SMESG000079503.1[more]
SMESG000079502.13.068e-12241.90SMESG000079502.1[more]
SMESG000013072.12.620e-1924.50SMESG000013072.1[more]
SMESG000032618.11.767e-1623.32SMESG000032618.1[more]
SMESG000032616.12.609e-1623.84SMESG000032616.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002312 ID=SMED30002312|Name=SMED30002312|organism=Schmidtea mediterranea sexual|type=transcript|length=1692bp
TGAGAAATGAAAAACAATGATAATCTGGATAAAACAGACGGAAGCCATTT
GAGCACATTTTCAAGCACTGCCGAATTGGTATTTGATGAATCGAAAAGGA
ACTCCATCAAAAAACAGTTGTATTACTTCGCATCGACTACAAAAGCTCAT
GGATTCTTGCAAGTCGCCACGACAGAAGCGTTAAGTGGCCGGATTTTATG
GATCATAATTATGGCACTGACATTTGGCGGTTTGATATTTCATTTCATAA
CAATGTTGATGATTTTCCTCGCTCACGAAGTACAGACAGAAATGGTCAAC
AACGCCGTTCCGTTTGAAATGCCCACAGTTATAATATGTCCTGATGCTCC
TTACGCAAAGTTGTTTAAAGTCGACAGGCCGGTTATTTTTAATATGACAT
TGTCGGGTGCCTTTGACACTTTCAACGCATTTTGGAAACTCGTCAATAAA
ACGACCAACATTCAAGAGAAAAGCCGGTTCTCAATTGCTCCATATGCCCA
GGAATATCAGTTGTTTACATTATCCGAAGATCTTACCGTTTTTTGTAAGT
ATAACAACGCAGTGAAGTGTAACGTGAGTAACTTTATGATAGAGGATTTG
TCGGTTTGTGCTAAAATTGACATTCCTCTTGATACCACCAAAACATCTTT
ATCTCAGCTGAATGTTTGGTATTCGTTTTTCACCGATGCTTCTTATCTTC
CTAATACCACGTTTTATAACTCGAAGTATATGTATATTCTAAGGACCGCA
TATTTAACGTACCAAGCAAAGGAAGAATATCCAAACTTTCATTCGACACG
GATTTCTGGATTTAAACAATTTATGACGACAATAAACTTAAATATTCGAA
TTCAGAACGAATTCCTTGTGAAGAATTCATGTCTTTCAAATCCGGAACCG
ATGAAGATATTATCCTATGGAAACGCAATTTTACAGTTTTCCTACACAAA
AAGCTTATGTCTTATGGTAAAAAAACAAAACTACATATTTCAGAATTGCA
AATGTTTTTCTGAGGCCCTTCCGATTCCAAATTACTCTGACAATATTACT
ATAGATATCGTTCCTTTCTGTCACAAGTTGAGCAAAGGCTTCATTGAGTA
TCTGAAAACGATTCCAAACCCAATAAACATTCTGAATAACAAGGAAACGG
CACAGTTGACATCGAGTTCAGTGTGCCATGATCATTTTCTTAATTCTTGG
ATAGATGACGGAAGCTGCATTTCCCCGTGCACTTCCAAGAGTTATTCTTG
GAGCAACATTAACGCAGTCAGTTGGCCGACGGTCACCTTTACTAACACTC
CTAACAGATTCTTATAAGTGATATTCAATCAAATATCAACCAGAAAATGG
CAAAATATAACGTGACGGAGAACGATCTAGTTTATTCAACAATTAAAACT
ACTTCAGACATAATTAGTAATAGAAAATTGGGTAGTTTCAAAATAGTTCC
CCAAACTCCGTCTGGACTTAAGATTACTGAGAGTGAGAATTATCCCTTGA
CTAATTTCCTATCAACTATCGGCTCCATTTTGGTTCTCTGGGTCGGGATT
AGCATTATAAACATAATTGAATTTTTTGAAATGATTTTTAACATTTTTAG
AATCATTTGTGATTGTGGAAAATCTAACTAAGTCAATTTTGTAGAAGCTT
TTACTGTTTTACCAAAACCCATCAAGAAGGATTCATGTGGAG
back to top

protein sequence of SMED30002312-orf-1

>SMED30002312-orf-1 ID=SMED30002312-orf-1|Name=SMED30002312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MKNNDNLDKTDGSHLSTFSSTAELVFDESKRNSIKKQLYYFASTTKAHGF
LQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEMVNNA
VPFEMPTVIICPDAPYAKLFKVDRPVIFNMTLSGAFDTFNAFWKLVNKTT
NIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKYNNAVKCNVSNFMIEDLSV
CAKIDIPLDTTKTSLSQLNVWYSFFTDASYLPNTTFYNSKYMYILRTAYL
TYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFLVKNSCLSNPEPMK
ILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITID
IVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWID
DGSCISPCTSKSYSWSNINAVSWPTVTFTNTPNRFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 62..91
e-value: 8.5E-7
score: 30.2
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 92..417
e-value: 8.5E-7
score: 30.2
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 114..247
e-value: 8.5E-7
score: 30.2
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 284..408
e-value: 8.5E-7
score: 30.2
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 41..427
e-value: 2.4E-26
score: 92.7