SMED30002304

Overview
NameSMED30002304
Smed IDSMED30002304
Length (bp)1047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002304 (SMED30002304) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002304 (SMED30002304) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002304

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 65

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002304h1SMcG0016777 SmedASXL_000441SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_000980SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_005166SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_004988SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_016624SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_001786SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_003521SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_014120SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_005997SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_001434SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_014121SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_016623SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 SmedASXL_003005SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0010369 Contig53819uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0010369 Contig53819newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig53819uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig53819newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig51836newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig51836uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig11750newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig11750uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig36489uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002304h1SMcG0016777 Contig36489newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 dd_Smed_v6_10214_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0016777 dd_Smed_v6_11466_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002304h1SMcG0019935 dd_Smed_v6_11466_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002304h1SMcG0016777 dd_Smed_v6_15904_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002304h1SMcG0016777 dd_Smed_v6_15904_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002304h1SMcG0016777 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002304h1SMcG0016777 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0016777 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002304h1SMcG0016777 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002304h1SMcG0016777 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002304h1SMcG0016777 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002304h1SMcG0019935 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002304 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001250:45618..51298 -5180
v31.001250:51524..53480 -2036
Homology
BLAST of SMED30002304 vs. Planmine SMEST
Match: SMESG000077685.1 (SMESG000077685.1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 3
Query:    3 SLENCEAVXXXXXXXXXXXXQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            SLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
Sbjct: 1714 SLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 2061          

HSP 2 Score: 271.552 bits (693), Expect = 1.038e-81
Identity = 179/348 (51.44%), Postives = 237/348 (68.10%), Query Frame = 3
Query:    6 LENCEAVXXXXXXXXXXXXQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEI-TSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            LENCEAVEELL+ LESLEEQCN  K++IE+K+ E   +IK Q A E  L   A+LMNE E E+  S+ K+    A+EE+L+KL+ +KSK    KN LE I + + +  +P+     C+  ++KY +L++ I  L   L   K+NWS ++  KS IE+SLET+ +DI   H    GIHG D  DK ++ ++ K  L DL  +E+  N+L   AK LGS  P+ E+  LK+  L+ K++L+ EIK NEKDL+NH+Q+ ND+   HDW+ + E L ++I   P+TK GLIEKQ LL  L +LK  G+K LKE+KNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
Sbjct: 1290 LENCEAVEELLNNLESLEEQCNIRKAKIEEKMNETESDIKKQVALENNLKILADLMNETETEMKISVTKQTGASAVEENLEKLKGLKSKLESEKNILENIEEQKDDFNVPKHCLMACKSSKKKYLDLKDEIHQLEENLNLMKNNWSEFDSAKSKIEESLETIGNDIENMHVTHNGIHGGDCDDKVSLLNEKKNELDDLIRQEEETNDLFSKAKKLGSNAPMIEIQNLKERILKQKENLKKEIKQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1637          

HSP 3 Score: 225.328 bits (573), Expect = 1.162e-65
Identity = 148/349 (42.41%), Postives = 230/349 (65.90%), Query Frame = 3
Query:    3 SLENCEAVXXXXXXXXXXXXQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEI-TSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            SLE+  A+E+LL+KLESLEE C E K++IE++I E + +IK Q+A EEKL++ + +MNE EIE   S PKE+SE AI ESL +L+ +K++H PGKN L+ ++K + E   P++    C   E+KY ++E+ IK+L   LE K + W ++N +K+D++K+  T   +I   H+ R GIHG D +DK  +  D KK L ++ +K+  ++ LIE++  LG +K + +   +K+ +L+  DDL+ EI  NE DL NH++++  L  F DW+   E +  +I+  P+ K GL+EKQN L ++K LK  G +M+K IK+LQ VV+NETA + K  +N ++  +IE F  VF +LD
Sbjct: 2138 SLEHSAALEDLLNKLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLD 2486          

HSP 4 Score: 194.897 bits (494), Expect = 4.539e-55
Identity = 116/223 (52.02%), Postives = 155/223 (69.51%), Query Frame = 3
Query:  378 NLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            NL+    +L+N L    ++W  +   K  + K  + + DD+  SH+ RKG+HG++  DK  +  +NK+RL++L  +E  + +L + A  LG EKP+NEV  LK   L+ K +LE EI+ NEKDL+NH+Q+ ND+   HDW+ + E L ++I   P+TK GLIEKQ LL  L +LK  G+K LKE+KNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
Sbjct:  994 NLQKTKVNLSNNL----NDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADLLEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1212          

HSP 5 Score: 95.5153 bits (236), Expect = 3.346e-21
Identity = 92/332 (27.71%), Postives = 177/332 (53.31%), Query Frame = 3
Query:   63 QCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSL-PKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGS----EKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLF---HDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVF 1034
            +C   K++I     +N  ++K    F++K++EF   M+  E EI    P   +E AI+++++KL+  +S H   K+ L ++L+   EL    + SE  ++ E+KY ++E+ I  L + LE +K++WS +N  K+D+EK L  +   +    ++  GIHG    +KE +   ++K LQ+  ++E  I   ++ +  L S    + P      L K + +  + L N I+ NE+D+  H  Y   +D F   ++ I+  + + ++I+  P+TK GL  K +LL  LK+L    + +L  ++NL+  V++ ++ +   N+  + +  I+ F + F
Sbjct: 2584 ECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIII--KRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSF 2913          
BLAST of SMED30002304 vs. Planmine SMEST
Match: SMESG000077685.1 (SMESG000077685.1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 3
Query:    3 SLENCEAVXXXXXXXXXXXXQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            SLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
Sbjct: 1713 SLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 2060          

HSP 2 Score: 271.552 bits (693), Expect = 1.038e-81
Identity = 179/348 (51.44%), Postives = 237/348 (68.10%), Query Frame = 3
Query:    6 LENCEAVXXXXXXXXXXXXQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEI-TSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            LENCEAVEELL+ LESLEEQCN  K++IE+K+ E   +IK Q A E  L   A+LMNE E E+  S+ K+    A+EE+L+KL+ +KSK    KN LE I + + +  +P+     C+  ++KY +L++ I  L   L   K+NWS ++  KS IE+SLET+ +DI   H    GIHG D  DK ++ ++ K  L DL  +E+  N+L   AK LGS  P+ E+  LK+  L+ K++L+ EIK NEKDL+NH+Q+ ND+   HDW+ + E L ++I   P+TK GLIEKQ LL  L +LK  G+K LKE+KNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
Sbjct: 1289 LENCEAVEELLNNLESLEEQCNIRKAKIEEKMNETESDIKKQVALENNLKILADLMNETETEMKISVTKQTGASAVEENLEKLKGLKSKLESEKNILENIEEQKDDFNVPKHCLMACKSSKKKYLDLKDEIHQLEENLNLMKNNWSEFDSAKSKIEESLETIGNDIENMHVTHNGIHGGDCDDKVSLLNEKKNELDDLIRQEEETNDLFSKAKKLGSNAPMIEIQNLKERILKQKENLKKEIKQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1636          

HSP 3 Score: 225.328 bits (573), Expect = 1.129e-65
Identity = 148/349 (42.41%), Postives = 230/349 (65.90%), Query Frame = 3
Query:    3 SLENCEAVXXXXXXXXXXXXQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEI-TSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            SLE+  A+E+LL+KLESLEE C E K++IE++I E + +IK Q+A EEKL++ + +MNE EIE   S PKE+SE AI ESL +L+ +K++H PGKN L+ ++K + E   P++    C   E+KY ++E+ IK+L   LE K + W ++N +K+D++K+  T   +I   H+ R GIHG D +DK  +  D KK L ++ +K+  ++ LIE++  LG +K + +   +K+ +L+  DDL+ EI  NE DL NH++++  L  F DW+   E +  +I+  P+ K GL+EKQN L ++K LK  G +M+K IK+LQ VV+NETA + K  +N ++  +IE F  VF +LD
Sbjct: 2137 SLEHSAALEDLLNKLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLD 2485          

HSP 4 Score: 194.897 bits (494), Expect = 4.453e-55
Identity = 116/223 (52.02%), Postives = 155/223 (69.51%), Query Frame = 3
Query:  378 NLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1046
            NL+    +L+N L    ++W  +   K  + K  + + DD+  SH+ RKG+HG++  DK  +  +NK+RL++L  +E  + +L + A  LG EKP+NEV  LK   L+ K +LE EI+ NEKDL+NH+Q+ ND+   HDW+ + E L ++I   P+TK GLIEKQ LL  L +LK  G+K LKE+KNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
Sbjct:  993 NLQKTKVNLSNNL----NDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADLLEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD 1211          

HSP 5 Score: 95.5153 bits (236), Expect = 3.346e-21
Identity = 92/332 (27.71%), Postives = 177/332 (53.31%), Query Frame = 3
Query:   63 QCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSL-PKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGS----EKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLF---HDWILEAESLADKISGTPSTKAGLIEKQXXXXXXXXXXPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVF 1034
            +C   K++I     +N  ++K    F++K++EF   M+  E EI    P   +E AI+++++KL+  +S H   K+ L ++L+   EL    + SE  ++ E+KY ++E+ I  L + LE +K++WS +N  K+D+EK L  +   +    ++  GIHG    +KE +   ++K LQ+  ++E  I   ++ +  L S    + P      L K + +  + L N I+ NE+D+  H  Y   +D F   ++ I+  + + ++I+  P+TK GL  K +LL  LK+L    + +L  ++NL+  V++ ++ +   N+  + +  I+ F + F
Sbjct: 2583 ECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIII--KRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSF 2912          
The following BLAST results are available for this feature:
BLAST of SMED30002304 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002304 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077685.11.038e-81100.00SMESG000077685.1[more]
SMESG000077685.11.038e-81100.00SMESG000077685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002304 ID=SMED30002304|Name=SMED30002304|organism=Schmidtea mediterranea sexual|type=transcript|length=1047bp
AATCTCTGGAAAACTGTGAAGCAGTAGAAGAACTTTTAGACAAATTGGAA
TCATTAGAAGAACAATGCAATGAAAATAAAAGTGAAATAGAAGACAAAAT
AGTGGAAAATAATATCAATATAAAAATGCAGGCTGCTTTCGAGGAAAAGC
TTGATGAATTTGCCAATTTGATGAATGAAGCTGAAATTGAAATTACATCT
CTTCCTAAAGAGAACAGTGAAATTGCCATTGAAGAAAGTTTACAGAAATT
GGAAAATATTAAATCAAAGCATCTGCCGGGAAAGAATACTTTAGAAGAAA
TTTTAAAATCTCAAACTGAACTTAGAATTCCACAAGAATACTCAGAAACC
TGTGAAAAATACGAAGAAAAATACTGTAATCTCGAAAATGGAATCAAAGA
TTTAACGAATGCACTAGAACAGAAAAAATCTAATTGGTCTCGATATAATT
TAATTAAGTCTGATATTGAGAAATCTTTGGAAACTCTCAAAGACGATATC
AACGTTTCTCATGAAATGAGAAAAGGTATTCACGGAAAAGATTCTAAAGA
TAAAGAAACAATATTTCATGATAATAAAAAAAGACTACAAGACTTAAATG
ACAAGGAAAAAGTAATAAATGAACTTATTGAAATGGCCAAATTACTCGGA
TCTGAAAAGCCAGTAAATGAAGTGTTACAATTAAAAAAAACATTTTTGGA
GGACAAAGATGATTTGGAAAATGAAATAAAAATAAATGAAAAAGATTTAA
AGAACCATCGACAATACGAAAATGATCTGGATTTATTTCATGATTGGATA
TTAGAAGCGGAAAGTTTGGCAGACAAAATATCAGGAACTCCAAGTACCAA
AGCCGGTCTAATTGAAAAACAAAACTTATTGAATAAATTAAAAAATTTAA
AACCAGTGGGAGAAAAAATGTTGAAAGAAATAAAAAATTTACAAAAAGTC
GTATTGAATGAAACAGCTCCCGATGAGAAAGAAAATATTAATATTCAACT
CAATGCAGAAATTGAAAAATTCAATGAAGTTTTCGTAAATCTAGATA
back to top

protein sequence of SMED30002304-orf-1

>SMED30002304-orf-1 ID=SMED30002304-orf-1|Name=SMED30002304-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
SLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKL
DEFANLMNEAEIEITSLPKENSEIAIEESLQKLENIKSKHLPGKNTLEEI
LKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNL
IKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLND
KEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLK
NHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLK
PVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 221..255
NoneNo IPR availableCOILSCoilCoilcoord: 69..89
NoneNo IPR availableCOILSCoilCoilcoord: 43..63
NoneNo IPR availableCOILSCoilCoilcoord: 5..35
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 45..141
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 249..343