Nucleolar protein isoform 2

Overview
NameNucleolar protein isoform 2
Smed IDSMED30002298
Length (bp)1323
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar protein isoform 2 (SMED30002298) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar protein isoform 2 (SMED30002298) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar protein isoform 2 (SMED30002298) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar protein isoform 2 (SMED30002298) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002298

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002298SMESG000009276.1 SmedASXL_016927SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30002298SMESG000009276.1 SmedASXL_016927SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002298SMESG000009276.1 dd_Smed_v4_10255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002298SMESG000009276.1 dd_Smed_v4_10255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002298SMESG000009276.1 dd_Smed_v4_10255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002298SMESG000009276.1 dd_Smed_v4_10255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002298SMESG000009276.1 dd_Smed_v4_10255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002298SMESG000009276.1 dd_Smed_v6_10255_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30002298SMESG000009276.1 dd_Smed_v4_10255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4L (nucleolar protein 4 like [Source:HGNC Symbol;Acc:HGNC:16106])

HSP 1 Score: 70.8626 bits (172), Expect = 1.282e-12
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDE-PIALDKQHSRD 309          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4L (nucleolar protein 4 like [Source:HGNC Symbol;Acc:HGNC:16106])

HSP 1 Score: 70.4774 bits (171), Expect = 1.463e-12
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDE-PIALDKQHSRD 309          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4L (nucleolar protein 4 like [Source:HGNC Symbol;Acc:HGNC:16106])

HSP 1 Score: 70.4774 bits (171), Expect = 2.292e-12
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  433 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDE-PIALDKQHSRD 553          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4 (nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7870])

HSP 1 Score: 66.6254 bits (161), Expect = 2.399e-11
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  125 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESILASACESESR 217          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4 (nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7870])

HSP 1 Score: 66.2402 bits (160), Expect = 4.514e-11
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  336 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESILASACESESR 428          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Fly
Match: CG46301 (gene:FBgn0283651 transcript:FBtr0445729)

HSP 1 Score: 75.8702 bits (185), Expect = 2.552e-14
Identity = 42/104 (40.38%), Postives = 63/104 (60.58%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNG-KVSMKDTPSHMCS---EKAFAMANEALSRINKELQI 614
            A+N+FVR  VD+ LDR +   +QPK+ I ++ D C+  FP     R R +IR YLK+CRRN K  +G + + + TP+H+ S   E+  A+A E  S   K ++I
Sbjct:  192 AFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSD-RSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMNAKRMRI 294          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Fly
Match: CG46301 (gene:FBgn0283651 transcript:FBtr0445730)

HSP 1 Score: 75.8702 bits (185), Expect = 3.371e-14
Identity = 42/104 (40.38%), Postives = 63/104 (60.58%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNG-KVSMKDTPSHMCS---EKAFAMANEALSRINKELQI 614
            A+N+FVR  VD+ LDR +   +QPK+ I ++ D C+  FP     R R +IR YLK+CRRN K  +G + + + TP+H+ S   E+  A+A E  S   K ++I
Sbjct:  793 AFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSD-RSRKRIRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQILAIACENESMNAKRMRI 895          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Zebrafish
Match: nol4lb (nucleolar protein 4-like b [Source:ZFIN;Acc:ZDB-GENE-070112-1702])

HSP 1 Score: 68.9366 bits (167), Expect = 3.801e-12
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG +  + TP H+ S   E   A A E+ SR
Sbjct:  212 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENILAAACESESR 303          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Zebrafish
Match: nol4la (nucleolar protein 4-like a [Source:ZFIN;Acc:ZDB-GENE-081105-118])

HSP 1 Score: 68.5514 bits (166), Expect = 5.980e-12
Identity = 40/96 (41.67%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR  K   G    + TP H+ S   E   A A E+ +R
Sbjct:  450 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RSRKRIRTYLKSCRRMKK---GGFESRPTPPHLTSAMAENILAAACESETR 541          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: nol4l (nucleolar protein 4-like [Source:NCBI gene;Acc:100494288])

HSP 1 Score: 71.633 bits (174), Expect = 5.555e-13
Identity = 42/96 (43.75%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ SR
Sbjct:  181 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMARPTPPHLTSAMAENILAAACESESR 273          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: nol4l (nucleolar protein 4-like [Source:NCBI gene;Acc:100494288])

HSP 1 Score: 71.633 bits (174), Expect = 6.306e-13
Identity = 42/96 (43.75%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ SR
Sbjct:  177 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMARPTPPHLTSAMAENILAAACESESR 269          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: NOL4 (nucleolar protein 4 [Source:NCBI gene;Acc:100494971])

HSP 1 Score: 66.2402 bits (160), Expect = 5.483e-11
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  383 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAETILASACESESR 475          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4l (nucleolar protein 4-like [Source:MGI Symbol;Acc:MGI:1918765])

HSP 1 Score: 71.2478 bits (173), Expect = 6.186e-13
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQ-EEPIALDKQHSRD 309          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4l (nucleolar protein 4-like [Source:MGI Symbol;Acc:MGI:1918765])

HSP 1 Score: 71.2478 bits (173), Expect = 1.029e-12
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  433 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQ-EEPIALDKQHSRD 553          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4 (nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:2441684])

HSP 1 Score: 67.0106 bits (162), Expect = 1.576e-11
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  192 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESILASACESESR 284          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4 (nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:2441684])

HSP 1 Score: 66.6254 bits (161), Expect = 2.464e-11
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  337 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESILASACESESR 429          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4 (nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:2441684])

HSP 1 Score: 66.6254 bits (161), Expect = 3.220e-11
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  410 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESILASACESESR 502          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|Q6DIB4|NOL4L_MOUSE (Nucleolar protein 4-like OS=Mus musculus OX=10090 GN=Nol4l PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.952e-12
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  248 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQ-EEPIALDKQHSRD 368          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|Q96MY1|NOL4L_HUMAN (Nucleolar protein 4-like OS=Homo sapiens OX=9606 GN=NOL4L PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 6.156e-12
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDE-PIALDKQHSRD 309          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|Q5RFT9|NOL4L_PONAB (Nucleolar protein 4-like OS=Pongo abelii OX=9601 GN=NOL4L PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.558e-11
Identity = 45/125 (36.00%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSD 680
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR Y K+CRR   K NG    + TP H+ S   E   A A E+ +R   +   L++ +  + E P ++ + +S D
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYHKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDE-PIALDKQHSRD 309          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|O94818|NOL4_HUMAN (Nucleolar protein 4 OS=Homo sapiens OX=9606 GN=NOL4 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 2.255e-10
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ D C   FP   + R R +IR YLK+CRR   K +G    +  PSH+ S   E   A A E+ SR
Sbjct:  410 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQE-RARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESILASACESESR 502          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A095AK27 (Uncharacterized protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_02646 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 8.458e-30
Identity = 58/105 (55.24%), Postives = 81/105 (77.14%), Query Frame = 3
Query:  306 TDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILK 620
            T  AYN FVRRVVDDTLDRTVTFCEQP+  I++LE+IC+ A+P L+  RHR +IR YLKACRRNSKK+ G+++MK+ P++  S +A  + ++AL+ +  +L  L+
Sbjct:   83 TTAAYNNFVRRVVDDTLDRTVTFCEQPRHAITALENICTRAWPQLEVKRHRNRIRAYLKACRRNSKKNKGQINMKEPPANGLSIEARQLVSKALTLVAGDLDYLR 187          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A183QT08 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.079e-29
Identity = 64/139 (46.04%), Postives = 95/139 (68.35%), Query Frame = 3
Query:  213 GIENGENFETNIIPCNINGAKVTGSTKKPTDTDM---AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILK 620
              +N  N+ T     N+N  KV    +  + +++   AYN FVRRVVDDTLDRTVTFCEQP+  I++LE+IC+ A+P L+  RHR +IR YLKACRRNSKK+ G+++MK+ P++  S +A  + ++AL+ +  +L  L+
Sbjct:  186 NYDNNGNWNTFNDTMNVNHPKVEVDNELSSASELTTAAYNSFVRRVVDDTLDRTVTFCEQPRHAITALENICTRAWPQLEVKRHRTRIRAYLKACRRNSKKNKGQINMKEPPANGLSIEARQLVSKALTLVAGDLDYLR 324          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A183P0L4 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS7900 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.515e-29
Identity = 58/105 (55.24%), Postives = 81/105 (77.14%), Query Frame = 3
Query:  306 TDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILK 620
            T  AYN FVRRVVDDTLDRTVTFCEQP+  I++LE+IC+ A+P L+  RHR +IR YLKACRRNSKK+ G+++MK+ P++  S +A  + ++AL+ +  +L  L+
Sbjct:  159 TTAAYNNFVRRVVDDTLDRTVTFCEQPRHAITALENICTRAWPQLEVKRHRNRIRAYLKACRRNSKKNKGQINMKEPPANGLSIEARQLVSKALTLVAGDLDYLR 263          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: G4VDJ7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_133680 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.539e-29
Identity = 58/105 (55.24%), Postives = 81/105 (77.14%), Query Frame = 3
Query:  306 TDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILK 620
            T  AYN FVRRVVDDTLDRTVTFCEQP+  I++LE+IC+ A+P L+  RHR +IR YLKACRRNSKK+ G+++MK+ P++  S +A  + ++AL+ +  +L  L+
Sbjct:  222 TTAAYNNFVRRVVDDTLDRTVTFCEQPRHAITALENICTRAWPQLEVKRHRTRIRAYLKACRRNSKKNKGQINMKEPPANGLSIEARQLVSKALTLVAGDLDYLR 326          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A183BDP8 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS17333 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 6.500e-29
Identity = 56/105 (53.33%), Postives = 78/105 (74.29%), Query Frame = 3
Query:  306 TDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILK 620
            T  AYN FVRR+VDDTLDRT+TFCEQP+  I++LE IC+ A+P ++  RHR +IR YLKACRRNSKK+ G+++MK+ P +  S +A  + + ALS +  ++  LK
Sbjct:   71 TTAAYNNFVRRIVDDTLDRTITFCEQPRHAITALESICAKAWPRMEMKRHRNRIRAYLKACRRNSKKNKGQINMKEAPMNGLSIEARQLVSNALSLVADDVDQLK 175          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Cavefish
Match: nol4la (nucleolar protein 4-like [Source:NCBI gene;Acc:103039117])

HSP 1 Score: 68.9366 bits (167), Expect = 4.091e-12
Identity = 40/96 (41.67%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR  K   G    + TP H+ S   E   A A E+ +R
Sbjct:  468 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRRMKK---GGFETRPTPPHLTSAMAENILAAACESETR 559          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Cavefish
Match: nol4lb (nucleolar protein 4 like [Source:NCBI gene;Acc:103032141])

HSP 1 Score: 67.3958 bits (163), Expect = 1.183e-11
Identity = 41/96 (42.71%), Postives = 57/96 (59.38%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG +  + TP H+ S   E   A A E+ +R
Sbjct:  463 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENILAAACESETR 554          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Match: nol4lb (nucleolar protein 4-like [Source:NCBI gene;Acc:101169180])

HSP 1 Score: 70.0922 bits (170), Expect = 1.389e-12
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG +  + TP H+ S   E   A A E+ SR
Sbjct:  246 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENILAAACESESR 337          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Match: nol4lb (nucleolar protein 4-like [Source:NCBI gene;Acc:101169180])

HSP 1 Score: 70.0922 bits (170), Expect = 1.389e-12
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR   K NG +  + TP H+ S   E   A A E+ SR
Sbjct:  246 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENILAAACESESR 337          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Match: nol4la (nucleolar protein 4-like [Source:NCBI gene;Acc:101174833])

HSP 1 Score: 69.707 bits (169), Expect = 2.634e-12
Identity = 40/96 (41.67%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  315 AYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS---EKAFAMANEALSR 593
            A+N+FVR  VD+ LDR V   +QPK+ I ++ + CS  FP   + R R +IR YLK+CRR  K   G   ++ TP H+ S   E   A A E+ +R
Sbjct:  446 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RSRKRIRTYLKSCRRMKK---GGFEIRPTPPHLTSAMAENILAAACESETR 537          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000009276.1 (SMESG000009276.1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 346/347 (99.71%), Postives = 347/347 (100.00%), Query Frame = 3
Query:  153 PEDLESHNFTIKKPKLESEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSDDGRPEIDLKSLECIVXXXXXXXXXXXXYLKYPITSSSDNDPFSAALSGLVXXXXXXXXXXXXXXXXXXXXXXRGCTPPPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHKXXXXXXXDDM 1193
            PEDLESHNFTIKKPKLESEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSENPDS+SQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFNYLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTPPPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHKSSYYYSSDDM
Sbjct:   77 PEDLESHNFTIKKPKLESEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSENPDSVSQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFNYLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTPPPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHKSSYYYSSDDM 423          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000009276.1 (SMESG000009276.1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 346/347 (99.71%), Postives = 347/347 (100.00%), Query Frame = 3
Query:  153 PEDLESHNFTIKKPKLESEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSENPDSISQGNSSDDGRPEIDLKSLECIVXXXXXXXXXXXXYLKYPITSSSDNDPFSAALSGLVXXXXXXXXXXXXXXXXXXXXXXRGCTPPPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHKXXXXXXXDDM 1193
            PEDLESHNFTIKKPKLESEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSENPDS+SQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFNYLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTPPPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHKSSYYYSSDDM
Sbjct:   68 PEDLESHNFTIKKPKLESEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSENPDSVSQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFNYLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTPPPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHKSSYYYSSDDM 414          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000007822.1 (SMESG000007822.1)

HSP 1 Score: 288.886 bits (738), Expect = 8.223e-91
Identity = 171/334 (51.20%), Postives = 232/334 (69.46%), Query Frame = 3
Query:  186 KKPKLE---SEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSE-NPDSISQGNSSDDGRPEIDLKSLECIVXXXXXXXXXXXXYLKYPITSSSDNDPFSAALSGLVXXXXXXXXXXXXXXXXXXXXXXRGCTPPPAHC----NSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHK 1163
            K+ KLE   SE   EN E  + N  P   +  +     KKPTD DMAYNIFVR+++D TLDRT+TFCEQPK +ISSLE+IC+ AF + DK RHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS+KA+ +ANEA  ++ KE++ L LAK G+S+ N   +S+    D  + + D + L+ I ++  S ++ +  Y     T+ +DN+ FS+ L+  +P  YG++P PP+L  ++ G+ G G +PPPAH     NSI    F ++   +   AT+ +LEKMLHC SIDPDFG +LL N+ A+QE+I+CMR+ AR+LL+RSL+MES+LI+E  K
Sbjct:  323 KRIKLEDGDSETNTENEEILDENSSPTTGDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEID--KSKTDAQYLDYI-ESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEKMLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKESTK 653          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000051494.1 (SMESG000051494.1)

HSP 1 Score: 100.523 bits (249), Expect = 9.268e-23
Identity = 45/117 (38.46%), Postives = 74/117 (63.25%), Query Frame = 3
Query:  309 DMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS-------EKAFAMANEALSRINKELQILKLAKLGR 638
            ++AYN+ +RR++D+ LDR V F  QPK++++ +  I    FP  ++ +HR K+R YLKACRRNSKK+NG++ MK+T +++ S        + +    E +  I KE +  KL + G+
Sbjct:  181 EIAYNLLLRRIIDEALDRNVIFSHQPKELLNLINTILVRQFPEYEESKHRSKVRSYLKACRRNSKKNNGRILMKNTAAYLSSGPGNRLMHQIYNNEKETIDIIKKESERFKLTQNGK 297          
The following BLAST results are available for this feature:
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOL4L1.282e-1236.80nucleolar protein 4 like [Source:HGNC Symbol;Acc:H... [more]
NOL4L1.463e-1236.80nucleolar protein 4 like [Source:HGNC Symbol;Acc:H... [more]
NOL4L2.292e-1236.80nucleolar protein 4 like [Source:HGNC Symbol;Acc:H... [more]
NOL42.399e-1142.71nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7... [more]
NOL44.514e-1142.71nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG463012.552e-1440.38gene:FBgn0283651 transcript:FBtr0445729[more]
CG463013.371e-1440.38gene:FBgn0283651 transcript:FBtr0445730[more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol4lb3.801e-1243.75nucleolar protein 4-like b [Source:ZFIN;Acc:ZDB-GE... [more]
nol4la5.980e-1241.67nucleolar protein 4-like a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nol4l5.555e-1343.75nucleolar protein 4-like [Source:NCBI gene;Acc:100... [more]
nol4l6.306e-1343.75nucleolar protein 4-like [Source:NCBI gene;Acc:100... [more]
NOL45.483e-1142.71nucleolar protein 4 [Source:NCBI gene;Acc:10049497... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nol4l6.186e-1336.80nucleolar protein 4-like [Source:MGI Symbol;Acc:MG... [more]
Nol4l1.029e-1236.80nucleolar protein 4-like [Source:MGI Symbol;Acc:MG... [more]
Nol41.576e-1142.71nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:244... [more]
Nol42.464e-1142.71nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:244... [more]
Nol43.220e-1142.71nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6DIB4|NOL4L_MOUSE4.952e-1236.80Nucleolar protein 4-like OS=Mus musculus OX=10090 ... [more]
sp|Q96MY1|NOL4L_HUMAN6.156e-1236.80Nucleolar protein 4-like OS=Homo sapiens OX=9606 G... [more]
sp|Q5RFT9|NOL4L_PONAB4.558e-1136.00Nucleolar protein 4-like OS=Pongo abelii OX=9601 G... [more]
sp|O94818|NOL4_HUMAN2.255e-1042.71Nucleolar protein 4 OS=Homo sapiens OX=9606 GN=NOL... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095AK278.458e-3055.24Uncharacterized protein (Fragment) OS=Schistosoma ... [more]
A0A183QT081.079e-2946.04Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A183P0L41.515e-2955.24Uncharacterized protein OS=Schistosoma mattheei OX... [more]
G4VDJ74.539e-2955.24Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183BDP86.500e-2953.33Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol4la4.091e-1241.67nucleolar protein 4-like [Source:NCBI gene;Acc:103... [more]
nol4lb1.183e-1142.71nucleolar protein 4 like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nol4lb1.389e-1243.75nucleolar protein 4-like [Source:NCBI gene;Acc:101... [more]
nol4lb1.389e-1243.75nucleolar protein 4-like [Source:NCBI gene;Acc:101... [more]
nol4la2.634e-1241.67nucleolar protein 4-like [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000009276.10.000e+099.71SMESG000009276.1[more]
SMESG000009276.10.000e+099.71SMESG000009276.1[more]
SMESG000007822.18.223e-9151.20SMESG000007822.1[more]
SMESG000051494.19.268e-2338.46SMESG000051494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002298 ID=SMED30002298|Name=Nucleolar protein isoform 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1323bp
ACGCCACTAGTCTAAGTTTATAAATAAATCCATGTCCATTTTGTTTGTAA
CTTGATGATGACAGTAAATTTGTCGAAATATCGTAAAATGTGTATTTGAA
TAGCGCTTTTTGTGATAACAATAATAATAATAATAATATTCATAATCATA
ACCCTGAAGATTTGGAATCTCACAATTTTACGATCAAGAAACCGAAATTG
GAATCAGAATTCGGAATTGAGAATGGAGAAAACTTTGAGACAAATATTAT
TCCCTGTAATATTAATGGAGCCAAAGTTACTGGATCAACTAAAAAACCAA
CAGATACCGATATGGCTTATAATATATTTGTACGAAGAGTTGTAGATGAT
ACCCTTGATAGAACTGTTACATTTTGTGAACAGCCGAAAGACATAATCAG
TAGTTTAGAAGATATTTGCTCAACAGCTTTTCCAACTTTAGACAAAGGGA
GACATCGAATCAAAATTCGAGGTTATCTCAAGGCTTGTAGAAGAAATTCT
AAAAAACATAATGGAAAGGTATCAATGAAAGACACCCCTTCCCACATGTG
TTCAGAGAAGGCATTTGCTATGGCTAATGAAGCTCTAAGTCGAATAAACA
AAGAATTGCAAATTCTCAAGCTGGCAAAATTAGGAAGATCAGAAAATCCG
GATAGTATTTCCCAAGGAAATTCGTCTGATGATGGCCGACCGGAAATAGA
CCTAAAAAGTCTTGAGTGTATTGTCGACAATGACTCTTCACCAAGCAATT
CAGACTTCAATTATTTAAAATATCCCATCACAAGCTCATCAGACAATGAT
CCGTTTTCAGCTGCTCTATCGGGTCTCGTACCTCCACCGTATGGAATCTT
GCCACCACCTCCAATTTTGCCAAGCTCAATTCCTGGTTTACCTGGTAGAG
GTTGCACTCCACCTCCTGCTCACTGTAATTCTATTCATTTCGGTCCATTT
TCACTACTTGGCTCAACGGCACAGCAACCGGCAACGAATATGCTATTAGA
AAAAATGCTTCACTGTACTTCCATAGATCCAGATTTCGGATATGAATTAT
TGAGAAATAAATTGGCAGCCCAAGAATCTATCAGTTGTATGCGAGTAATG
GCCAGATTTCTCCTGAACAGATCTTTAATTATGGAATCTTATTTGATCCG
GGAAATGCACAAATCATCATATTACTATTCATCTGATGATATGTAATTTG
TGAAAAATAATGTCTCCGGTCCTTGCGTCAACATCCTGTCTCATAATCTC
TATTTTGTGATTTGTACTACTGCAATTCGATATTAGTATCAGCTGTTATT
CAGTTTTTTATTGGAATATATTA
back to top

protein sequence of SMED30002298-orf-1

>SMED30002298-orf-1 ID=SMED30002298-orf-1|Name=SMED30002298-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=295bp
MAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRI
KIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQ
ILKLAKLGRSENPDSISQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFN
YLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTP
PPAHCNSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNK
LAAQESISCMRVMARFLLNRSLIMESYLIREMHKSSYYYSSDDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039788NOL4/NOL4L
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039788Nucleolar protein 4 familyPANTHERPTHR12449FAMILY NOT NAMEDcoord: 2..103
NoneNo IPR availablePANTHERPTHR12449:SF22coord: 2..103