Glutamine-dependent NAD( ) synthetase

Overview
NameGlutamine-dependent NAD( ) synthetase
Smed IDSMED30002295
Length (bp)3078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamine-dependent NAD( ) synthetase (SMED30002295) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamine-dependent NAD( ) synthetase (SMED30002295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamine-dependent NAD( ) synthetase (SMED30002295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamine-dependent NAD( ) synthetase (SMED30002295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002295SMESG000004423.1 dd_Smed_v4_7717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30002295SMESG000004423.1 SMED30002295smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30002295SMESG000004423.1 dd_Smed_v4_7717_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Human
Match: NADSYN1 (NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:29832])

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 382/701 (54.49%), Postives = 499/701 (71.18%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKT 2303
            M    T AT  LNQWALDF+GN + I++SI++AK R A+YR GPELE+ GYGC DH+YESDTLLHS++V+  ++E+    DIICD+GMP+ HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y LP  IQ++T Q+ VPFGDA+L   DTCI  E CEELW  ++P+ID  L+G EII N +GS+ +LRK + R++L+     K GG+Y+  N +GCDG+R+YYDG A+IA+NG +  Q  QFSL DVEVL   +DL++VR+YR   S+ ++         R+ +DF+L+    + +    IS PI      PE+EISL PA WLWD LRRS+  GF LPLSGG+DS++ AC++YSMC ++ ++++ GN + LAD+R +V  ++Y P + ++LC +IL TCYM+S+NSS+ET TRA+ LA  I S+HI + ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   GGLLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ + I  F+L +L  IL AP TAELEPL DG+V Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +W+    TP ++A+KVK FF  YS NRHKMT +TP+YH E+Y+ +DNRFDLRP+LYN  W WQF CI+  V  LE+ 
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYESDTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPRVKVDFALSC---HEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQAGFLLPLSGGVDSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSVYGKLRKVAKMGPYSMFCKLLGMWRHI-CTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERA 697          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Human
Match: NADSYN1 (NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:29832])

HSP 1 Score: 399.823 bits (1026), Expect = 1.898e-130
Identity = 188/327 (57.49%), Postives = 239/327 (73.09%), Query Frame = 3
Query: 1323 MCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKT 2303
            MC ++ ++++ GN + LAD+R +V  ++Y P + ++LC +IL TCYM+S+NSS+ET TRA+ LA  I S+HI + ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   GGLLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ + I  F+L +L  IL AP TAELEPL DG+V Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +W+    TP ++A+KVK FF  YS NRHKMT +TP+YH E+Y+ +DNRFDLRP+LYN  W WQF CI+  V  LE+ 
Sbjct:    1 MCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSVYGKLRKVAKMGPYSMFCKLLGMWRHI-CTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERA 326          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Human
Match: NADSYN1 (NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:29832])

HSP 1 Score: 320.857 bits (821), Expect = 3.690e-101
Identity = 146/266 (54.89%), Postives = 192/266 (72.18%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDV 998
            M    T AT  LNQWALDF+GN + I++SI++AK R A+YR GPELE+ GYGC DH+YESDTLLHS++V+  ++E+    DIICD+GMP+ HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y LP  IQ++T Q+ VPFGDA+L   DTCI  E CEELW  ++P+ID  L+G EII N +GS+ +LRK + R++L+     K GG+Y+  N +GCDG+R+YYDG A+IA+NG +  Q  QFSL DV
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYESDTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSVFAQGSQFSLDDV 266          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Human
Match: NADSYN1 (NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:29832])

HSP 1 Score: 290.426 bits (742), Expect = 3.574e-90
Identity = 131/257 (50.97%), Postives = 177/257 (68.87%), Query Frame = 3
Query:  306 RNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNI 1076
            R A+YR GPELE+ GYGC DH+YESDTLLHS++V+  ++E+    DIICD+GMP+ HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y LP  IQ++T Q+ VPFGDA+L   DTCI  E CEELW  ++P+ID  L+G EII N +GS+ +LRK + R++L+     K GG+Y+  N +GCDG+R+YYDG A+IA+NG +  Q  QFSL DV+     + L ++ T   C++    N 
Sbjct:    3 RGARYRLGPELEICGYGCWDHYYESDTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSVFAQGSQFSLDDVQTRKNGLLLPQMETNPKCTNTTKSNF 259          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Human
Match: NADSYN1 (NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:29832])

HSP 1 Score: 166.777 bits (421), Expect = 4.141e-47
Identity = 78/149 (52.35%), Postives = 107/149 (71.81%), Query Frame = 3
Query: 1323 MCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDE 1769
            MC ++ ++++ GN + LAD+R +V  ++Y P + ++LC +IL TCYM+S+NSS+ET TRA+ LA  I S+HI + ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   GGLLVL S N+DE
Sbjct:    1 MCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDE 149          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Celegans
Match: qns-1 (Glutamine-dependent NAD(+) synthetase [Source:UniProtKB/TrEMBL;Acc:F3Y5P7])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 306/701 (43.65%), Postives = 438/701 (62.48%), Query Frame = 3
Query:  213 CTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILE-NEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTC-IAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLN-LIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDF--SLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            C  AT  +N WALDF GN + I+++ + A    A+ R GPELE+ GYGC DHF+E DT  HSWE++  ++E ++   +++   G+P   RG +YNC   L NGK++ IR K  LA+  V+RESRWF  W + F   +Y +P        Q+ VPFGD +L  +D   I  E CEELW+  + N+     G +I+ NG+GS+HIL K + R+N LI  +  K+GGVY+Y N RGCDG+R+YYDG + +A NG+++ Q  QF ++D  V+   +DL + + +R+  S+   N    D +  +PI F   +T    YN         +    + P  E+   P  +LW  LRRS + G+F+PLSGG DSS+VA +V  MC ++  +IK        D          +  +  ELC+++L TCYM+SE+SS ET+  A+ LA ++NS+H  + ID IV++ + V    +G   ++++    N E +ALQN+QARIRMVL+YL +QL L S  R GGLLVL + N+DE L GYLTKYDCSSAD+NPIGS+ K DL+ F+  +  ++ +A+L  ++++ PTAEL+PL DGKV Q DE ++G+TY ELS  G+LRK    GP+GMF+KLL++W DK  +  EI EKV  FF  Y  NRHK TV TP+ H E+Y+ DD+R D RP+LY  D+S+QF  I + V  L+K
Sbjct:    8 CRVATCTVNNWALDFKGNYERIVKTCEEAAALGARIRLGPELEIPGYGCADHFFELDTERHSWEMLSKLVEKSKKWPNLLVVTGLPTRFRGLLYNCAAALRNGKLLFIRAKMGLADDNVYRESRWFVKWTETF--KHYQMPLNSDIHFDQETVPFGDGILESSDNVRIGFEICEELWSARSTNVRLAEQGVDIMCNGSGSHHILGKSNYRINQLILGSSAKVGGVYLYANQRGCDGDRVYYDGASSVAQNGDLLAQIHQFDIEDTSVVSAVVDLSDNQCFRHMKSSDRGN--ASDQVTVVPIRFDGKMTGGIKYNEKSTAPIHNVEDLQLSPIAELCHGPPAYLWTYLRRSGMAGYFIPLSGGQDSSAVAAMVRLMCEKVCGAIKRRRETDGGDDPAYYLGGKKVGEDPAELCNQVLFTCYMASEHSSDETRQCAEGLAKNVNSSHCGIFIDTIVTSILKVFNVAYGFMPSFQSP--DNRETMALQNIQARIRMVLSYLFAQLALVSHKRPGGLLVLGTANVDESLVGYLTKYDCSSADINPIGSVSKRDLRQFLEIAYEKYGMAALRCVIDSTPTAELKPLVDGKVAQTDEAEIGLTYDELSVIGRLRKPGGMGPYGMFLKLLQLWGDK-YSIDEIEEKVNKFFWRYRVNRHKATVSTPAIHAENYSPDDHRNDHRPFLYP-DFSYQFERIREKVVELKK 700          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Celegans
Match: qns-1 (Glutamine-dependent NAD(+) synthetase [Source:UniProtKB/TrEMBL;Acc:F3Y5P7])

HSP 1 Score: 501.516 bits (1290), Expect = 8.678e-166
Identity = 272/634 (42.90%), Postives = 393/634 (61.99%), Query Frame = 3
Query:  411 KTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTC-IAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLN-LIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDF--SLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            K + +++   +++   G+P   RG +YNC   L NGK++ IR K  LA+  V+RESRWF  W + F   +Y +P        Q+ VPFGD +L  +D   I  E CEELW+  + N+     G +I+ NG+GS+HIL K + R+N LI  +  K+GGVY+Y N RGCDG+R+YYDG + +A NG+++ Q  QF ++D  V+   +DL + + +R+  S+   N    D +  +PI F   +T    YN         +    + P  E+   P  +LW  LRRS + G+F+PLSGG DSS+VA +V  MC ++  +IK        D          +  +  ELC+++L TCYM+SE+SS ET+  A+ LA ++NS+H  + ID IV++ + V    +G   ++++    N E +ALQN+QARIRMVL+YL +QL L S  R GGLLVL + N+DE L GYLTKYDCSSAD+NPIGS+ K DL+ F+  +  ++ +A+L  ++++ PTAEL+PL DGKV Q DE ++G+TY ELS  G+LRK    GP+GMF+KLL++W DK  +  EI EKV  FF  Y  NRHK TV TP+ H E+Y+ DD+R D RP+LY  D+S+QF  I + V  L+K
Sbjct:    4 KLVEKSKKWPNLLVVTGLPTRFRGLLYNCAAALRNGKLLFIRAKMGLADDNVYRESRWFVKWTETF--KHYQMPLNSDIHFDQETVPFGDGILESSDNVRIGFEICEELWSARSTNVRLAEQGVDIMCNGSGSHHILGKSNYRINQLILGSSAKVGGVYLYANQRGCDGDRVYYDGASSVAQNGDLLAQIHQFDIEDTSVVSAVVDLSDNQCFRHMKSSDRGN--ASDQVTVVPIRFDGKMTGGIKYNEKSTAPIHNVEDLQLSPIAELCHGPPAYLWTYLRRSGMAGYFIPLSGGQDSSAVAAMVRLMCEKVCGAIKRRRETDGGDDPAYYLGGKKVGEDPAELCNQVLFTCYMASEHSSDETRQCAEGLAKNVNSSHCGIFIDTIVTSILKVFNVAYGFMPSFQSP--DNRETMALQNIQARIRMVLSYLFAQLALVSHKRPGGLLVLGTANVDESLVGYLTKYDCSSADINPIGSVSKRDLRQFLEIAYEKYGMAALRCVIDSTPTAELKPLVDGKVAQTDEAEIGLTYDELSVIGRLRKPGGMGPYGMFLKLLQLWGDK-YSIDEIEEKVNKFFWRYRVNRHKATVSTPAIHAENYSPDDHRNDHRPFLYP-DFSYQFERIREKVVELKK 629          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Celegans
Match: qns-1 (Glutamine-dependent NAD(+) synthetase [Source:UniProtKB/TrEMBL;Acc:F3Y5P7])

HSP 1 Score: 501.516 bits (1290), Expect = 8.678e-166
Identity = 272/634 (42.90%), Postives = 393/634 (61.99%), Query Frame = 3
Query:  411 KTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTC-IAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLN-LIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDF--SLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            K + +++   +++   G+P   RG +YNC   L NGK++ IR K  LA+  V+RESRWF  W + F   +Y +P        Q+ VPFGD +L  +D   I  E CEELW+  + N+     G +I+ NG+GS+HIL K + R+N LI  +  K+GGVY+Y N RGCDG+R+YYDG + +A NG+++ Q  QF ++D  V+   +DL + + +R+  S+   N    D +  +PI F   +T    YN         +    + P  E+   P  +LW  LRRS + G+F+PLSGG DSS+VA +V  MC ++  +IK        D          +  +  ELC+++L TCYM+SE+SS ET+  A+ LA ++NS+H  + ID IV++ + V    +G   ++++    N E +ALQN+QARIRMVL+YL +QL L S  R GGLLVL + N+DE L GYLTKYDCSSAD+NPIGS+ K DL+ F+  +  ++ +A+L  ++++ PTAEL+PL DGKV Q DE ++G+TY ELS  G+LRK    GP+GMF+KLL++W DK  +  EI EKV  FF  Y  NRHK TV TP+ H E+Y+ DD+R D RP+LY  D+S+QF  I + V  L+K
Sbjct:    4 KLVEKSKKWPNLLVVTGLPTRFRGLLYNCAAALRNGKLLFIRAKMGLADDNVYRESRWFVKWTETF--KHYQMPLNSDIHFDQETVPFGDGILESSDNVRIGFEICEELWSARSTNVRLAEQGVDIMCNGSGSHHILGKSNYRINQLILGSSAKVGGVYLYANQRGCDGDRVYYDGASSVAQNGDLLAQIHQFDIEDTSVVSAVVDLSDNQCFRHMKSSDRGN--ASDQVTVVPIRFDGKMTGGIKYNEKSTAPIHNVEDLQLSPIAELCHGPPAYLWTYLRRSGMAGYFIPLSGGQDSSAVAAMVRLMCEKVCGAIKRRRETDGGDDPAYYLGGKKVGEDPAELCNQVLFTCYMASEHSSDETRQCAEGLAKNVNSSHCGIFIDTIVTSILKVFNVAYGFMPSFQSP--DNRETMALQNIQARIRMVLSYLFAQLALVSHKRPGGLLVLGTANVDESLVGYLTKYDCSSADINPIGSVSKRDLRQFLEIAYEKYGMAALRCVIDSTPTAELKPLVDGKVAQTDEAEIGLTYDELSVIGRLRKPGGMGPYGMFLKLLQLWGDK-YSIDEIEEKVNKFFWRYRVNRHKATVSTPAIHAENYSPDDHRNDHRPFLYP-DFSYQFERIREKVVELKK 629          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Celegans
Match: qns-1 (Glutamine-dependent NAD(+) synthetase [Source:UniProtKB/TrEMBL;Acc:F3Y5P7])

HSP 1 Score: 279.641 bits (714), Expect = 2.296e-86
Identity = 143/280 (51.07%), Postives = 197/280 (70.36%), Query Frame = 3
Query: 1461 MSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            M+SE+SS ET+  A+ LA ++NS+H  + ID IV++ + V    +G   ++++    N E +ALQN+QARIRMVL+YL +QL L S  R GGLLVL + N+DE L GYLTKYDCSSAD+NPIGS+ K DL+ F+  +  ++ +A+L  ++++ PTAEL+PL DGKV Q DE ++G+TY ELS  G+LRK    GP+GMF+KLL++W DK  +  EI EKV  FF  Y  NRHK TV TP+ H E+Y+ DD+R D RP+LY  D+S+QF  I + V  L+K
Sbjct:    1 MASEHSSDETRQCAEGLAKNVNSSHCGIFIDTIVTSILKVFNVAYGFMPSFQS--PDNRETMALQNIQARIRMVLSYLFAQLALVSHKRPGGLLVLGTANVDESLVGYLTKYDCSSADINPIGSVSKRDLRQFLEIAYEKYGMAALRCVIDSTPTAELKPLVDGKVAQTDEAEIGLTYDELSVIGRLRKPGGMGPYGMFLKLLQLWGDK-YSIDEIEEKVNKFFWRYRVNRHKATVSTPAIHAENYSPDDHRNDHRPFLYP-DFSYQFERIREKVVELKK 276          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Fly
Match: Nadsyn (gene:FBgn0030512 transcript:FBtr0073844)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 361/696 (51.87%), Postives = 478/696 (68.68%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQ---FSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKD-GKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCID 2276
            M    T A S LNQWALDF+GN   I++SI  AK   A YR GPELEV GY C DHF E DT LHSWEV+  ++ +  C +++ D+GMP+ HR   YNCR+   N +I+LIRPK  + +   +RESRWFT W +    + Y+LP  I + TGQ+ VPFGDA++   DTC+  E CEELW   + +I+  L G E+I N +GS   LRK     +LI++A  K GG Y+++NLRGCDG+R+Y++G + IA+NGEI+ +S+QF+LQDVEV +  IDL+E+R YR    +            RI  DF ++T    F  +   L         +  PE+EI+L PA WLWD LRRS   GFFLPLSGG+DSSS A IV+SMC +IV++++ G+ + L DIRQ++ D +Y P N   LC+++LVTCYM S NSSKET+ RA  LA  + S HI+++ID  V+A +++     G    ++  GG   +NLALQN+Q+RIRMVLAY+ +QL LW +NR GGLLVL S N+DE LRGYLTKYDCSSAD+NPIG I K DL+ F++Y+ ++F L  L  I++APPTAELEPL++ G++ Q DE DMGMTY+ELS++G+LRK   CGP+ MF  L+  WK   L+P E+AEKVKHFF+CY+ NRHKMTV+TPS H ESY+ DDNRFD RP+LY  +WSWQF  ID
Sbjct:    1 MGRKVTVAVSTLNQWALDFEGNMVRILQSILEAKDMGASYRTGPELEVCGYSCEDHFREPDTFLHSWEVLLEVMMSPMCENMLVDVGMPVMHRNVAYNCRVAFFNRQILLIRPKMAMCDDGNYRESRWFTAWTKALQTEEYVLPRMIAQHTGQQTVPFGDAVIATRDTCLGYEICEELWNVRSKHIEMSLAGVELIVNSSGSYMELRKAHITSDLIRNASFKAGGAYLFSNLRGCDGQRVYFNGCSAIALNGEILARSQQFALQDVEVTLATIDLEEIRAYRVSLRSRCTAAASAAEYPRIHCDFEMSTHSDIFKTSTPPLNWP------MHTPEEEIALGPACWLWDYLRRSGQGGFFLPLSGGVDSSSSATIVHSMCRQIVQAVQQGDAQVLHDIRQLLADSDYTPDNAAGLCNRLLVTCYMGSVNSSKETRRRAAQLANQLGSYHIEISIDSAVNALLSIFNAVTGLTPRFRTQGGCARQNLALQNMQSRIRMVLAYIFAQLTLWVRNRPGGLLVLGSANVDESLRGYLTKYDCSSADINPIGGISKMDLRRFLTYAKDKFNLPVLESIIDAPPTAELEPLQENGELQQTDEADMGMTYAELSQFGRLRKQSFCGPYSMFCHLVATWKSD-LSPKEVAEKVKHFFLCYAINRHKMTVLTPSVHAESYSPDDNRFDHRPFLYRPNWSWQFKAID 689          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Fly
Match: Nadsyn (gene:FBgn0030512 transcript:FBtr0343352)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 361/696 (51.87%), Postives = 478/696 (68.68%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQ---FSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKD-GKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCID 2276
            M    T A S LNQWALDF+GN   I++SI  AK   A YR GPELEV GY C DHF E DT LHSWEV+  ++ +  C +++ D+GMP+ HR   YNCR+   N +I+LIRPK  + +   +RESRWFT W +    + Y+LP  I + TGQ+ VPFGDA++   DTC+  E CEELW   + +I+  L G E+I N +GS   LRK     +LI++A  K GG Y+++NLRGCDG+R+Y++G + IA+NGEI+ +S+QF+LQDVEV +  IDL+E+R YR    +            RI  DF ++T    F  +   L         +  PE+EI+L PA WLWD LRRS   GFFLPLSGG+DSSS A IV+SMC +IV++++ G+ + L DIRQ++ D +Y P N   LC+++LVTCYM S NSSKET+ RA  LA  + S HI+++ID  V+A +++     G    ++  GG   +NLALQN+Q+RIRMVLAY+ +QL LW +NR GGLLVL S N+DE LRGYLTKYDCSSAD+NPIG I K DL+ F++Y+ ++F L  L  I++APPTAELEPL++ G++ Q DE DMGMTY+ELS++G+LRK   CGP+ MF  L+  WK   L+P E+AEKVKHFF+CY+ NRHKMTV+TPS H ESY+ DDNRFD RP+LY  +WSWQF  ID
Sbjct:    1 MGRKVTVAVSTLNQWALDFEGNMVRILQSILEAKDMGASYRTGPELEVCGYSCEDHFREPDTFLHSWEVLLEVMMSPMCENMLVDVGMPVMHRNVAYNCRVAFFNRQILLIRPKMAMCDDGNYRESRWFTAWTKALQTEEYVLPRMIAQHTGQQTVPFGDAVIATRDTCLGYEICEELWNVRSKHIEMSLAGVELIVNSSGSYMELRKAHITSDLIRNASFKAGGAYLFSNLRGCDGQRVYFNGCSAIALNGEILARSQQFALQDVEVTLATIDLEEIRAYRVSLRSRCTAAASAAEYPRIHCDFEMSTHSDIFKTSTPPLNWP------MHTPEEEIALGPACWLWDYLRRSGQGGFFLPLSGGVDSSSSATIVHSMCRQIVQAVQQGDAQVLHDIRQLLADSDYTPDNAAGLCNRLLVTCYMGSVNSSKETRRRAAQLANQLGSYHIEISIDSAVNALLSIFNAVTGLTPRFRTQGGCARQNLALQNMQSRIRMVLAYIFAQLTLWVRNRPGGLLVLGSANVDESLRGYLTKYDCSSADINPIGGISKMDLRRFLTYAKDKFNLPVLESIIDAPPTAELEPLQENGELQQTDEADMGMTYAELSQFGRLRKQSFCGPYSMFCHLVATWKSD-LSPKEVAEKVKHFFLCYAINRHKMTVLTPSVHAESYSPDDNRFDHRPFLYRPNWSWQFKAID 689          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Fly
Match: Nadsyn (gene:FBgn0030512 transcript:FBtr0073845)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 361/696 (51.87%), Postives = 478/696 (68.68%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQ---FSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKD-GKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCID 2276
            M    T A S LNQWALDF+GN   I++SI  AK   A YR GPELEV GY C DHF E DT LHSWEV+  ++ +  C +++ D+GMP+ HR   YNCR+   N +I+LIRPK  + +   +RESRWFT W +    + Y+LP  I + TGQ+ VPFGDA++   DTC+  E CEELW   + +I+  L G E+I N +GS   LRK     +LI++A  K GG Y+++NLRGCDG+R+Y++G + IA+NGEI+ +S+QF+LQDVEV +  IDL+E+R YR    +            RI  DF ++T    F  +   L         +  PE+EI+L PA WLWD LRRS   GFFLPLSGG+DSSS A IV+SMC +IV++++ G+ + L DIRQ++ D +Y P N   LC+++LVTCYM S NSSKET+ RA  LA  + S HI+++ID  V+A +++     G    ++  GG   +NLALQN+Q+RIRMVLAY+ +QL LW +NR GGLLVL S N+DE LRGYLTKYDCSSAD+NPIG I K DL+ F++Y+ ++F L  L  I++APPTAELEPL++ G++ Q DE DMGMTY+ELS++G+LRK   CGP+ MF  L+  WK   L+P E+AEKVKHFF+CY+ NRHKMTV+TPS H ESY+ DDNRFD RP+LY  +WSWQF  ID
Sbjct:    1 MGRKVTVAVSTLNQWALDFEGNMVRILQSILEAKDMGASYRTGPELEVCGYSCEDHFREPDTFLHSWEVLLEVMMSPMCENMLVDVGMPVMHRNVAYNCRVAFFNRQILLIRPKMAMCDDGNYRESRWFTAWTKALQTEEYVLPRMIAQHTGQQTVPFGDAVIATRDTCLGYEICEELWNVRSKHIEMSLAGVELIVNSSGSYMELRKAHITSDLIRNASFKAGGAYLFSNLRGCDGQRVYFNGCSAIALNGEILARSQQFALQDVEVTLATIDLEEIRAYRVSLRSRCTAAASAAEYPRIHCDFEMSTHSDIFKTSTPPLNWP------MHTPEEEIALGPACWLWDYLRRSGQGGFFLPLSGGVDSSSSATIVHSMCRQIVQAVQQGDAQVLHDIRQLLADSDYTPDNAAGLCNRLLVTCYMGSVNSSKETRRRAAQLANQLGSYHIEISIDSAVNALLSIFNAVTGLTPRFRTQGGCARQNLALQNMQSRIRMVLAYIFAQLTLWVRNRPGGLLVLGSANVDESLRGYLTKYDCSSADINPIGGISKMDLRRFLTYAKDKFNLPVLESIIDAPPTAELEPLQENGELQQTDEADMGMTYAELSQFGRLRKQSFCGPYSMFCHLVATWKSD-LSPKEVAEKVKHFFLCYAINRHKMTVLTPSVHAESYSPDDNRFDHRPFLYRPNWSWQFKAID 689          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Zebrafish
Match: nadsyn1 (NAD synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-070615-22])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 303/568 (53.35%), Postives = 399/568 (70.25%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVG 1904
            M    T AT  LNQWALDFDGN   I++SI++AK + AKYR GPELE+ GYGC DHFYESDTLLH ++V+K++LE+    DIICD+GMP+ H    YNCR+I LN KI+ IRPK +LAN    RE RWF+PW +   ++ Y LP  IQ++T Q  VPFGD +L   DTCI  E C ELW   +P++D  L+G EI  N + S H LRK D R+NL++SA  K GG+Y++ N RGCDG+R+YYDG A+IA+NG+IV +  QFSL+DVEV+   +DL++VR+YR    +  +         RI  DFSL+     ++  L   +P+      PE+EISL PA WLWD LRRS   GF LPLSGG+DSSS ACIVYSMC++I ++++ GN + L D+++VVGD +Y P + +ELC ++  TCYM+SENSS++T+ RAK LAA I SNH+++ ID  V A + +     G+   ++A+GGS  ENLALQNVQARIRMVLAYL +QL LW++ ++GGLLVL S N+DE L GY TKYDCSSAD+NPIG + KTDLK F+ Y +   +L SL+G
Sbjct:    1 MGRKVTLATCSLNQWALDFDGNLGRILKSIEIAKQKGAKYRLGPELEICGYGCADHFYESDTLLHCFQVLKSLLESPLTQDIICDVGMPVMHHNVRYNCRVIFLNKKILFIRPKMLLANYGNNREFRWFSPWSRPRYVEEYFLPRMIQDVTEQSTVPFGDVVLSTIDTCIGSEICAELWNPRSPHVDMGLDGIEIFTNSSASYHELRKADHRVNLVKSATTKSGGIYMFANQRGCDGDRLYYDGCAMIAINGDIVARGAQFSLEDVEVVTATLDLEDVRSYRGERCHPHMEYEH-KPYQRIKTDFSLS---DCDDRCLPTHQPVEWIFHTPEEEISLGPACWLWDYLRRSGQAGFLLPLSGGVDSSSSACIVYSMCVQICQAVEHGNCQVLEDVQRVVGDSSYRPQDPRELCGRLFTTCYMASENSSEDTRNRAKDLAAQIGSNHLNINIDMAVKAMLGIFSMVTGKWPQFRANGGSARENLALQNVQARIRMVLAYLFAQLCLWAQGKTGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGVSKTDLKGFLEYCVKRLQLTSLIG 564          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Zebrafish
Match: nadsyn1 (NAD synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-070615-22])

HSP 1 Score: 191.045 bits (484), Expect = 7.853e-56
Identity = 87/153 (56.86%), Postives = 110/153 (71.90%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQ 659
            M    T AT  LNQWALDFDGN   I++SI++AK + AKYR GPELE+ GYGC DHFYESDTLLH ++V+K++LE+    DIICD+GMP+ H    YNCR+I LN KI+ IRPK +LAN    RE RWF+PW +   ++ Y LP  IQ++T Q
Sbjct:    1 MGRKVTLATCSLNQWALDFDGNLGRILKSIEIAKQKGAKYRLGPELEICGYGCADHFYESDTLLHCFQVLKSLLESPLTQDIICDVGMPVMHHNVRYNCRVIFLNKKILFIRPKMLLANYGNNREFRWFSPWSRPRYVEEYFLPRMIQDVTEQ 153          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Xenopus
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:100145482])

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 396/700 (56.57%), Postives = 509/700 (72.71%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            M    T AT  LNQWALDF+GN   I+ SI +AK + A+YR GPELE+ GYGC DHFYESDT+ HS++V+  +LE+ +  DIICD+GMP+ H+   YNCR+I LN KI+LIRPK V+AN+  +RE RWFTPW +   ++++ LP  IQ ITGQ  VPFGDA++   DTC+  E CEELWA N+P+ID  L+G EII NG+ S+H LRK   R++LI+S   K GG+Y+ +N++GCD +R+Y+DG A++++NG+IV Q  QFSL DVEVL   +DL++VR+YR   S+  ++       HR+ +DFSL+   S+++  L  +  I      PE+EISL PA WLWD LRRSK +GF LPLSGG+DSS+VACIVYSMC  + +++  GN   L +++ +V D  Y+PT+ ++LC +IL TCYM+SENSS++T  RAK LA  I S H+   ID  V A + +     G+   ++AHGGS  ENLALQNVQARIRMV+AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSADLNPIG I KTDL+ FI YSI+ F+L +L GI+ APPTAELEPL DGKV Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +WK+   TP ++A+KVKHFF  YS NRHKMT +TP+YH ESY+ DDNRFDLRP+LYN  W+WQF CID  V  LE+
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLNRILRSISIAKEKKARYRLGPELEICGYGCSDHFYESDTIFHSFQVLAKLLESPETTDIICDVGMPVMHKNVRYNCRVIFLNRKILLIRPKMVMANEGNYRELRWFTPWSRIREVEDFFLPRTIQCITGQITVPFGDAVIATKDTCVGTEICEELWAPNSPHIDMGLDGVEIITNGSASHHELRKAYLRVDLIKSTTAKNGGIYLLSNMKGCDSDRLYFDGCAMVSLNGDIVAQGSQFSLTDVEVLTATLDLEDVRSYRAQISSRCISASRVRPFHRVHVDFSLS---SFDDLDLPTNDLIQWKYHTPEEEISLGPACWLWDYLRRSKQSGFLLPLSGGVDSSAVACIVYSMCTLVCEAVATGNGDVLTEVQGIVQDDTYLPTSPQDLCKRILTTCYMASENSSQDTHDRAKHLAEQIGSYHLTPKIDGAVKAIMNIFQVVTGKVPKFRAHGGSGRENLALQNVQARIRMVIAYLFAQLSLWARGLEGGLLVLGSANVDESLRGYLTKYDCSSADLNPIGGISKTDLRGFIQYSIDRFQLHALKGIMSAPPTAELEPLTDGKVSQTDEDDMGMTYAELSVYGKLRKVLKAGPYSMFCKLLLMWKNI-CTPKQVADKVKHFFRTYSINRHKMTTLTPAYHAESYSPDDNRFDLRPFLYNTAWNWQFRCIDNEVSHLER 696          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Xenopus
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:100145482])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 394/695 (56.69%), Postives = 506/695 (72.81%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M    T AT  LNQWALDF+GN   I+ SI +AK + A+YR GPELE+ GYGC DHFYESDT+ HS++V+  +LE+ +  DIICD+GMP+ H+   YNCR+I LN KI+LIRPK V+AN+  +RE RWFTPW +   ++++ LP  IQ ITGQ  VPFGDA++   DTC+  E CEELWA N+P+ID  L+G EII NG+ S+H LRK   R++LI+S   K GG+Y+ +N++GCD +R+Y+DG A++++NG+IV Q  QFSL DVEVL   +DL++VR+YR   S+  ++       HR+ +DFSL+   S+++  L  +  I      PE+EISL PA WLWD LRRSK +GF LPLSGG+DSS+VACIVYSMC  + +++  GN   L +++ +V D  Y+PT+ ++LC +IL TCYM+SENSS++T  RAK LA  I S H+   ID  V A + +     G+   ++AHGGS  ENLALQNVQARIRMV+AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSADLNPIG I KTDL+ FI YSI+ F+L +L GI+ APPTAELEPL DGKV Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +WK+   TP ++A+KVKHFF  YS NRHKMT +TP+YH ESY+ DDNRFDLRP+LYN  W+WQF CID  V
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLNRILRSISIAKEKKARYRLGPELEICGYGCSDHFYESDTIFHSFQVLAKLLESPETTDIICDVGMPVMHKNVRYNCRVIFLNRKILLIRPKMVMANEGNYRELRWFTPWSRIREVEDFFLPRTIQCITGQITVPFGDAVIATKDTCVGTEICEELWAPNSPHIDMGLDGVEIITNGSASHHELRKAYLRVDLIKSTTAKNGGIYLLSNMKGCDSDRLYFDGCAMVSLNGDIVAQGSQFSLTDVEVLTATLDLEDVRSYRAQISSRCISASRVRPFHRVHVDFSLS---SFDDLDLPTNDLIQWKYHTPEEEISLGPACWLWDYLRRSKQSGFLLPLSGGVDSSAVACIVYSMCTLVCEAVATGNGDVLTEVQGIVQDDTYLPTSPQDLCKRILTTCYMASENSSQDTHDRAKHLAEQIGSYHLTPKIDGAVKAIMNIFQVVTGKVPKFRAHGGSGRENLALQNVQARIRMVIAYLFAQLSLWARGLEGGLLVLGSANVDESLRGYLTKYDCSSADLNPIGGISKTDLRGFIQYSIDRFQLHALKGIMSAPPTAELEPLTDGKVSQTDEDDMGMTYAELSVYGKLRKVLKAGPYSMFCKLLLMWKNI-CTPKQVADKVKHFFRTYSINRHKMTTLTPAYHAESYSPDDNRFDLRPFLYNTAWNWQFRCIDNEV 691          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Xenopus
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:100145482])

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 394/695 (56.69%), Postives = 506/695 (72.81%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M    T AT  LNQWALDF+GN   I+ SI +AK + A+YR GPELE+ GYGC DHFYESDT+ HS++V+  +LE+ +  DIICD+GMP+ H+   YNCR+I LN KI+LIRPK V+AN+  +RE RWFTPW +   ++++ LP  IQ ITGQ  VPFGDA++   DTC+  E CEELWA N+P+ID  L+G EII NG+ S+H LRK   R++LI+S   K GG+Y+ +N++GCD +R+Y+DG A++++NG+IV Q  QFSL DVEVL   +DL++VR+YR   S+  ++       HR+ +DFSL+   S+++  L  +  I      PE+EISL PA WLWD LRRSK +GF LPLSGG+DSS+VACIVYSMC  + +++  GN   L +++ +V D  Y+PT+ ++LC +IL TCYM+SENSS++T  RAK LA  I S H+   ID  V A + +     G+   ++AHGGS  ENLALQNVQARIRMV+AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSADLNPIG I KTDL+ FI YSI+ F+L +L GI+ APPTAELEPL DGKV Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +WK+   TP ++A+KVKHFF  YS NRHKMT +TP+YH ESY+ DDNRFDLRP+LYN  W+WQF CID  V
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLNRILRSISIAKEKKARYRLGPELEICGYGCSDHFYESDTIFHSFQVLAKLLESPETTDIICDVGMPVMHKNVRYNCRVIFLNRKILLIRPKMVMANEGNYRELRWFTPWSRIREVEDFFLPRTIQCITGQITVPFGDAVIATKDTCVGTEICEELWAPNSPHIDMGLDGVEIITNGSASHHELRKAYLRVDLIKSTTAKNGGIYLLSNMKGCDSDRLYFDGCAMVSLNGDIVAQGSQFSLTDVEVLTATLDLEDVRSYRAQISSRCISASRVRPFHRVHVDFSLS---SFDDLDLPTNDLIQWKYHTPEEEISLGPACWLWDYLRRSKQSGFLLPLSGGVDSSAVACIVYSMCTLVCEAVATGNGDVLTEVQGIVQDDTYLPTSPQDLCKRILTTCYMASENSSQDTHDRAKHLAEQIGSYHLTPKIDGAVKAIMNIFQVVTGKVPKFRAHGGSGRENLALQNVQARIRMVIAYLFAQLSLWARGLEGGLLVLGSANVDESLRGYLTKYDCSSADLNPIGGISKTDLRGFIQYSIDRFQLHALKGIMSAPPTAELEPLTDGKVSQTDEDDMGMTYAELSVYGKLRKVLKAGPYSMFCKLLLMWKNI-CTPKQVADKVKHFFRTYSINRHKMTTLTPAYHAESYSPDDNRFDLRPFLYNTAWNWQFRCIDNEV 691          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Xenopus
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:100145482])

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 385/703 (54.77%), Postives = 500/703 (71.12%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALW--LWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKT 2303
            M    T AT  LNQWALDF+GN   I+ SI +AK + A+YR GPELE+ GYGC DHFYESDT+ HS++V+  +LE+ +  DIICD+GMP+ H+   YNCR+I LN KI+LIRPK V+AN+  +RE RWFTPW +   ++++ LP  IQ ITGQ  VPFGDA++   DTC+  E CEELWA N+P+ID  L+G EII NG+ S+H LRK   R++LI+S   K GG+Y+ +N++GCD +R+Y+DG A++++NG+IV Q  QFSL DVEVL   +DL++VR+YR   S+  ++       HR+ +DFSL+   S+++  L  +  I      PE+EIS  P  +     N      +GF LPLSGG+DSS+VACIVYSMC  + +++  GN   L +++ +V D  Y+PT+ ++LC +IL TCYM+SENSS++T  RAK LA  I S H+   ID  V A + +     G+   ++AHGGS  ENLALQNVQARIRMV+AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSADLNPIG I KTDL+ FI YSI+ F+L +L GI+ APPTAELEPL DGKV Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +WK+   TP ++A+KVKHFF  YS NRHKMT +TP+YH ESY+ DDNRFDLRP+LYN  W+WQF CID  V  L+ +
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLNRILRSISIAKEKKARYRLGPELEICGYGCSDHFYESDTIFHSFQVLAKLLESPETTDIICDVGMPVMHKNVRYNCRVIFLNRKILLIRPKMVMANEGNYRELRWFTPWSRIREVEDFFLPRTIQCITGQITVPFGDAVIATKDTCVGTEICEELWAPNSPHIDMGLDGVEIITNGSASHHELRKAYLRVDLIKSTTAKNGGIYLLSNMKGCDSDRLYFDGCAMVSLNGDIVAQGSQFSLTDVEVLTATLDLEDVRSYRAQISSRCISASRVRPFHRVHVDFSLS---SFDDLDLPTNDLIQWKYHTPEEEISYYPTHFGAKLPNYVSVFQSGFLLPLSGGVDSSAVACIVYSMCTLVCEAVATGNGDVLTEVQGIVQDDTYLPTSPQDLCKRILTTCYMASENSSQDTHDRAKHLAEQIGSYHLTPKIDGAVKAIMNIFQVVTGKVPKFRAHGGSGRENLALQNVQARIRMVIAYLFAQLSLWARGLEGGLLVLGSANVDESLRGYLTKYDCSSADLNPIGGISKTDLRGFIQYSIDRFQLHALKGIMSAPPTAELEPLTDGKVSQTDEDDMGMTYAELSVYGKLRKVLKAGPYSMFCKLLLMWKNI-CTPKQVADKVKHFFRTYSINRHKMTTLTPAYHAESYSPDDNRFDLRPFLYNTAWNWQFRCIDNEVSGLKTS 699          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Xenopus
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:100145482])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 384/697 (55.09%), Postives = 497/697 (71.31%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALW--LWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M    T AT  LNQWALDF+GN   I+ SI +AK + A+YR GPELE+ GYGC DHFYESDT+ HS++V+  +LE+ +  DIICD+GMP+ H+   YNCR+I LN KI+LIRPK V+AN+  +RE RWFTPW +   ++++ LP  IQ ITGQ  VPFGDA++   DTC+  E CEELWA N+P+ID  L+G EII NG+ S+H LRK   R++LI+S   K GG+Y+ +N++GCD +R+Y+DG A++++NG+IV Q  QFSL DVEVL   +DL++VR+YR   S+  ++       HR+ +DFSL+   S+++  L  +  I      PE+EIS  P  +     N      +GF LPLSGG+DSS+VACIVYSMC  + +++  GN   L +++ +V D  Y+PT+ ++LC +IL TCYM+SENSS++T  RAK LA  I S H+   ID  V A + +     G+   ++AHGGS  ENLALQNVQARIRMV+AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSADLNPIG I KTDL+ FI YSI+ F+L +L GI+ APPTAELEPL DGKV Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +WK+   TP ++A+KVKHFF  YS NRHKMT +TP+YH ESY+ DDNRFDLRP+LYN  W+WQF CID  V
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLNRILRSISIAKEKKARYRLGPELEICGYGCSDHFYESDTIFHSFQVLAKLLESPETTDIICDVGMPVMHKNVRYNCRVIFLNRKILLIRPKMVMANEGNYRELRWFTPWSRIREVEDFFLPRTIQCITGQITVPFGDAVIATKDTCVGTEICEELWAPNSPHIDMGLDGVEIITNGSASHHELRKAYLRVDLIKSTTAKNGGIYLLSNMKGCDSDRLYFDGCAMVSLNGDIVAQGSQFSLTDVEVLTATLDLEDVRSYRAQISSRCISASRVRPFHRVHVDFSLS---SFDDLDLPTNDLIQWKYHTPEEEISYYPTHFGAKLPNYVSVFQSGFLLPLSGGVDSSAVACIVYSMCTLVCEAVATGNGDVLTEVQGIVQDDTYLPTSPQDLCKRILTTCYMASENSSQDTHDRAKHLAEQIGSYHLTPKIDGAVKAIMNIFQVVTGKVPKFRAHGGSGRENLALQNVQARIRMVIAYLFAQLSLWARGLEGGLLVLGSANVDESLRGYLTKYDCSSADLNPIGGISKTDLRGFIQYSIDRFQLHALKGIMSAPPTAELEPLTDGKVSQTDEDDMGMTYAELSVYGKLRKVLKAGPYSMFCKLLLMWKNI-CTPKQVADKVKHFFRTYSINRHKMTTLTPAYHAESYSPDDNRFDLRPFLYNTAWNWQFRCIDNEV 693          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Mouse
Match: Nadsyn1 (NAD synthetase 1 [Source:MGI Symbol;Acc:MGI:1926164])

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 384/700 (54.86%), Postives = 497/700 (71.00%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            M    T AT  LNQWALDF+GN + I++SIQ+AK + A+YR GPELE+ GYGC DH++ESDTLLHS +V+  +L++    DIICD+GMPI HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y+LP  +Q++T QK VPFGD +L   DTC+  E CEELW   +P+ID  L+G EII N +GS+H+LRK   R++L+  A  K GG+Y+  N +GCDG+R+YYDG A+IA+NG I  Q  QFSL DVEVL   +DL++VR+Y+   S+ ++         R+ +DF+L+      +    +S P+  T   PE+EISL PA WLWD LRRSK  GFFLPLSGG+DS++ ACIVYSMC  +  ++K GN++ L D++ +V + +Y P + +ELC ++L TCYM+SENSS+ET +RA  LA  I S HI+++ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   G LLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ +    F+L  L  IL AP TAELEPL DG+V Q+DE DMGMTY+ELS +G+LRKV   GP+ MF KLL +W+D   TP+++AEKVK FF  YS NRHKMT +TP+YH E+Y+ DDNRFDLRP+LYN  W WQF CID  V  LE+
Sbjct:    1 MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKGARYRLGPELEICGYGCWDHYHESDTLLHSLQVLAALLDSPVTQDIICDVGMPIMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWTRSRQTEEYVLPRMLQDLTKQKTVPFGDVVLATQDTCVGSEICEELWTPRSPHIDMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSIFAQGTQFSLDDVEVLTATLDLEDVRSYKAEISSRNLEATRVSPYPRVTVDFALSVS---EDLLEPVSEPMEWTYHRPEEEISLGPACWLWDFLRRSKQAGFFLPLSGGVDSAASACIVYSMCCLVCDAVKSGNQQVLTDVQNLVDESSYTPQDPRELCGRLLTTCYMASENSSQETHSRATKLAQLIGSYHINLSIDTAVKAVLGIFSLMTGKLPRFSAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGARGSLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCAERFQLPVLQTILSAPATAELEPLADGQVSQMDEEDMGMTYAELSIFGRLRKVAKAGPYSMFCKLLNMWRDS-YTPTQVAEKVKLFFSKYSMNRHKMTTLTPAYHAENYSPDDNRFDLRPFLYNTRWPWQFLCIDNQVLQLER 696          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Mouse
Match: Nadsyn1 (NAD synthetase 1 [Source:MGI Symbol;Acc:MGI:1926164])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 299/566 (52.83%), Postives = 395/566 (69.79%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASL 1898
            M    T AT  LNQWALDF+GN + I++SIQ+AK + A+YR GPELE+ GYGC DH++ESDTLLHS +V+  +L++    DIICD+GMPI HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y+LP  +Q++T QK VPFGD +L   DTC+  E CEELW   +P+ID  L+G EII N +GS+H+LRK   R++L+  A  K GG+Y+  N +GCDG+R+YYDG A+IA+NG I  Q  QFSL DVEVL   +DL++VR+Y+   S+ ++         R+ +DF+L+      +    +S P+  T   PE+EISL PA WLWD LRRSK  GFFLPLSGG+DS++ ACIVYSMC  +  ++K GN++ L D++ +V + +Y P + +ELC ++L TCYM+SENSS+ET +RA  LA  I S HI+++ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   G LLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ +    F+L  L
Sbjct:    1 MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKGARYRLGPELEICGYGCWDHYHESDTLLHSLQVLAALLDSPVTQDIICDVGMPIMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWTRSRQTEEYVLPRMLQDLTKQKTVPFGDVVLATQDTCVGSEICEELWTPRSPHIDMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSIFAQGTQFSLDDVEVLTATLDLEDVRSYKAEISSRNLEATRVSPYPRVTVDFALSVS---EDLLEPVSEPMEWTYHRPEEEISLGPACWLWDFLRRSKQAGFFLPLSGGVDSAASACIVYSMCCLVCDAVKSGNQQVLTDVQNLVDESSYTPQDPRELCGRLLTTCYMASENSSQETHSRATKLAQLIGSYHINLSIDTAVKAVLGIFSLMTGKLPRFSAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGARGSLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCAERFQLPVL 563          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Mouse
Match: Nadsyn1 (NAD synthetase 1 [Source:MGI Symbol;Acc:MGI:1926164])

HSP 1 Score: 110.538 bits (275), Expect = 3.429e-28
Identity = 59/141 (41.84%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNY 623
            M    T AT  LNQWALDF+GN + I++SIQ+AK + A+YR GPELE+                  W                     PI HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y
Sbjct:    1 MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKGARYRLGPELEI------------------W---------------------PIMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWTRSRQTEEY 102          
BLAST of Glutamine-dependent NAD( ) synthetase vs. UniProt/SwissProt
Match: sp|Q5ZMA6|NADE_CHICK (Glutamine-dependent NAD(+) synthetase OS=Gallus gallus OX=9031 GN=NADSYN1 PE=2 SV=1)

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 395/700 (56.43%), Postives = 501/700 (71.57%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            M    + A   LNQWALDF+GN++ I+ SI +AK + A+YR GPELE+ GYGC DH+YESDTLLHS++V+  +LE+    DIICD+GMP+ HR   YNCR+I LN KI+LIRPK  LAN   +RE RWFTPW +   ++ YLLP  IQE+TGQ  VPFGDA+L   DTC+  E CEELWA N+P+I+  L+G EI  N +GS+H+LRK   R++L+ SA  K GG+Y+ +N +GCDG+R+YYDG A+I++NGE V Q  QFSL DVEVLV  +DL++VR+YR   S+ ++     +   RI ++F+L+     ++  + I  PI      PE+EI L PA WLWD LRRSK  GF LPLSGG+DSS+ ACIVYSMC ++  ++K GN + LAD R++V D  Y+P + +E C ++  TCYM+SENSS++T+ RAK LA  I S HI++ ID  V A + +     GR   +  +GGS  ENLALQNVQAR+RMV AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSAD+NPIG I KTDLK FI Y I  F+L +L  I+ APPTAELEPL DG+V Q DE DMGMTY+ELS YGKLRK+   GP+ MF KL+ +WK+   TP E+A KVKHFF  YS NRHKMT +TPSYH E+Y+ DDNRFDLRP+LYN  WSWQF CID  V  LEK
Sbjct:    1 MGRAVSVAACALNQWALDFEGNAERILRSISIAKSKGARYRLGPELEICGYGCADHYYESDTLLHSFQVLAKLLESPATQDIICDVGMPLMHRNVRYNCRVIFLNKKILLIRPKISLANAGNYRELRWFTPWNKARHVEEYLLPRIIQEVTGQDTVPFGDAVLATKDTCLGTEICEELWAPNSPHIEMGLDGVEIFTNSSGSHHVLRKAHTRVDLVNSATAKNGGIYILSNQKGCDGDRLYYDGCAMISMNGETVAQGSQFSLDDVEVLVATLDLEDVRSYRAEISSRNLAASKVNPFPRIKVNFALSCS---DDLSVPICVPIQWRHHSPEEEICLGPACWLWDYLRRSKQAGFLLPLSGGIDSSATACIVYSMCRQVCLAVKNGNSEVLADARKIVHDETYIPEDPQEFCKRVFTTCYMASENSSQDTRNRAKLLAEQIGSYHINLNIDAAVKAIVGIFSMVTGRTPRFSVYGGSRRENLALQNVQARVRMVPAYLFAQLTLWTRGMPGGLLVLGSANVDESLRGYLTKYDCSSADINPIGGISKTDLKNFIQYCIENFQLTALRSIMAAPPTAELEPLMDGQVSQTDEADMGMTYAELSIYGKLRKIAKAGPYSMFCKLINLWKEI-CTPREVASKVKHFFRMYSVNRHKMTTLTPSYHAENYSPDDNRFDLRPFLYNTTWSWQFRCIDNQVSHLEK 696          
BLAST of Glutamine-dependent NAD( ) synthetase vs. UniProt/SwissProt
Match: sp|Q4R5Y2|NADE_MACFA (Glutamine-dependent NAD(+) synthetase OS=Macaca fascicularis OX=9541 GN=NADSYN1 PE=2 SV=1)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 384/701 (54.78%), Postives = 500/701 (71.33%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKT 2303
            M    T AT  LNQWALDF+GN + I++SI++AK R A+YR GPELE+ GYGC DH+YESDTLLHS++V+  +LE+    DIICD+GMP+ HR   YNCR+I L+ KI+LIRPK  LAN+  +RE RWFTPW +    + YLLP  IQ++T Q+  PFGDA+L   DTCI  E CEELW  ++P+ID  L+G EII N +GS+H+LRK + R++L+  A  K GG+Y+  N +GCDG+R+YYDG A+IA+NG +  Q  QFSL DVEVL   +DL++VR+YR   S+ ++         R+ +DF+L+    + +    +S PI      PE+EISL PA WLWD LRRS+  GF LPLSGG+DS++ AC+VYSMC ++ KS++ GN++ LAD+R +V  ++Y P + ++LC  IL TCYM+S+NSS+ET TRA+ LA  I S+HI + ID  V A   +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   GGLLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ + I  F+L +L  I+ AP TAELEPL DG+V Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +W+    TP ++A+KVK FF  +S NRHKMT +TP+YH E+Y+ +DNRFDLRP+LYN  W WQF CI+  V  LE+ 
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYESDTLLHSFQVLAALLESPVTQDIICDVGMPVMHRNVRYNCRVIFLSRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEEYLLPRMIQDLTKQETAPFGDAVLATWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHHVLRKANTRVDLVTMATSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPRVKVDFALSC---HEDLLAPVSEPIEWKYHSPEEEISLGPACWLWDFLRRSQQGGFLLPLSGGVDSAATACLVYSMCCQVCKSVRSGNQEVLADVRTIVNQISYTPQDPRDLCGHILTTCYMASKNSSQETCTRARELAQQIGSHHISLNIDPAVKAVTGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGIRGGLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCIERFQLTALQSIISAPVTAELEPLADGQVSQTDEEDMGMTYAELSVYGKLRKVAKMGPYSMFCKLLGMWRHV-CTPRQVADKVKWFFTKHSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERA 697          
BLAST of Glutamine-dependent NAD( ) synthetase vs. UniProt/SwissProt
Match: sp|Q711T7|NADE_MOUSE (Glutamine-dependent NAD(+) synthetase OS=Mus musculus OX=10090 GN=Nadsyn1 PE=1 SV=1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 384/700 (54.86%), Postives = 497/700 (71.00%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            M    T AT  LNQWALDF+GN + I++SIQ+AK + A+YR GPELE+ GYGC DH++ESDTLLHS +V+  +L++    DIICD+GMPI HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y+LP  +Q++T QK VPFGD +L   DTC+  E CEELW   +P+ID  L+G EII N +GS+H+LRK   R++L+  A  K GG+Y+  N +GCDG+R+YYDG A+IA+NG I  Q  QFSL DVEVL   +DL++VR+Y+   S+ ++         R+ +DF+L+      +    +S P+  T   PE+EISL PA WLWD LRRSK  GFFLPLSGG+DS++ ACIVYSMC  +  ++K GN++ L D++ +V + +Y P + +ELC ++L TCYM+SENSS+ET +RA  LA  I S HI+++ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   G LLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ +    F+L  L  IL AP TAELEPL DG+V Q+DE DMGMTY+ELS +G+LRKV   GP+ MF KLL +W+D   TP+++AEKVK FF  YS NRHKMT +TP+YH E+Y+ DDNRFDLRP+LYN  W WQF CID  V  LE+
Sbjct:    1 MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKGARYRLGPELEICGYGCWDHYHESDTLLHSLQVLAALLDSPVTQDIICDVGMPIMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWTRSRQTEEYVLPRMLQDLTKQKTVPFGDVVLATQDTCVGSEICEELWTPRSPHIDMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSIFAQGTQFSLDDVEVLTATLDLEDVRSYKAEISSRNLEATRVSPYPRVTVDFALSVS---EDLLEPVSEPMEWTYHRPEEEISLGPACWLWDFLRRSKQAGFFLPLSGGVDSAASACIVYSMCCLVCDAVKSGNQQVLTDVQNLVDESSYTPQDPRELCGRLLTTCYMASENSSQETHSRATKLAQLIGSYHINLSIDTAVKAVLGIFSLMTGKLPRFSAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGARGSLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCAERFQLPVLQTILSAPATAELEPLADGQVSQMDEEDMGMTYAELSIFGRLRKVAKAGPYSMFCKLLNMWRDS-YTPTQVAEKVKLFFSKYSMNRHKMTTLTPAYHAENYSPDDNRFDLRPFLYNTRWPWQFLCIDNQVLQLER 696          
BLAST of Glutamine-dependent NAD( ) synthetase vs. UniProt/SwissProt
Match: sp|Q3ZBF0|NADE_BOVIN (Glutamine-dependent NAD(+) synthetase OS=Bos taurus OX=9913 GN=NADSYN1 PE=2 SV=1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 381/699 (54.51%), Postives = 495/699 (70.82%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLE 2297
            M    T AT  LNQWALDF+GN + I++SI++AK R A+YR GPELE+ GYGC DH+YESDTLLHS +V+  +LE+    DIICD+GMP+ HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y LP  +Q++T Q+ VPFGDA+L   DTCI  E CEELW  ++P++D  L+G EI  N +GS+H+LRK   R++L+  A  K GG+Y+  N +GCDG+R+YYDG ALIA+NG I  Q  QFSL DVEVL   +DL+++R+YR   S+ ++         R+ +DF+L+    + +    +S PI      P +EISL PA WLWD LRRS+  GFFLPLSGG+DS++ AC+VYSMC ++ +++K GN + LAD+R +V  L+Y P + +ELC ++L TCYM+SENSS+ET  RA+ LA  I S+HI + ID +V A + +     G    +  HGGS+ ENLALQNVQAR+RMV+AYL +QL LWS+   GGLLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+   +  F+L +L  IL AP TAELEPL  G+V Q DE DMGMTY+ELS YG+LRKV   GP+ MF KLL++W+D   +P ++A+KVK FF  YS NRHKMT +TP+YH ESY+ DDNRFDLRP+LYN  W WQF CI+  V  LE
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKHRGARYRLGPELEICGYGCWDHYYESDTLLHSLQVLAALLESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRQTEEYFLPRMLQDLTKQETVPFGDAVLSTWDTCIGSEVCEELWTPHSPHVDMGLDGVEIFTNASGSHHVLRKAHARVDLVTMATTKNGGIYLLANQKGCDGDRLYYDGCALIAMNGSIFAQGSQFSLDDVEVLTATLDLEDIRSYRAEISSRNLAASRVSPYPRVKVDFALSC---HEDLLEPVSEPIEWKYHSPAEEISLGPACWLWDFLRRSRQAGFFLPLSGGVDSAATACLVYSMCHQVCEAVKRGNLEVLADVRTIVNQLSYTPQDPRELCGRVLTTCYMASENSSQETCDRARELAQQIGSHHIGLHIDPVVKALVGLFSLVTGASPRFAVHGGSDRENLALQNVQARVRMVIAYLFAQLSLWSRGAPGGLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQLCVERFQLPALQSILAAPATAELEPLAHGRVSQTDEEDMGMTYAELSVYGRLRKVAKTGPYSMFCKLLDMWRDT-CSPRQVADKVKCFFSKYSMNRHKMTTLTPAYHAESYSPDDNRFDLRPFLYNTRWPWQFRCIENQVLQLE 695          
BLAST of Glutamine-dependent NAD( ) synthetase vs. UniProt/SwissProt
Match: sp|Q6IA69|NADE_HUMAN (Glutamine-dependent NAD(+) synthetase OS=Homo sapiens OX=9606 GN=NADSYN1 PE=1 SV=3)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 382/701 (54.49%), Postives = 499/701 (71.18%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKT 2303
            M    T AT  LNQWALDF+GN + I++SI++AK R A+YR GPELE+ GYGC DH+YESDTLLHS++V+  ++E+    DIICD+GMP+ HR   YNCR+I LN KI+LIRPK  LAN+  +RE RWFTPW +    + Y LP  IQ++T Q+ VPFGDA+L   DTCI  E CEELW  ++P+ID  L+G EII N +GS+ +LRK + R++L+     K GG+Y+  N +GCDG+R+YYDG A+IA+NG +  Q  QFSL DVEVL   +DL++VR+YR   S+ ++         R+ +DF+L+    + +    IS PI      PE+EISL PA WLWD LRRS+  GF LPLSGG+DS++ AC++YSMC ++ ++++ GN + LAD+R +V  ++Y P + ++LC +IL TCYM+S+NSS+ET TRA+ LA  I S+HI + ID  V A + +     G+   + AHGGS+ ENLALQNVQARIRMVLAYL +QL LWS+   GGLLVL S N+DE L GYLTKYDCSSAD+NPIG I KTDL+ F+ + I  F+L +L  IL AP TAELEPL DG+V Q DE DMGMTY+ELS YGKLRKV   GP+ MF KLL +W+    TP ++A+KVK FF  YS NRHKMT +TP+YH E+Y+ +DNRFDLRP+LYN  W WQF CI+  V  LE+ 
Sbjct:    1 MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYESDTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRLYYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPRVKVDFALSC---HEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQAGFLLPLSGGVDSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSVYGKLRKVAKMGPYSMFCKLLGMWRHI-CTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERA 697          
BLAST of Glutamine-dependent NAD( ) synthetase vs. TrEMBL
Match: A0A4W6CZ16 (Glutamine-dependent NAD(+) synthetase OS=Lates calcarifer OX=8187 GN=nadsyn1 PE=3 SV=1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 402/697 (57.68%), Postives = 507/697 (72.74%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRN--CSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M    T AT  LNQWALDF+GN + I++SI++AK   AKYR GPELE+ GYGC DHFYESDTLLHS++V+K +LE+    DIICD+GMPI H    YNCR++ LN KI+LIRPK ++AN  ++RE RWF+PW Q   ++ Y LP  IQE+TGQ  VP GD +L   DTCI  E C ELW   +P+I+  L+G EI  N + S+H LRK D+R+NLI+SA  K GG+Y+Y N RGCDG+R+YYDG A++A+NG+IV Q  QFSL DVEV++   DL++VR+YR   C  +       C   HR+ +DFSL+T    ++  L   +PI      PE+EISL PA WLWD LRRS   GF LPLSGG+DSSS ACIV+SMC+ + ++++ GN++ L DIR+VVGD +Y P + KELC +I  TCYM+SENSS++T+ RAK LA  I S H+ + ID  V   + +     GR   ++A+GGS+ ENLALQNVQAR+RMVLAYL +QL LW++ + GGLLVL S N+DE L GY TKYDCSSAD+NPIG I KTDLK F+ Y + +F+L +L GIL APPTAELEPL DG+V Q DEVDMGMTYSELS  G+LRK+  CGPF MF KL+ +WKD  L+P+E+A+KVKHFF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LYN  WSWQF CID  V
Sbjct:    1 MGRKVTLATCSLNQWALDFEGNLERILKSIEIAKTNGAKYRLGPELEICGYGCADHFYESDTLLHSFQVLKKLLESPITKDIICDVGMPIMHHNVRYNCRVLFLNRKILLIRPKMLMANHGIYREVRWFSPWNQLRKVEEYFLPRMIQEVTGQNTVPIGDCVLSTKDTCIGTEICAELWNPRSPHIEMGLDGVEIFTNSSASHHELRKADQRVNLIKSATSKSGGIYLYANQRGCDGDRVYYDGCAMVAINGDIVAQGAQFSLNDVEVIMATADLEDVRSYRGELCQPHMQSETKPC---HRVKVDFSLSTG---DDLYLPTHQPITWHFHTPEEEISLGPACWLWDYLRRSGQAGFLLPLSGGVDSSSTACIVHSMCVLLCQTVQDGNKQVLEDIRRVVGDDSYCPQHAKELCGRIFTTCYMASENSSEDTRNRAKDLANQIGSTHMSINIDMAVEGILGIFSAVTGRWPQFRANGGSHRENLALQNVQARVRMVLAYLFAQLSLWARGKPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGISKTDLKSFLLYCVEQFQLTALRGILAAPPTAELEPLTDGQVSQTDEVDMGMTYSELSVIGRLRKISKCGPFSMFCKLIHMWKDA-LSPTEVAQKVKHFFRMYSVNRHKMTTVTPSYHAESYSPDDNRFDLRPFLYNTRWSWQFRCIDNQV 690          
BLAST of Glutamine-dependent NAD( ) synthetase vs. TrEMBL
Match: A0A2I4ANB0 (Glutamine-dependent NAD(+) synthetase OS=Austrofundulus limnaeus OX=52670 GN=nadsyn1 PE=3 SV=1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 399/697 (57.25%), Postives = 509/697 (73.03%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRN--CSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M    T AT  LNQWALDF+GNS+ I+ SI++AK + AKYR GPELE+ G+GC DHFYESDTLLHS++V+KT+LE+    DIICD+GMPI H    YNCR++ LN KI+LIRPK ++A+  ++RE RWF+PW+ + V + Y LP  IQ +TGQ  VPFGD +L   DTCI  E C ELWA N+P+I   L+G EI  N + S+H LRK D+R+NL++SA  K GGVY+Y N RGCDG+R+YYDG A++A+NG+IV Q  QFSL DVEV+   +DL++VR+YR   C       +  C   HRI +DFSL+     ++  L   +PI       E+EISL PA WLWD LRRS+  GF LPLSGG+DSSS ACIV+SMC+ + +++  GN   L D+R+VVGD +Y P + KELC +I  TCYM+SENSS++T +RA+ LA+ I S H+++ ID  V   + +     GR   ++A+GGS+ ENLALQNVQAR+RMVLAYL +QL LW++ + GGLLVL S N+DE L GY TKYDCSSAD+NPIG I KTDLK F+ Y +++F+L +L GIL APPTAELEPL DG+V Q DE DMGMTYSELS  G+LRK+  CGPF MF KL+ +WKD  L+P+E+A+KVKHFF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LYN  W+WQF CID  V
Sbjct:    1 MGRKVTVATCSLNQWALDFEGNSERILRSIEIAKDQGAKYRLGPELEICGFGCADHFYESDTLLHSFQVLKTLLESPITQDIICDVGMPIMHHNVRYNCRVLFLNRKILLIRPKMLMADYGIYRERRWFSPWRSRQV-EEYFLPRMIQAVTGQDTVPFGDCVLSTKDTCIGTELCAELWAPNSPHIQMGLDGVEIFTNSSASHHELRKADQRVNLVKSATFKSGGVYLYANQRGCDGDRVYYDGCAMVAINGDIVAQGAQFSLTDVEVITATLDLEDVRSYRGELCQPQMESELRPC---HRIKVDFSLSGD---DDIYLPTHQPIQWHFHTAEEEISLGPACWLWDYLRRSRQAGFLLPLSGGVDSSSTACIVHSMCVLLCQAVNNGNSHVLEDVRRVVGDESYNPQHPKELCGRIFTTCYMASENSSEDTCSRARELASQIGSTHMNINIDLAVKGILGIFSAVTGRWPQFRANGGSHRENLALQNVQARLRMVLAYLFAQLSLWTRGKPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGISKTDLKSFLLYCVDQFQLTALTGILTAPPTAELEPLTDGQVSQTDEADMGMTYSELSVIGRLRKISKCGPFSMFCKLIHMWKDV-LSPTEVAQKVKHFFRMYSMNRHKMTTVTPSYHAESYSPDDNRFDLRPFLYNTRWTWQFRCIDNQV 689          
BLAST of Glutamine-dependent NAD( ) synthetase vs. TrEMBL
Match: A0A3Q2QQH3 (Glutamine-dependent NAD(+) synthetase OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 394/703 (56.05%), Postives = 505/703 (71.83%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRN--CSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKT 2303
            M    T AT  LNQWALDF+GN+  I++SI++AK+  AKYR GPELE+ GYGC DHFYESDTLLHS+EV+KT+L++    DIICD+GMP+ H    YNCR++ LN KI+LIRPK ++AN  ++RE RWF+PW++   ++ Y LP  IQE+TGQ  VPFGD +L   D+CI  E C ELW+ N+P+I   L+G EI  N + S+H LRK D+R+NLI+SA  K GG+Y+Y N +GCDG+R+YYDG A++A+NG++V +  QFSL DVEV+   +DL++VR+YR   C          C   HRI +DFSL+   S N+  L   +PI      PE+EISL PA WLWD LRRS   GF LPLSGG+DSSS ACIV+ MC+ + +++  GN + L D+R+VVGD +Y P   KELC +I  TCYM+SENSS++T +RA+ LA  I S H++++ID  V   + +     GR   ++A+GGSN ENLALQNVQAR+RMVLAYL +QL LW+  + GGLLVL S N+DE L GY TKYDCSSAD+NPIG I K+DLK F+ Y    F+ A+L GIL APPTAELEPL DG++ Q DE DMGMTYSELS  G+LRK+  CGPF MF KL+ +WKD   +P+E+A+KVK FF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LYN  W+WQF CID  V  +  T
Sbjct:    1 MGRKVTLATCSLNQWALDFEGNADRILKSIEIAKVNGAKYRLGPELEICGYGCADHFYESDTLLHSFEVLKTLLDSPTTQDIICDVGMPVMHHNVRYNCRVLFLNRKILLIRPKMLMANHGIYREMRWFSPWRRLREVEEYFLPRMIQEVTGQDTVPFGDCVLSTKDSCIGTEICAELWSPNSPHIQMGLDGVEIFTNSSASHHELRKADQRVNLIKSATTKSGGIYLYANQKGCDGDRVYYDGCAMVAINGDVVARGAQFSLDDVEVITATLDLEDVRSYRGELCQQRLEGQQKPC---HRIKVDFSLS---SPNDIHLPTHQPIQWHFHTPEEEISLGPACWLWDYLRRSGQGGFLLPLSGGVDSSSTACIVHCMCVLVCQAVDDGNSQVLKDVRRVVGDESYTPQEPKELCGRIFTTCYMTSENSSQDTCSRARDLAGQIGSAHMNISIDMAVKGILGIFSVVTGRWPQFRANGGSNRENLALQNVQARVRMVLAYLFAQLSLWAHGKPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGISKSDLKSFLVYCAERFQFAALRGILAAPPTAELEPLTDGQLTQTDEADMGMTYSELSVIGRLRKISKCGPFSMFCKLIHMWKDV-FSPTEVAQKVKRFFRMYSVNRHKMTTVTPSYHAESYSPDDNRFDLRPFLYNTRWTWQFRCIDNQVSQMPTT 696          
BLAST of Glutamine-dependent NAD( ) synthetase vs. TrEMBL
Match: A0A3B4UMH5 (Glutamine-dependent NAD(+) synthetase OS=Seriola dumerili OX=41447 PE=3 SV=1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 398/697 (57.10%), Postives = 504/697 (72.31%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRN--CSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M    T AT  LNQW+LDF+GN + I++SI++AK   AKYR GPELE+ GYGC DHFYESDTLLHS++V++ +LE+    DIICD+GMPI H    YNCR++ LN KI+LIRPK ++AN   +RE RWF+PW Q   M+ Y LP  IQE+TGQ  VPFGD +L   DTCI  E C ELW   +P+ID  L+G EI  N + S+H LRK D+R+NL++SA  K GG+Y+Y N RGCDG+R+YYDG A++A+NG++V Q  QFSL DVEV+   +DL++VR+YR   C          C   HR+ +DF L+T    ++  L   +PI+     PE+EISL PA WLWD LRRS   GF LPLSGG+DSSS AC+V+SMC+ + ++++ GN + L DIR+VVGD +Y P   KELC +I  TCYM+SENSS++T+ RAK LA+ I S+H+++ ID  V   + +     GR   + A+GGS+ ENLALQNVQAR+RMVLAYL +QL LW+  R GGLLVL S N+DE L GY TKYDCSSAD+NPIG I KTDLK F+ Y   +F+L++L GIL APPTAELEPL DG+V Q DE DMGMTYSELS  G+LRK+  CGPF MF KL+ +WKD  L+P+E+A+KVKHFF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LYN  W+WQF CID  V
Sbjct:    1 MGRKVTLATCSLNQWSLDFEGNLERILKSIEIAKTHGAKYRLGPELEICGYGCADHFYESDTLLHSFQVLRKLLESPVTQDIICDVGMPIMHHNVRYNCRVLFLNRKILLIRPKMLMANHGSYREVRWFSPWNQLRKMEEYFLPRMIQEVTGQDTVPFGDCVLSTKDTCIGTEICAELWNPRSPHIDMGLDGVEIFTNSSASHHELRKADQRVNLVRSATTKSGGIYLYANQRGCDGDRVYYDGCAMVAINGDLVAQGAQFSLNDVEVITATVDLEDVRSYRGELCQPVMESEHKPC---HRVKVDFPLST---CDDFYLPTHQPIMWHFHTPEEEISLGPACWLWDYLRRSGQAGFLLPLSGGVDSSSTACLVHSMCVLLCQAVEDGNTQVLKDIRRVVGDDSYCPQQAKELCGRIFTTCYMASENSSEDTRNRAKELASQIGSSHMNINIDMAVKGILGIFSAVTGRWPQFHANGGSHRENLALQNVQARVRMVLAYLFAQLSLWASGRPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGISKTDLKGFLLYCAEQFQLSALRGILAAPPTAELEPLTDGQVSQTDEADMGMTYSELSVIGRLRKISKCGPFSMFCKLIHMWKDV-LSPTEVAQKVKHFFWMYSVNRHKMTTVTPSYHAESYSPDDNRFDLRPFLYNTHWTWQFRCIDTQV 690          
BLAST of Glutamine-dependent NAD( ) synthetase vs. TrEMBL
Match: A0A2U9BEC2 (Glutamine-dependent NAD(+) synthetase OS=Scophthalmus maximus OX=52904 GN=SMAX5B_021207 PE=3 SV=1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 399/694 (57.49%), Postives = 501/694 (72.19%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRN--CSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCID 2276
            M    T AT  LNQWALDFDGN + I+ SI++A+ R AKYR GPELE+ GYGC DHFYESDTLLHS++V++ +LE+    DIICD+GMP+ H    YNCR++ LNGKI+LIRPK ++ANK  +RE RWF+PW Q   ++ Y LP  IQE+TGQ  VPFGD +L   DTCI  E C ELW+  +P+I   L+G EI  N + S+H LRK D R++L++SA  K GGVY+Y N +GCDG+R+YYDG A++AVNG+IV Q  QFSL DVEV+   +DL++VR+YR   C  +       C   HR+ +DFSL+T    N+  L   +PI      PE+EISL PA WLWD LRRS   GF LPLSGG+DSSS ACIV+SMC+ + ++++ GN + L DIR+VVGD +Y P + KELC +I  T YM+S+NSS++T  RAK LA  I S H+++ ID  V   + +     GR   ++A+GGS  ENLALQNVQAR+RMVLAYL +QL LW+  R GGLLVL S N+DE L GY TKYDCSSAD+NPIG I KTDLK F+ Y + +F+L +L GIL APPTAELEPL DG+V Q DEVDMGMTYSELS  G+LRK+  CGPF MF KL+  WKD  L+ +++A+KVKHFF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LYN  W+WQF CID
Sbjct:    1 MGRKVTLATCSLNQWALDFDGNLERILRSIEVARTRGAKYRLGPELEICGYGCADHFYESDTLLHSFQVLRKLLESPVTRDIICDVGMPVMHHNVRYNCRVLFLNGKILLIRPKMLMANKGNYREIRWFSPWNQLRRVEEYFLPRMIQEVTGQDTVPFGDCVLSTKDTCIGTEICHELWSPRSPHIRMGLDGVEIFTNSSASHHELRKADNRVDLVKSATTKSGGVYLYANQKGCDGDRVYYDGCAMVAVNGDIVAQGAQFSLDDVEVITATVDLEDVRSYRGEECQPHMESEPKPC---HRVKVDFSLSTG---NDLYLPTHQPIRWHFHTPEEEISLGPACWLWDYLRRSGQAGFLLPLSGGVDSSSTACIVHSMCVLLCQAVEDGNSQVLGDIRRVVGDESYCPQHAKELCGRIFTTFYMASKNSSEDTCNRAKDLANQIGSTHMNINIDMAVKGILGIFSAATGRWPQFRANGGSQRENLALQNVQARVRMVLAYLFAQLSLWASGRPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGISKTDLKSFLLYCVEQFQLTALKGILAAPPTAELEPLTDGQVSQTDEVDMGMTYSELSVIGRLRKISKCGPFSMFCKLIHTWKDS-LSATQVAQKVKHFFRMYSMNRHKMTTVTPSYHAESYSPDDNRFDLRPFLYNTRWTWQFRCID 687          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Cavefish
Match: nadsyn1 (NAD synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-070615-22])

HSP 1 Score: 327.02 bits (837), Expect = 9.852e-104
Identity = 150/266 (56.39%), Postives = 190/266 (71.43%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDV 998
            M    T AT  LNQWALDFDGN + I+ SI++AK   AKYR GPELE+ GYGC DHFYESDTLLH ++V+K +LE+    DIICD+GMP+ H    YNCR++ LN KI+LIRPK +LAN    RE RWF+PW Q   ++ Y LP  IQ++TGQ  VPFGDA+L   DTCI  E C ELW   +P++D  L+G EI  N + S H LRK D R+NL++SA  K GG+Y++ N +GCDG+R+YYDG ++IA+NG+IV Q  QFSL DV
Sbjct:    1 MGRKVTLATCSLNQWALDFDGNLRRILNSIEIAKANGAKYRLGPELEICGYGCADHFYESDTLLHCFQVLKELLESPLTQDIICDVGMPVMHHNVRYNCRVLFLNKKILLIRPKMLLANHGNNREFRWFSPWSQPRHVEEYFLPRMIQDVTGQVTVPFGDAVLSTKDTCIGSEICAELWNPRSPHVDMGLDGVEIFTNSSASYHELRKADHRVNLVKSATTKSGGIYLFANQKGCDGDRLYYDGCSMIAINGDIVAQGVQFSLDDV 266          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Cavefish
Match: ENSAMXT00000045660.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001406.1:74474:84382:-1 gene:ENSAMXG00000033181.1 transcript:ENSAMXT00000045660.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 268.085 bits (684), Expect = 2.167e-82
Identity = 128/231 (55.41%), Postives = 166/231 (71.86%), Query Frame = 3
Query: 1461 MSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNR 2153
            M+SENSS++T+ RAK LAA I SNH+++ ID  V   + +     G+  N++ +GGSN ENLALQNVQAR+RM+LAYL +QL LW++ + GGLLVL S N+DE L GY TKYDCSSAD+NPIG + K DLK F+ Y  + F+L +L  IL APPTAELEPL +G+V Q DE DMGMTYSELS  GKLRK+  CGP+ MF KL+  W++   +P++ A    HF++   R R
Sbjct:    1 MASENSSEDTRNRAKELAAQIGSNHLNINIDMAVKGILGIFSVVMGKLPNFRVNGGSNRENLALQNVQARVRMILAYLFAQLCLWAQGKPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGVSKMDLKRFLQYCTDHFQLTALKSILAAPPTAELEPLTEGQVSQTDEADMGMTYSELSVIGKLRKISKCGPYSMFCKLIHSWRET-CSPTQSA----HFYLKAERVR 226          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Yeast
Match: QNS1 (Glutamine-dependent NAD(+) synthetase; essential for the formation of NAD(+) from nicotinic acid adenine dinucleotide [Source:SGD;Acc:S000001116])

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 364/700 (52.00%), Postives = 489/700 (69.86%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDL-IHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVV--GDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKN--RSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLV 2285
            M  + T AT  LNQWALDF+GN   I++SI++AK R A+ R GPELE+TGYGC DHF E+D  LHSWE+   I++N++ H +I DIGMP+ H+   YNCR++ L+G+I+ IRPK  LAN   +RE R+FTPW +  V+++++LP  IQ++TGQ+ VPFGDA++   DTCI  ETCEEL+   +P+I   L+G EI+ N +GS+H LRKL++RL+LI +A K+ GGVY+Y N RGCDG+R+YYDG ALIA+NG IV Q  QFSL DVEV+   +DL+EVR+YR    +  +     ++   RI I   L    S  +  +  ++   P    PE+EI+L PA W+WD LRR    GFFLPLSGG+DS + A IV+SMC  +  + + GN + + D+R++   GD +++P + ++L SKI  +C+M +ENSSKET+ RAK L+  I S H+D+ +D +VS+ +++     G+K  YK  GGS  ENLALQN+QAR+RMVL+YL +QL  W +    SGGLLVL S N+DECLRGYLTKYDCSSAD+NPIG I KTDLK FI+Y+  ++ +  L   L A PTAELEP+    V Q DE+DMGMTY EL  +G LRKV+ CGP+ MF+KLL  W  K LTP +I+EKVK FF  Y+ NRHK TV+TPSYH E Y+ +DNRFDLRP+L N  + W    ID++V
Sbjct:    1 MSHLITLATCNLNQWALDFEGNRDRILQSIKIAKERGARLRVGPELEITGYGCLDHFLENDVCLHSWEMYAQIIKNKETHGLILDIGMPVLHKNVRYNCRLLSLDGEILFIRPKIWLANDGNYREMRFFTPWMKPGVVEDFILPPEIQKVTGQRLVPFGDAVINSLDTCIGTETCEELFTPQSPHIAMSLDGVEIMTNSSGSHHELRKLNKRLDLILNATKRCGGVYLYANQRGCDGDRLYYDGCALIAINGTIVAQGSQFSLDDVEVVTATVDLEEVRSYRAAVMSRGLQASLAEIKFKRIDIPVELALMTSRFDPTVCPTKVREPFYHSPEEEIALGPACWMWDYLRRCNGTGFFLPLSGGIDSCATAMIVHSMCRLVTDAAQNGNEQVIKDVRKITRSGD-DWIPDSPQDLASKIFHSCFMGTENSSKETRNRAKDLSNAIGSYHVDLKMDSLVSSVVSLFEVATGKKPIYKIFGGSQIENLALQNIQARLRMVLSYLFAQLLPWVRGIPNSGGLLVLGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIAYASKQYNMPILNDFLNATPTAELEPMTKDYV-QSDEIDMGMTYEELGVFGYLRKVEKCGPYSMFLKLLHQWSPK-LTPRQISEKVKRFFFFYAINRHKQTVLTPSYHAEQYSPEDNRFDLRPFLINPRFPWASRKIDEVV 697          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Nematostella
Match: EDO33760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR86])

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 386/701 (55.06%), Postives = 504/701 (71.90%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNY-SVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEK 2300
            M    T A   +NQWALDFDGN K I++SIQLAK + A YR GPELE+ GYGC DHF+E DT+LHS++V+  +L +    DIICD+GMPI H+   YNCR+I LNGKI+LIRPK  L N   +RE RWFTPW++    + + LP  I +ITGQ  VPFGD ++  +DTCI  E CEEL++ ++ +I   L+G EI  NG+GS+H LRKLD+R+NL+ SA +K GGVY+Y+NLRGCDGER+YYDG + IAVNG++V Q  QF+LQDVEV+   +DL++V +YR  +  + +  IH      R+ +D++LT     ++  + +S  I      PE+EISL PA WLWD LRRS   GFFLPLSGG+DSSS ACIV SMC  + +S++ G+ + L D+R+VV D  Y+PT+ +EL ++I VTCYM +ENSS+ET+ RA  LA ++ S H+ + ID  VSA + +      +   +K HGGS+ ENLALQNVQAR+RM+ AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSAD+NPIG I KTDL+ FI + + ++  +SL+ IL APPTAELEPL DG++ Q DE DMGMTY ELS YG+LRK+  CGP+ MF KLL++W+D+ L   ++A KVK FF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LYNV WSWQF  ID  +  L++
Sbjct:    1 MGRKVTLAVCTINQWALDFDGNLKRILQSIQLAKAKGASYRLGPELEICGYGCNDHFFEGDTILHSFQVLAFLLNSPVTRDIICDVGMPILHKNVRYNCRVIFLNGKILLIRPKIQLCNTGNYREMRWFTPWRKMKQTEEFFLPRMISDITGQSTVPFGDGVVSTSDTCIGSEVCEELFSLDSTHIPMALDGVEIFTNGSGSHHELRKLDKRVNLVISATEKAGGVYMYSNLRGCDGERVYYDGCSFIAVNGKVVAQGAQFALQDVEVVTATVDLEDVHSYRGANMTFGAAAIHQPTSYPRVKVDYALTHD---DDLVVPLSDAIRVHYHTPEEEISLGPACWLWDYLRRSGQAGFFLPLSGGIDSSSTACIVASMCHLVCQSVRGGDTQVLEDVRRVVRDSEYIPTDPRELANRIFVTCYMGTENSSEETRKRAANLADEMGSYHLGITIDAAVSAVLTIFTAMTSKVPKFKVHGGSHTENLALQNVQARLRMIFAYLFAQLILWARGMPGGLLVLGSSNVDEGLRGYLTKYDCSSADINPIGGISKTDLRAFIFHCVEKYNFSSLITILGAPPTAELEPLSDGQIQQKDEDDMGMTYDELSLYGRLRKISWCGPYSMFTKLLDVWRDE-LRADQVANKVKFFFQTYSINRHKMTTLTPSYHAESYSPDDNRFDLRPFLYNVRWSWQFRTIDDQLQKLKQ 697          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Nematostella
Match: EDO26927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAP4])

HSP 1 Score: 236.884 bits (603), Expect = 7.064e-72
Identity = 111/197 (56.35%), Postives = 143/197 (72.59%), Query Frame = 3
Query: 1407 YMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYS 1997
            Y+PT+ +EL ++I VTCYM +ENSS+ET+ RA  LA +I S H+ + ID  VSA + +      +   +K HGGS+ ENLALQNVQAR+RM+ AYL +QL LW++   GGLLVL S N+DE LRGYLTKYDCSSAD+NPIG I KTDL+ FI + + ++  +SL+ IL APPTAELEPL DG++ Q DEV     YS
Sbjct:   14 YIPTDPRELANRIFVTCYMGTENSSEETRKRAANLADEIGSYHLGITIDAAVSAVLTIFTAMTSKVPKFKVHGGSHTENLALQNVQARLRMIFAYLFAQLILWARGMPGGLLVLGSSNVDEGLRGYLTKYDCSSADINPIGGISKTDLRAFIFHCVEKYNFSSLITILGAPPTAELEPLADGQIQQKDEVSHTDKYS 210          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Medaka
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:101158072])

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 386/699 (55.22%), Postives = 502/699 (71.82%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLE 2297
            M    T AT  LNQW LDF+GN++ I+ S++ AK   AKYR GPELE+ GYGC DHFYESDTLLHS++ +K +LE+    DIICD+GMP+ H    YNCR++ LN KI+LIRPK ++AN  V+RE RWF+PW +   +++Y LP  IQE+TGQ  VPFGD +L   DTCI  E C ELW  ++P+I    +G EI  N + S+H LRK D+R++LI+SA  K GG+Y+Y N RGCDG+R+YYDG A++AVNG++V + +QFSL DVEV+   +DL++VR+YR      ++       + R+ +DFSL+T    ++  L   +P+      PE+EISL PA WLWD LRRS   GF LPLSGG+DSSS ACIV+SMC  +  ++  GN + L D+R+VVGD +Y P + KELC ++  TCYMSSENSS++T++RA+ LAA I S H++ +ID  V   + +     G    ++A GGS+ ENLALQNVQAR+RMVLAYL +QL LW++ R GGLLVL S N+DE L GY TKYDCSSAD+NPIG I KTDL+ F+ Y  + F+L++L GIL+APPTAELEPL DG+V Q DE DMGMTYSELS  G+LRK+  CGPF MF KL++ WKD  L+P+E+A+KVK FF  YS NRHKMT +TPSYH ESY+ DDNRFDLRP+LY+  W WQF  ID+ +  LE
Sbjct:    1 MGRKVTVATCALNQWVLDFEGNTERILRSVEAAKAGGAKYRLGPELEICGYGCADHFYESDTLLHSFQALKVLLESPVTQDIICDVGMPVMHHNVRYNCRVLFLNRKILLIRPKMLMANSGVYREMRWFSPWNRPRHVEDYFLPRMIQEVTGQDTVPFGDCVLSTKDTCIGTEMCAELWNPDSPHIHMGRDGVEIFTNSSASHHELRKADQRVHLIRSATAKTGGIYLYANQRGCDGDRVYYDGCAMVAVNGDVVARGDQFSLDDVEVVTATLDLEDVRSYRGEHLQPAMKSETQAFL-RVKVDFSLSTS---DDVFLPTQQPLQWRFHTPEEEISLGPACWLWDYLRRSGQAGFLLPLSGGVDSSSTACIVHSMCTLLCAAVADGNLQVLEDVRRVVGDTSYDPQDPKELCGRVFTTCYMSSENSSEDTRSRARELAAQIGSTHLNFSIDAAVKGILGIFSAVTGHWPCFRARGGSHRENLALQNVQARVRMVLAYLFAQLSLWARGRPGGLLVLGSANVDESLTGYFTKYDCSSADINPIGGISKTDLRGFLRYCADRFQLSALDGILKAPPTAELEPLTDGQVSQTDEADMGMTYSELSVIGRLRKISKCGPFSMFCKLIQAWKDV-LSPAEVAQKVKRFFRMYSVNRHKMTTVTPSYHAESYSPDDNRFDLRPFLYDTRWRWQFKTIDEQLSQLE 694          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Medaka
Match: nadsyn1 (NAD synthetase 1 [Source:NCBI gene;Acc:101158072])

HSP 1 Score: 330.102 bits (845), Expect = 1.101e-104
Identity = 146/266 (54.89%), Postives = 193/266 (72.56%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDV 998
            M    T AT  LNQW LDF+GN++ I+ S++ AK   AKYR GPELE+ GYGC DHFYESDTLLHS++ +K +LE+    DIICD+GMP+ H    YNCR++ LN KI+LIRPK ++AN  V+RE RWF+PW +   +++Y LP  IQE+TGQ  VPFGD +L   DTCI  E C ELW  ++P+I    +G EI  N + S+H LRK D+R++LI+SA  K GG+Y+Y N RGCDG+R+YYDG A++AVNG++V + +QFSL DV
Sbjct:    1 MGRKVTVATCALNQWVLDFEGNTERILRSVEAAKAGGAKYRLGPELEICGYGCADHFYESDTLLHSFQALKVLLESPVTQDIICDVGMPVMHHNVRYNCRVLFLNRKILLIRPKMLMANSGVYREMRWFSPWNRPRHVEDYFLPRMIQEVTGQDTVPFGDCVLSTKDTCIGTEMCAELWNPDSPHIHMGRDGVEIFTNSSASHHELRKADQRVHLIRSATAKTGGIYLYANQRGCDGDRVYYDGCAMVAVNGDVVARGDQFSLDDV 266          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Planmine SMEST
Match: SMESG000004423.1 (SMESG000004423.1)

HSP 1 Score: 1417.91 bits (3669), Expect = 0.000e+0
Identity = 699/702 (99.57%), Postives = 699/702 (99.57%), Query Frame = 3
Query:  201 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRXXXXXXXXXEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKTC 2306
            MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDII DIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRPIIPTIIPPEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGD NYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDK LTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKTC
Sbjct:    1 MKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRAGPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIILDIGMPIGHRGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYLLPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNGAEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYYDGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNIHGCDLIHRIPIDFSLTTQFSYNNSKLKISRPIIPTIIPPEKEISLAPALWLWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLADIRQVVGDPNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADINSNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIRMVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPIGSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEVDMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKQLTPSEIAEKVKHFFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCIDKLVFTLEKTC 702          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Planmine SMEST
Match: SMESG000045343.1 (SMESG000045343.1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.297e-10
Identity = 45/105 (42.86%), Postives = 55/105 (52.38%), Query Frame = 2
Query: 2456 VNAKCKDEY*RLRYDEWVFLRSKCY-------CMKVKVISMKDTKLTHQLIQNCYY-NKIYNVS---------LAL*YKNNKRALAN-ADKRK*MEVNNSYVYGH 2716
            V  K KDE     YDEWVFLR KCY       C+K K IS+KDT LTH+  + CY  N +++V              +KN+K AL N  DKR  +  N S  YGH
Sbjct:  629 VIGKFKDESKGEGYDEWVFLRPKCYSLLGKSSCLKAKGISLKDTDLTHKTYKECYEKNSVFSVPQFRIGSKNHQLYSFKNSKVALTNRDDKRVWVGKNKSLAYGH 733          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Planmine SMEST
Match: SMESG000032351.1 (SMESG000032351.1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.425e-10
Identity = 45/105 (42.86%), Postives = 55/105 (52.38%), Query Frame = 2
Query: 2456 VNAKCKDEY*RLRYDEWVFLRSKCY-------CMKVKVISMKDTKLTHQLIQNCYY-NKIYNVS---------LAL*YKNNKRALAN-ADKRK*MEVNNSYVYGH 2716
            V  K KDE     YDEWVFLR KCY       C+K K IS+KDT LTH+  + CY  N +++V              +KN+  ALAN  DKR  +  N S  YGH
Sbjct:  867 VIGKFKDESKGEGYDEWVFLRPKCYSLLGKSSCLKAKGISLKDTDLTHKSYKECYEKNSVFSVPQFRIERKNHQLYSFKNSNVALANRDDKRVWVGKNKSLAYGH 971          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Planmine SMEST
Match: SMESG000076702.1 (SMESG000076702.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.445e-9
Identity = 44/106 (41.51%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 2456 VNAKCKDEY*RLRYDEWVFLRSKCY-------CMKVKVISMKDTKLTHQLIQNCYY-NKIYNVS---------LAL*YKNNKRALAN-ADKRK*MEVNNSYVYGHY 2719
            V  K KDE     YDEWVFLR KCY       C+K K +++KDT LTH+  ++CY  N  ++V              +K +K AL N  DKR  +E N S  YGHY
Sbjct: 1022 VIGKFKDESKGEGYDEWVFLRPKCYSLLGKSKCLKAKGVTLKDTTLTHKSYKDCYEKNSTFSVPQFRIGTSNHQLYSFKTSKVALTNKEDKRVWVEKNVSLAYGHY 1127          
BLAST of Glutamine-dependent NAD( ) synthetase vs. Planmine SMEST
Match: SMESG000076702.1 (SMESG000076702.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.476e-9
Identity = 44/106 (41.51%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 2456 VNAKCKDEY*RLRYDEWVFLRSKCY-------CMKVKVISMKDTKLTHQLIQNCYY-NKIYNVS---------LAL*YKNNKRALAN-ADKRK*MEVNNSYVYGHY 2719
            V  K KDE     YDEWVFLR KCY       C+K K +++KDT LTH+  ++CY  N  ++V              +K +K AL N  DKR  +E N S  YGHY
Sbjct: 1076 VIGKFKDESKGEGYDEWVFLRPKCYSLLGKSKCLKAKGVTLKDTTLTHKSYKDCYEKNSTFSVPQFRIGTSNHQLYSFKTSKVALTNKEDKRVWVEKNVSLAYGHY 1181          
The following BLAST results are available for this feature:
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NADSYN10.000e+054.49NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:2983... [more]
NADSYN11.898e-13057.49NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:2983... [more]
NADSYN13.690e-10154.89NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:2983... [more]
NADSYN13.574e-9050.97NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:2983... [more]
NADSYN14.141e-4752.35NAD synthetase 1 [Source:HGNC Symbol;Acc:HGNC:2983... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
qns-10.000e+043.65Glutamine-dependent NAD(+) synthetase [Source:Uni... [more]
qns-18.678e-16642.90Glutamine-dependent NAD(+) synthetase [Source:Uni... [more]
qns-18.678e-16642.90Glutamine-dependent NAD(+) synthetase [Source:Uni... [more]
qns-12.296e-8651.07Glutamine-dependent NAD(+) synthetase [Source:Uni... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nadsyn0.000e+051.87gene:FBgn0030512 transcript:FBtr0073844[more]
Nadsyn0.000e+051.87gene:FBgn0030512 transcript:FBtr0343352[more]
Nadsyn0.000e+051.87gene:FBgn0030512 transcript:FBtr0073845[more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nadsyn10.000e+053.35NAD synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-070615-... [more]
nadsyn17.853e-5656.86NAD synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-070615-... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nadsyn10.000e+056.57NAD synthetase 1 [Source:NCBI gene;Acc:100145482][more]
nadsyn10.000e+056.69NAD synthetase 1 [Source:NCBI gene;Acc:100145482][more]
nadsyn10.000e+056.69NAD synthetase 1 [Source:NCBI gene;Acc:100145482][more]
nadsyn10.000e+054.77NAD synthetase 1 [Source:NCBI gene;Acc:100145482][more]
nadsyn10.000e+055.09NAD synthetase 1 [Source:NCBI gene;Acc:100145482][more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nadsyn10.000e+054.86NAD synthetase 1 [Source:MGI Symbol;Acc:MGI:192616... [more]
Nadsyn10.000e+052.83NAD synthetase 1 [Source:MGI Symbol;Acc:MGI:192616... [more]
Nadsyn13.429e-2841.84NAD synthetase 1 [Source:MGI Symbol;Acc:MGI:192616... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZMA6|NADE_CHICK0.000e+056.43Glutamine-dependent NAD(+) synthetase OS=Gallus ga... [more]
sp|Q4R5Y2|NADE_MACFA0.000e+054.78Glutamine-dependent NAD(+) synthetase OS=Macaca fa... [more]
sp|Q711T7|NADE_MOUSE0.000e+054.86Glutamine-dependent NAD(+) synthetase OS=Mus muscu... [more]
sp|Q3ZBF0|NADE_BOVIN0.000e+054.51Glutamine-dependent NAD(+) synthetase OS=Bos tauru... [more]
sp|Q6IA69|NADE_HUMAN0.000e+054.49Glutamine-dependent NAD(+) synthetase OS=Homo sapi... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W6CZ160.000e+057.68Glutamine-dependent NAD(+) synthetase OS=Lates cal... [more]
A0A2I4ANB00.000e+057.25Glutamine-dependent NAD(+) synthetase OS=Austrofun... [more]
A0A3Q2QQH30.000e+056.05Glutamine-dependent NAD(+) synthetase OS=Fundulus ... [more]
A0A3B4UMH50.000e+057.10Glutamine-dependent NAD(+) synthetase OS=Seriola d... [more]
A0A2U9BEC20.000e+057.49Glutamine-dependent NAD(+) synthetase OS=Scophthal... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nadsyn19.852e-10456.39NAD synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-070615-... [more]
ENSAMXT00000045660.12.167e-8255.41pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
QNS10.000e+052.00Glutamine-dependent NAD(+) synthetase; essential f... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO337600.000e+055.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269277.064e-7256.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nadsyn10.000e+055.22NAD synthetase 1 [Source:NCBI gene;Acc:101158072][more]
nadsyn11.101e-10454.89NAD synthetase 1 [Source:NCBI gene;Acc:101158072][more]
back to top
BLAST of Glutamine-dependent NAD( ) synthetase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004423.10.000e+099.57SMESG000004423.1[more]
SMESG000045343.13.297e-1042.86SMESG000045343.1[more]
SMESG000032351.17.425e-1042.86SMESG000032351.1[more]
SMESG000076702.11.445e-941.51SMESG000076702.1[more]
SMESG000076702.11.476e-941.51SMESG000076702.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002295 ID=SMED30002295|Name=Glutamine-dependent NAD( ) synthetase|organism=Schmidtea mediterranea sexual|type=transcript|length=3078bp
GTCATATTGAATCATATAAACTTTTTAAAAATATTATTATAGAATTATAT
AATTTTGGCTATTTATCAATTAAATAAAATTTTCTTTTAATTATTACAGA
CATTAATGCTAAAAATTAAACTAATTTATTTATCCAATATTGTCATTACT
AAATTTAAAATTTTTTTGATGTTTATATGATTCAATATGACTATTTAAAA
ATGAAAAGTGTTTGCACATTTGCTACTTCTGTTTTAAATCAATGGGCTTT
AGATTTTGATGGTAATTCCAAAAACATAATTGAAAGTATTCAATTAGCAA
AGTTACGAAATGCAAAATATCGTGCTGGTCCAGAATTAGAAGTAACTGGA
TATGGATGTGGTGATCATTTCTATGAATCTGACACGTTGTTACATTCATG
GGAAGTTATGAAAACAATTTTGGAAAATGAAGATTGTCACGATATTATTT
GTGATATTGGAATGCCAATTGGTCACAGAGGTGCAATTTACAATTGTCGC
ATAATTTTATTGAATGGAAAAATTATTTTAATTCGACCGAAACAAGTTCT
AGCGAATAAAGAAGTGTTTCGCGAGAGCCGTTGGTTTACTCCTTGGCAAC
AAAAATTCGTTATGGACAACTATTTATTACCGGATTTTATTCAAGAAATC
ACTGGACAGAAACAAGTTCCATTCGGAGATGCGTTGTTGTGTTTAAATGA
CACATGTATTGCAATTGAAACTTGTGAAGAGTTGTGGGCACAAAACGCTC
CGAATATTGATTATTATCTAAATGGGGCGGAAATTATTTTCAATGGAAAT
GGCAGTAACCATATTTTAAGGAAATTGGATAGGAGATTGAATTTAATCCA
ATCAGCATGCAAAAAAATCGGCGGGGTTTATGTGTACACAAATTTACGAG
GATGCGACGGAGAACGAATTTATTATGACGGAGGAGCACTGATTGCTGTA
AATGGGGAAATTGTCGGTCAGAGTGAACAATTTAGCTTGCAAGACGTTGA
AGTGTTAGTGGGAAACATTGATTTGGACGAAGTTCGCACTTATAGGAATT
GCAGTTCAAACTACAGTGTGAACATTCACGGATGCGATCTGATTCATCGA
ATTCCTATCGATTTCTCGTTGACAACTCAGTTTTCTTACAACAATTCGAA
ATTGAAAATTTCCCGTCCAATAATTCCGACAATAATTCCCCCGGAAAAAG
AGATCAGTTTAGCGCCTGCGTTGTGGTTGTGGGATAATTTGCGCCGATCG
AAACTCAATGGATTCTTTCTTCCATTGAGCGGTGGATTGGACAGTTCCAG
CGTTGCCTGCATCGTCTACTCAATGTGCATCGAAATCGTCAAATCGATCA
AGCTCGGCAACAGAAAAACTCTCGCTGATATTCGACAAGTTGTCGGTGAT
CTGAACTACATGCCGACCAATGAGAAAGAGTTGTGCTCGAAAATCCTCGT
CACCTGTTACATGAGCTCGGAAAACAGTTCTAAAGAAACGAAAACCCGAG
CGAAATGTTTGGCGGCCGATATAAACTCCAATCACATCGATGTTGCAATC
GATCAGATCGTGTCGGCATTCATTGCTGTCGTGTTGTGTTGTTTCGGTAG
GAAGCTGAATTACAAAGCACACGGCGGCTCGAATGCCGAGAATTTGGCCC
TTCAAAATGTACAGGCGAGGATCCGAATGGTGCTGGCGTATTTATTGAGC
CAATTGTATTTGTGGTCGAAAAATCGATCAGGCGGCCTCCTGGTGCTGGC
TTCGGGTAATCTTGACGAATGTTTGAGGGGTTACTTGACCAAGTATGACT
GCAGCAGTGCTGATTTGAATCCGATTGGCTCGATTTGTAAGACGGATTTA
AAACTATTCATCTCGTATTCGATCAATGAATTTGAATTGGCGAGCTTGGT
AGGGATTCTAGAGGCGCCTCCGACAGCCGAATTGGAGCCTTTGAAGGATG
GCAAAGTGTGCCAAATCGACGAGGTCGACATGGGAATGACATATTCGGAA
TTGTCTGAGTATGGAAAGTTGCGAAAGGTGAAATGTTGCGGGCCTTTTGG
AATGTTTATAAAGCTGCTGGAAATTTGGAAAGATAAACCACTAACTCCCA
GTGAAATCGCTGAGAAAGTCAAACACTTTTTCATATGCTATTCTAGAAAC
CGTCACAAAATGACCGTTATAACCCCATCATATCATGTTGAGTCGTATAA
TTGTGATGACAACCGATTTGATTTGAGGCCTTATCTGTATAACGTGGATT
GGAGCTGGCAATTTGGTTGCATAGATAAATTGGTTTTTACTCTAGAAAAA
ACTTGTTTTTAGATTTTGAACTTTATATTTTTGTTATTTATAATTTTTAA
GGTTTTATAGTCAACATAGAGTATCAGTAATTTAGAATTCCAGGTCGTTT
GTTACACTTATGTTGTCTTGTTAATAAAGGTTTTTGAAATTTGATGCGAA
GAATTGTTAATGCCAAATGCAAAGACGAGTACTAGAGACTTCGATATGAT
GAATGGGTATTTTTAAGATCTAAATGTTATTGTATGAAAGTGAAAGTGAT
TTCAATGAAGGATACTAAACTAACCCATCAGTTGATTCAGAATTGTTATT
ATAATAAAATTTATAATGTGTCGCTAGCTTTATAGTATAAAAATAATAAG
AGGGCATTAGCTAATGCTGATAAACGCAAATAAATGGAGGTCAATAACAG
TTACGTATATGGGCATTATAGAGAGTGGTACAAATGAAAGGCTATTGATT
ATTGATCCAGGTGAAAGTTAGTTTATTATACCATGCAGATTTTTTCGGAG
AATGAAGAATTCATGTTTCAATGAAGATTATTATAACTCCAAGGATTATT
TTTTCGTAGCCATTTATTCTTACATCAATGTGTATTTATGGAGCCTTAAT
CACTCAGTGAATTAAACAACAAGAACTAAATATATCGAAAAAAAGTGTTA
CTGACTGGTGATGATTTCATGACCTTCGTTATTGTCAAATCTATGGTGAT
TATCGCGTGTAAACAAATTTTTTGTAAATTTCATTTCGTTATTTGAAAAT
CTAGTTTACATTGTGTTTTGTACAAGAG
back to top

protein sequence of SMED30002295-orf-1

>SMED30002295-orf-1 ID=SMED30002295-orf-1|Name=SMED30002295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=712bp
MIQYDYLKMKSVCTFATSVLNQWALDFDGNSKNIIESIQLAKLRNAKYRA
GPELEVTGYGCGDHFYESDTLLHSWEVMKTILENEDCHDIICDIGMPIGH
RGAIYNCRIILLNGKIILIRPKQVLANKEVFRESRWFTPWQQKFVMDNYL
LPDFIQEITGQKQVPFGDALLCLNDTCIAIETCEELWAQNAPNIDYYLNG
AEIIFNGNGSNHILRKLDRRLNLIQSACKKIGGVYVYTNLRGCDGERIYY
DGGALIAVNGEIVGQSEQFSLQDVEVLVGNIDLDEVRTYRNCSSNYSVNI
HGCDLIHRIPIDFSLTTQFSYNNSKLKISRPIIPTIIPPEKEISLAPALW
LWDNLRRSKLNGFFLPLSGGLDSSSVACIVYSMCIEIVKSIKLGNRKTLA
DIRQVVGDLNYMPTNEKELCSKILVTCYMSSENSSKETKTRAKCLAADIN
SNHIDVAIDQIVSAFIAVVLCCFGRKLNYKAHGGSNAENLALQNVQARIR
MVLAYLLSQLYLWSKNRSGGLLVLASGNLDECLRGYLTKYDCSSADLNPI
GSICKTDLKLFISYSINEFELASLVGILEAPPTAELEPLKDGKVCQIDEV
DMGMTYSELSEYGKLRKVKCCGPFGMFIKLLEIWKDKPLTPSEIAEKVKH
FFICYSRNRHKMTVITPSYHVESYNCDDNRFDLRPYLYNVDWSWQFGCID
KLVFTLEKTCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR003694NAD_synthase
IPR036526C-N_Hydrolase_sf
IPR022310NAD/GMP_synthase
IPR014729Rossmann-like_a/b/a_fold
IPR014445Gln-dep_NAD_synthase
IPR003010C-N_Hydrolase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003952NAD+ synthase (glutamine-hydrolyzing) activity
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0000166nucleotide binding
GO:0004359glutaminase activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0009435NAD biosynthetic process
GO:0006807nitrogen compound metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 339..703
e-value: 1.2E-125
score: 421.0
IPR022310NAD/GMP synthasePFAMPF02540NAD_synthasecoord: 349..615
e-value: 1.6E-24
score: 86.4
IPR003694NAD(+) synthetaseTIGRFAMTIGR00552TIGR00552coord: 422..617
e-value: 2.1E-20
score: 70.9
IPR003694NAD(+) synthetasePANTHERPTHR23090NH 3 /GLUTAMINE-DEPENDENT NAD + SYNTHETASEcoord: 13..703
IPR003694NAD(+) synthetaseCDDcd00553NAD_synthasecoord: 340..662
e-value: 5.3784E-79
score: 250.542
IPR003010Carbon-nitrogen hydrolasePFAMPF00795CN_hydrolasecoord: 20..290
e-value: 1.2E-27
score: 96.9
IPR003010Carbon-nitrogen hydrolasePROSITEPS50263CN_HYDROLASEcoord: 13..283
score: 34.468
IPR036526Carbon-nitrogen hydrolase superfamilyGENE3DG3DSA:3.60.110.10coord: 11..296
e-value: 7.4E-75
score: 253.4
IPR036526Carbon-nitrogen hydrolase superfamilySUPERFAMILYSSF56317Carbon-nitrogen hydrolasecoord: 16..292
IPR014445Glutamine-dependent NAD(+) synthetasePIRSFPIRSF006630NADS_GATcoord: 10..696
e-value: 5.2E-151
score: 501.5
NoneNo IPR availablePANTHERPTHR23090:SF9GLUTAMINE-DEPENDENT NAD(+) SYNTHETASEcoord: 13..703
NoneNo IPR availableCDDcd07570GAT_Gln-NAD-synthcoord: 16..296
e-value: 1.06628E-86
score: 271.265
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 339..674