formimidoyltransferase-cyclodeaminase

Overview
Nameformimidoyltransferase-cyclodeaminase
Smed IDSMED30002286
Length (bp)1999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of formimidoyltransferase-cyclodeaminase (SMED30002286) t-SNE clustered cells

Violin plots show distribution of expression levels for formimidoyltransferase-cyclodeaminase (SMED30002286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of formimidoyltransferase-cyclodeaminase (SMED30002286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for formimidoyltransferase-cyclodeaminase (SMED30002286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002286SMESG000070969.1 SmedASXL_012912SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30002286SMESG000070969.1 dd_Smed_v4_7815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002286SMESG000070969.1 dd_Smed_v4_7815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30002286SMESG000070969.1 dd_Smed_v4_7815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002286SMESG000070969.1 dd_Smed_v6_7815_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30002286SMESG000070969.1 SMESG000057810.1 SMESG000052981.1 OX_Smed_1.0.20232ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30002286SMESG000070969.1 dd_Smed_v4_7815_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002286SMESG000070969.1 dd_Smed_v4_7815_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Human
Match: FTCD (formimidoyltransferase cyclodeaminase [Source:HGNC Symbol;Acc:HGNC:3974])

HSP 1 Score: 346.28 bits (887), Expect = 6.929e-111
Identity = 193/506 (38.14%), Postives = 299/506 (59.09%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG++++VI+  S AI+   G +L+DVD+ P+ NRTV+ FVG    V+E ALN +R A  LID+S+H+G  PR+G +  CPF+P++   V++C+  A  F  +LAEE+  PVY+YGE+   + R+T +  +   EYE L  K+ + +  PDFG + FVP WGAT  GARKFL+ FNINLLGTKEQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +++     A E++  V+GSQ+VG VPL  LL  A    E E L +L+++Q+IRLV+ +LGL+SL PF+PKE++IEY+V       G  S           +L  F+  V AR++ PG GSVA+  + +GA+L +M GL++YG   +     +  +R+LIP   + S KL   +D  A     Y +    P  + ++K  +     + L R +     + E + +LW  + EL+   + +   +L++A   +   + G ++ +L
Sbjct:    7 CVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRT-LPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSK----------SLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYG--RRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Human
Match: FTCD (formimidoyltransferase cyclodeaminase [Source:HGNC Symbol;Acc:HGNC:3974])

HSP 1 Score: 346.28 bits (887), Expect = 6.929e-111
Identity = 193/506 (38.14%), Postives = 299/506 (59.09%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG++++VI+  S AI+   G +L+DVD+ P+ NRTV+ FVG    V+E ALN +R A  LID+S+H+G  PR+G +  CPF+P++   V++C+  A  F  +LAEE+  PVY+YGE+   + R+T +  +   EYE L  K+ + +  PDFG + FVP WGAT  GARKFL+ FNINLLGTKEQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +++     A E++  V+GSQ+VG VPL  LL  A    E E L +L+++Q+IRLV+ +LGL+SL PF+PKE++IEY+V       G  S           +L  F+  V AR++ PG GSVA+  + +GA+L +M GL++YG   +     +  +R+LIP   + S KL   +D  A     Y +    P  + ++K  +     + L R +     + E + +LW  + EL+   + +   +L++A   +   + G ++ +L
Sbjct:    7 CVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRT-LPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSK----------SLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYG--RRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Human
Match: FTCD (formimidoyltransferase cyclodeaminase [Source:HGNC Symbol;Acc:HGNC:3974])

HSP 1 Score: 346.28 bits (887), Expect = 1.647e-110
Identity = 193/506 (38.14%), Postives = 299/506 (59.09%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG++++VI+  S AI+   G +L+DVD+ P+ NRTV+ FVG    V+E ALN +R A  LID+S+H+G  PR+G +  CPF+P++   V++C+  A  F  +LAEE+  PVY+YGE+   + R+T +  +   EYE L  K+ + +  PDFG + FVP WGAT  GARKFL+ FNINLLGTKEQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +++     A E++  V+GSQ+VG VPL  LL  A    E E L +L+++Q+IRLV+ +LGL+SL PF+PKE++IEY+V       G  S           +L  F+  V AR++ PG GSVA+  + +GA+L +M GL++YG   +     +  +R+LIP   + S KL   +D  A     Y +    P  + ++K  +     + L R +     + E + +LW  + EL+   + +   +L++A   +   + G ++ +L
Sbjct:    7 CVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRT-LPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSK----------SLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYG--RRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Human
Match: FTCD (formimidoyltransferase cyclodeaminase [Source:HGNC Symbol;Acc:HGNC:3974])

HSP 1 Score: 330.487 bits (846), Expect = 1.898e-106
Identity = 179/420 (42.62%), Postives = 263/420 (62.62%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHA 1380
            C PN SEG++++VI+  S AI+   G +L+DVD+ P+ NRTV+ FVG    V+E ALN +R A  LID+S+H+G  PR+G +  CPF+P++   V++C+  A  F  +LAEE+  PVY+YGE+   + R+T +  +   EYE L  K+ + +  PDFG + FVP WGAT  GARKFL+ FNINLLGTKEQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +++     A E++  V+GSQ+VG VPL  LL  A    E E L +L+++Q+IRLV+ +LGL+SL PF+PKE++IEY+V       G  S           +L  F+  V AR++ PG GSVA+  + +GA+L +M GL++YG   +     +  +R+LIP   + S KL   +D  A
Sbjct:    7 CVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRT-LPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSK----------SLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYG--RRQFQSLDTTMRRLIPPFREASAKLTTLVDADA 413          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Human
Match: FTCD (formimidoyltransferase cyclodeaminase [Source:HGNC Symbol;Acc:HGNC:3974])

HSP 1 Score: 330.487 bits (846), Expect = 1.898e-106
Identity = 179/420 (42.62%), Postives = 263/420 (62.62%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHA 1380
            C PN SEG++++VI+  S AI+   G +L+DVD+ P+ NRTV+ FVG    V+E ALN +R A  LID+S+H+G  PR+G +  CPF+P++   V++C+  A  F  +LAEE+  PVY+YGE+   + R+T +  +   EYE L  K+ + +  PDFG + FVP WGAT  GARKFL+ FNINLLGTKEQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +++     A E++  V+GSQ+VG VPL  LL  A    E E L +L+++Q+IRLV+ +LGL+SL PF+PKE++IEY+V       G  S           +L  F+  V AR++ PG GSVA+  + +GA+L +M GL++YG   +     +  +R+LIP   + S KL   +D  A
Sbjct:    7 CVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRT-LPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSK----------SLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYG--RRQFQSLDTTMRRLIPPFREASAKLTTLVDADA 413          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Zebrafish
Match: ftcd (formimidoyltransferase cyclodeaminase [Source:ZFIN;Acc:ZDB-GENE-030131-9643])

HSP 1 Score: 357.451 bits (916), Expect = 3.101e-115
Identity = 195/506 (38.54%), Postives = 315/506 (62.25%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEGR+K+VI+  ++AIS+ +G  L+DVD   + NRTV+ FVG+ ++VIE ALN +R A+ LID++KH G  PR G +  CPF+P++N  + +C++ ANEF  +LA+ +  PVY+YGE+   E R++ +  +   EYE L DK+ K E  P+FG A FVP WGAT+ GARKFLV +N+NLL TKEQA  I+  + E      +    + +Q  GW+ +E N+AQ+S NI+DFE TP+H +++     A ++N  V+GSQIVG +PL  +L  A+  ++ EKL +++++ KIRLVI KLGL+SL PF+PKE++IEY+V+ ++++            L++L+L  F+ +V AR + PG GSV++ ++ +GA+L  M G ++YG   Q ++   E +RKLIP  H+    LL  +D  +     Y      P  +  + + ++E   + L+  +     + E ++ LW  I E+    + +   ++++A   + TA+ G ++ ++
Sbjct:   17 CVPNFSEGRNKEVIDAIANAISATEGCSLLDVDPGSSTNRTVYTFVGSPTTVIEGALNAARVAFKLIDMTKHSGEHPRTGAMDVCPFIPVQNVTMEECVQCANEFGQRLADMLHVPVYLYGEAARKESRRS-LPSVRAGEYEALPDKLKKSEWAPEFGPATFVPSWGATVTGARKFLVAYNVNLLSTKEQAHRIALDIREQGRSKDQPGLLKKVQGMGWYLEESNLAQVSTNILDFELTPMHTVYEEICRDAKDLNLPVVGSQIVGLIPLKAMLDCADFYIKREKLFVVEEEHKIRLVISKLGLDSLGPFDPKERIIEYMVQNNQDD----------GRLVSLSLQKFVHSVGARTAAPGGGSVSAAIAAMGAALGCMVGQMTYGK-RQFESLDGE-MRKLIPPFHEAMNDLLLKVDADSTAFNSYMAALKMPKGTTDEIKRREEAMQEGLKAAVRVPLSLAERINTLWPHIKEMVKYGNVACKSDIQVAAKALETAVYGAYFNVI 509          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Zebrafish
Match: zgc:153901 (zgc:153901 [Source:ZFIN;Acc:ZDB-GENE-060929-820])

HSP 1 Score: 75.8702 bits (185), Expect = 1.075e-14
Identity = 58/195 (29.74%), Postives = 98/195 (50.26%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSV-----DGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVN--KCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINL 672
            + C  NISE R KD++ET + SAI+ +     +GV ++++ +    NR+V   V N   + EA L+    A +LID+S H+G  P +G +   P  P+  EDV    C E A   A+ LAE V     +++G + + + R          E       ++   +KPD G ++   ++G T VGA  +++  N+ +
Sbjct:   11 VACLLNISEARRKDLVETVARSAITDIKGEKREGVTVLNIFNDSDYNRSVITVVANIELIREAVLSACECACSLIDMSVHEGIHPCMGAVDLVPLYPL-GEDVGLQDCGEEAQALALTLAERVAGTSAFLFGWADSPQHRGLA---QRRKEIGWFRKVLNVSNIKPDIG-SQPTRRYGITGVGASPYVMNCNVTI 200          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Zebrafish
Match: zgc:153901 (zgc:153901 [Source:ZFIN;Acc:ZDB-GENE-060929-820])

HSP 1 Score: 75.8702 bits (185), Expect = 1.802e-14
Identity = 58/195 (29.74%), Postives = 98/195 (50.26%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSV-----DGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVN--KCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINL 672
            + C  NISE R KD++ET + SAI+ +     +GV ++++ +    NR+V   V N   + EA L+    A +LID+S H+G  P +G +   P  P+  EDV    C E A   A+ LAE V     +++G + + + R          E       ++   +KPD G ++   ++G T VGA  +++  N+ +
Sbjct:   11 VACLLNISEARRKDLVETVARSAITDIKGEKREGVTVLNIFNDSDYNRSVITVVANIELIREAVLSACECACSLIDMSVHEGIHPCMGAVDLVPLYPL-GEDVGLQDCGEEAQALALTLAERVAGTSAFLFGWADSPQHRGLA---QRRKEIGWFRKVLNVSNIKPDIG-SQPTRRYGITGVGASPYVMNCNVTI 200          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Zebrafish
Match: zgc:153901 (zgc:153901 [Source:ZFIN;Acc:ZDB-GENE-060929-820])

HSP 1 Score: 75.8702 bits (185), Expect = 1.802e-14
Identity = 58/195 (29.74%), Postives = 98/195 (50.26%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSV-----DGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVN--KCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINL 672
            + C  NISE R KD++ET + SAI+ +     +GV ++++ +    NR+V   V N   + EA L+    A +LID+S H+G  P +G +   P  P+  EDV    C E A   A+ LAE V     +++G + + + R          E       ++   +KPD G ++   ++G T VGA  +++  N+ +
Sbjct:   11 VACLLNISEARRKDLVETVARSAITDIKGEKREGVTVLNIFNDSDYNRSVITVVANIELIREAVLSACECACSLIDMSVHEGIHPCMGAVDLVPLYPL-GEDVGLQDCGEEAQALALTLAERVAGTSAFLFGWADSPQHRGLA---QRRKEIGWFRKVLNVSNIKPDIG-SQPTRRYGITGVGASPYVMNCNVTI 200          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Xenopus
Match: clock (clock circadian regulator [Source:Xenbase;Acc:XB-GENE-495448])

HSP 1 Score: 359.377 bits (921), Expect = 5.265e-116
Identity = 201/506 (39.72%), Postives = 311/506 (61.46%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG++K+VI+  ++AI+   G  L+DVD   + NRTV+ FVG+  +V+E ALN +R A+ +ID+ KHKG  PR+G +  CPF+P++N  + +C+  AN+FA +LA+E+  PVY+YGE+   E R+T +  +   EYE L  K+   E  PDFG   FVP WGAT+ GARKFL+ +NINLL TKE A  I+  + E      +  +   IQ  GWF  E N+AQ+S N++DFE TP+H +++     A E+   VIGSQ+VG VPL  LL +AE  ++ EKL +L+++ KIRLVI +LGL+SL+PF+P++++IEY+V+              E++L+  +L  F+Q+V AR++TPG GSVA+ VS LGA+L  M G ++YG       D    +R+LIP  H  + KLL  +D  +     Y      P  + +++  +     + L+  ++    + E ++NLW P+LE+S   + +   +L++A   + T + G ++ +L
Sbjct:    7 CVPNFSEGKNKEVIDALAAAITQTGGCRLLDVDPGASTNRTVYTFVGSPEAVVEGALNAARVAFQMIDMRKHKGEHPRMGALDVCPFIPVRNVTMEECVACANQFAKRLAKELQVPVYLYGEAARSESRRT-LPAVRAGEYEALATKLKNPEWAPDFGDPVFVPSWGATVSGARKFLIAYNINLLSTKELAHRIALNIREGGRGKDQPGRLRKIQAIGWFLQEENLAQVSTNLLDFEITPLHVVYEEVCKDAKEMTLPVIGSQLVGLVPLQSLLDSAEFYIQKEKLFVLEEEHKIRLVINRLGLDSLAPFDPRQRIIEYLVQDDLS----------ESSLVTQSLRGFVQSVGARSATPGGGSVAAAVSALGAALGCMVGQMTYGKRQFESLDG--VMRELIPPFHHAADKLLAMVDADSNAFGSYMAALKLPKNTVEEQDKRSAALQEGLKEAVKVPLSLAENINNLWYPLLEMSKHGNIACKSDLQVAAKALETGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Xenopus
Match: clock (clock circadian regulator [Source:Xenbase;Acc:XB-GENE-495448])

HSP 1 Score: 358.607 bits (919), Expect = 1.790e-115
Identity = 200/506 (39.53%), Postives = 312/506 (61.66%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG++K+VI+  ++AI+   G  L+DVD   + NRTV+ FVG+  +V+E ALN +R A+ +ID+ KHKG  PR+G +  CPF+P++N  + +C+  AN+FA +LA+E+  PVY+YGE+   E R+T +  +   EYE L  K+   E  PDFG   FVP WGAT+ GARKFL+ +NINLL TKE A  I+  + E      +  +   IQ  GWF  E N+AQ+S N++DFE TP+H +++     A E+   VIGSQ+VG VPL  LL +AE  ++ EKL +L+++ KIRLVI +LGL+SL+PF+P++++IEY+V+              E++L+  +L  F+Q+V AR++TPG GSVA+ VS LGA+L  M G ++YG   +     +  +R+LIP  H  + KLL  +D  +     Y      P  + +++  +     + L+  ++    + E ++NLW P+LE+S   + +   +L++A   + T + G ++ +L
Sbjct:    7 CVPNFSEGKNKEVIDALAAAITQTGGCRLLDVDPGASTNRTVYTFVGSPEAVVEGALNAARVAFQMIDMRKHKGEHPRMGALDVCPFIPVRNVTMEECVACANQFAKRLAKELQVPVYLYGEAARSESRRT-LPAVRAGEYEALATKLKNPEWAPDFGDPVFVPSWGATVSGARKFLIAYNINLLSTKELAHRIALNIREGGRGKDQPGRLRKIQAIGWFLQEENLAQVSTNLLDFEITPLHVVYEEVCKDAKEMTLPVIGSQLVGLVPLQSLLDSAEFYIQKEKLFVLEEEHKIRLVINRLGLDSLAPFDPRQRIIEYLVQDDLS----------ESSLVTQSLRGFVQSVGARSATPGGGSVAAAVSALGAALGCMVGQMTYG--KRQFESLDGVMRELIPPFHHAADKLLAMVDADSNAFGSYMAALKLPKNTVEEQDKRSAALQEGLKEAVKVPLSLAENINNLWYPLLEMSKHGNIACKSDLQVAAKALETGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Xenopus
Match: clock (clock circadian regulator [Source:Xenbase;Acc:XB-GENE-495448])

HSP 1 Score: 341.658 bits (875), Expect = 1.720e-109
Identity = 193/494 (39.07%), Postives = 302/494 (61.13%), Query Frame = 1
Query:  157 VIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            VI+  ++AI+   G  L+DVD   + NRTV+ FVG+  +V+E ALN +R A+ +ID+ KHKG  PR+G +  CPF+P++N  + +C+  AN+FA +LA+E+  PVY+YGE+   E R+T +  +   EYE L  K+   E  PDFG   FVP WGAT+ GARKFL+ +NINLL TKE A  I+  + E      +  +   IQ  GWF  E N+AQ+S N++DFE TP+H +++     A E+   VIGSQ+VG VPL  LL +AE  ++ EKL +L+++ KIRLVI +LGL+SL+PF+P++++IEY+V+              E++L+  +L  F+Q+V AR++TPG GSVA+ VS LGA+L  M G ++YG   +     +  +R+LIP  H  + KLL  +D  +     Y      P  + +++  +     + L+  ++    + E ++NLW P+LE+S   + +   +L++A   + T + G ++ +L
Sbjct:   13 VIDALAAAITQTGGCRLLDVDPGASTNRTVYTFVGSPEAVVEGALNAARVAFQMIDMRKHKGEHPRMGALDVCPFIPVRNVTMEECVACANQFAKRLAKELQVPVYLYGEAARSESRRT-LPAVRAGEYEALATKLKNPEWAPDFGDPVFVPSWGATVSGARKFLIAYNINLLSTKELAHRIALNIREGGRGKDQPGRLRKIQAIGWFLQEENLAQVSTNLLDFEITPLHVVYEEVCKDAKEMTLPVIGSQLVGLVPLQSLLDSAEFYIQKEKLFVLEEEHKIRLVINRLGLDSLAPFDPRQRIIEYLVQDDLS----------ESSLVTQSLRGFVQSVGARSATPGGGSVAAAVSALGAALGCMVGQMTYG--KRQFESLDGVMRELIPPFHHAADKLLAMVDADSNAFGSYMAALKLPKNTVEEQDKRSAALQEGLKEAVKVPLSLAENINNLWYPLLEMSKHGNIACKSDLQVAAKALETGVFGAYFNVL 493          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Xenopus
Match: clock (clock circadian regulator [Source:Xenbase;Acc:XB-GENE-495448])

HSP 1 Score: 338.191 bits (866), Expect = 3.669e-108
Identity = 191/492 (38.82%), Postives = 300/492 (60.98%), Query Frame = 1
Query:  163 ETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            +  ++AI+   G  L+DVD   + NRTV+ FVG+  +V+E ALN +R A+ +ID+ KHKG  PR+G +  CPF+P++N  + +C+  AN+FA +LA+E+  PVY+YGE+   E R+T +  +   EYE L  K+   E  PDFG   FVP WGAT+ GARKFL+ +NINLL TKE A  I+  + E      +  +   IQ  GWF  E N+AQ+S N++DFE TP+H +++     A E+   VIGSQ+VG VPL  LL +AE  ++ EKL +L+++ KIRLVI +LGL+SL+PF+P++++IEY+V+              E++L+  +L  F+Q+V AR++TPG GSVA+ VS LGA+L  M G ++YG   +     +  +R+LIP  H  + KLL  +D  +     Y      P  + +++  +     + L+  ++    + E ++NLW P+LE+S   + +   +L++A   + T + G ++ +L
Sbjct:   13 DALAAAITQTGGCRLLDVDPGASTNRTVYTFVGSPEAVVEGALNAARVAFQMIDMRKHKGEHPRMGALDVCPFIPVRNVTMEECVACANQFAKRLAKELQVPVYLYGEAARSESRRT-LPAVRAGEYEALATKLKNPEWAPDFGDPVFVPSWGATVSGARKFLIAYNINLLSTKELAHRIALNIREGGRGKDQPGRLRKIQAIGWFLQEENLAQVSTNLLDFEITPLHVVYEEVCKDAKEMTLPVIGSQLVGLVPLQSLLDSAEFYIQKEKLFVLEEEHKIRLVINRLGLDSLAPFDPRQRIIEYLVQDDLS----------ESSLVTQSLRGFVQSVGARSATPGGGSVAAAVSALGAALGCMVGQMTYG--KRQFESLDGVMRELIPPFHHAADKLLAMVDADSNAFGSYMAALKLPKNTVEEQDKRSAALQEGLKEAVKVPLSLAENINNLWYPLLEMSKHGNIACKSDLQVAAKALETGVFGAYFNVL 491          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Xenopus
Match: clock (clock circadian regulator [Source:Xenbase;Acc:XB-GENE-495448])

HSP 1 Score: 334.339 bits (856), Expect = 1.059e-106
Identity = 185/489 (37.83%), Postives = 294/489 (60.12%), Query Frame = 1
Query:  172 SSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            ++AI+   G  L+DVD   + NRTV+ FVG+  +V+E ALN +R A+ +ID+ KHKG  PR+G +  CPF+P++N  + +C+  AN+FA +LA+E+  PVY+YGE+   E R+T +  +   EYE L  K+   E  PDFG   FVP WGAT+ GARKFL+ +NINLL TKE A  I+  + E      +  +   IQ  GWF  E N+AQ+S N++DFE TP+H +++     A E+   VIGSQ+VG VPL  LL +AE  ++ EKL +L+++ KIRLVI +LGL+SL+PF+P++++IEY+V+              E++L+  +L  F+Q+V AR++TP  G  +   +V GA+L  M G ++YG   +     +  +R+LIP  H  + KLL  +D  +     Y      P  + +++  +     + L+  ++    + E ++NLW P+LE+S   + +   +L++A   + T + G ++ +L
Sbjct:   19 AAAITQTGGCRLLDVDPGASTNRTVYTFVGSPEAVVEGALNAARVAFQMIDMRKHKGEHPRMGALDVCPFIPVRNVTMEECVACANQFAKRLAKELQVPVYLYGEAARSESRRT-LPAVRAGEYEALATKLKNPEWAPDFGDPVFVPSWGATVSGARKFLIAYNINLLSTKELAHRIALNIREGGRGKDQPGRLRKIQAIGWFLQEENLAQVSTNLLDFEITPLHVVYEEVCKDAKEMTLPVIGSQLVGLVPLQSLLDSAEFYIQKEKLFVLEEEHKIRLVINRLGLDSLAPFDPRQRIIEYLVQDDLS----------ESSLVTQSLRGFVQSVGARSATP--GGGSVAAAVSGAALGCMVGQMTYG--KRQFESLDGVMRELIPPFHHAADKLLAMVDADSNAFGSYMAALKLPKNTVEEQDKRSAALQEGLKEAVKVPLSLAENINNLWYPLLEMSKHGNIACKSDLQVAAKALETGVFGAYFNVL 492          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Mouse
Match: Ftcd (formiminotransferase cyclodeaminase [Source:MGI Symbol;Acc:MGI:1339962])

HSP 1 Score: 356.681 bits (914), Expect = 5.250e-115
Identity = 201/506 (39.72%), Postives = 310/506 (61.26%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG +++VI+  S AIS   G +L+DVD+ P+ NRTV+ FVG    V+E AL+ +R A  LID+SKHKG  PR+G +  CPF+P++   + +C+  A  F  +LAEE+  PVY+YGE+     R+T +  +   EYE L +K+ + E  PDFG + FVP WGAT+ GARKFL+ FNINLL TKEQA  I+  L E      +  + + +Q  GW+ +E N+AQ+S N++DFE T +H +F+ A   A E+N  V+GSQ+VG VPL  LL  A    + EKL +L+++ +IRLV+ +LGL+SL+PF+PKE++IEY+V     +SG       E +LL+ +L  F++ V AR++ PG GSVA+ V+ LGA+LA+M G ++YG   Q D+  +  +R+LIP  H  S +L   +D  A       +    P  + +++  +     + L + +    ++ E +  LW  + EL+   + S + +L++A   + T + G ++ +L
Sbjct:    7 CVPNFSEGNNQEVIDAISRAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALHAARTASQLIDMSKHKGEHPRMGALDVCPFIPVRGVSMEECVLCAKAFGQRLAEELNVPVYLYGEAAQTPSRQT-LPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARKFLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLEEKNLAQVSTNLLDFEVTALHTVFEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDKEKLFVLEEEHRIRLVVNRLGLDSLAPFDPKERIIEYLV----PDSGP------EQSLLDTSLRGFVREVGARSAAPGGGSVAAAVAALGAALASMVGQMTYGR-RQFDH-LDSTMRRLIPPFHAASAQLTSLVDADARAFAACLEAIKLPKNTPEERDRRACALQEGLRQAVAVPLKLAETVSQLWPALQELAHCGNLSCLSDLQVAAKALETGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. UniProt/SwissProt
Match: sp|P53603|FTCD_PIG (Formimidoyltransferase-cyclodeaminase OS=Sus scrofa OX=9823 GN=FTCD PE=1 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.177e-118
Identity = 212/549 (38.62%), Postives = 320/549 (58.29%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIV-EASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFE-YSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL-----TYPDENNVKVKTEIDKYNSESKINRQSLEDKFSEKN 1746
            C PN SEG++++VI+  S A++   G +L+DVDS P+ NRTV+ FVG    V+E ALN +RAAY LID+S+H G  PR+G +  CPF+P++   +++C+  A  F  +LAEE+  PVY+YGE+     R++ +  L   EYE L +K+ + E  PDFG + FVP WGAT+ GARKFL+ FNINLL T+EQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +F+     A E++  V+GSQ+VG VPL  LL  A    E E L LL D+ +IRLV+ +LGL+SL+PF PKE++IEY+V EA  E S           LL+  L  F++ V +R++ PG GSVA+  + +GA+LA+M GL++YG       D    +R+LIP  H  S KL   +D  A  AFE Y K    P ++ +DK  +     + L + +     + E + +LW  + EL+   + +   +L++A   + T + G ++ +L        D    +V+  I     E+K     + D+   + 
Sbjct:    7 CVPNFSEGKNQEVIDAISRAVAQTPGCVLLDVDSGPSTNRTVYTFVGRPEDVVEGALNAARAAYQLIDMSRHHGEHPRMGALDVCPFIPVRGVTMDECVRCAQAFGQRLAEELGVPVYLYGEAARTAGRQS-LPALRAGEYEALPEKLKQAEWAPDFGPSAFVPSWGATVAGARKFLLAFNINLLSTREQAHRIALDLREQGRGKDQPGRLKKVQAIGWYLDEKNLAQVSTNLLDFEVTGLHTVFEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFLLQDEHRIRLVVNRLGLDSLAPFKPKERIIEYLVPEAGPEQS-----------LLHKPLRTFVREVGSRSAAPGAGSVAAATAAMGAALASMVGLMTYGRRQFEHLDAT--MRRLIPPFHAASAKLTSLVDADA-RAFEAYLKAMKLPKDTPEDKDRRAAALQEGLRQAVAVPLALAETVASLWPALQELALCGNLACRSDLQVAAKALETGVFGAYFNVLINLKDVTDDAFKAQVRQRISSLLQEAKTQAALVLDRLEARQ 540          
BLAST of formimidoyltransferase-cyclodeaminase vs. UniProt/SwissProt
Match: sp|Q91XD4|FTCD_MOUSE (Formimidoyltransferase-cyclodeaminase OS=Mus musculus OX=10090 GN=Ftcd PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 3.672e-114
Identity = 201/506 (39.72%), Postives = 310/506 (61.26%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG +++VI+  S AIS   G +L+DVD+ P+ NRTV+ FVG    V+E AL+ +R A  LID+SKHKG  PR+G +  CPF+P++   + +C+  A  F  +LAEE+  PVY+YGE+     R+T +  +   EYE L +K+ + E  PDFG + FVP WGAT+ GARKFL+ FNINLL TKEQA  I+  L E      +  + + +Q  GW+ +E N+AQ+S N++DFE T +H +F+ A   A E+N  V+GSQ+VG VPL  LL  A    + EKL +L+++ +IRLV+ +LGL+SL+PF+PKE++IEY+V     +SG       E +LL+ +L  F++ V AR++ PG GSVA+ V+ LGA+LA+M G ++YG   Q D+  +  +R+LIP  H  S +L   +D  A       +    P  + +++  +     + L + +    ++ E +  LW  + EL+   + S + +L++A   + T + G ++ +L
Sbjct:    7 CVPNFSEGNNQEVIDAISRAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALHAARTASQLIDMSKHKGEHPRMGALDVCPFIPVRGVSMEECVLCAKAFGQRLAEELNVPVYLYGEAAQTPSRQT-LPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARKFLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLEEKNLAQVSTNLLDFEVTALHTVFEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDKEKLFVLEEEHRIRLVVNRLGLDSLAPFDPKERIIEYLV----PDSGP------EQSLLDTSLRGFVREVGARSAAPGGGSVAAAVAALGAALASMVGQMTYGR-RQFDH-LDSTMRRLIPPFHAASAQLTSLVDADARAFAACLEAIKLPKNTPEERDRRACALQEGLRQAVAVPLKLAETVSQLWPALQELAHCGNLSCLSDLQVAAKALETGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. UniProt/SwissProt
Match: sp|O88618|FTCD_RAT (Formimidoyltransferase-cyclodeaminase OS=Rattus norvegicus OX=10116 GN=Ftcd PE=1 SV=4)

HSP 1 Score: 352.443 bits (903), Expect = 1.338e-112
Identity = 199/506 (39.33%), Postives = 309/506 (61.07%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG +++VI+  S AIS   G +L+DVD+ P+ NRTV+ FVG    V+E AL+ +R A  LID+ KHKG  PR+G +  CPF+P++   +++C+  A  F  +LAEE+  PVY+YGE+     R+T +  +   EYE L +K+ + E  PDFG + FVP WGAT+ GARKFL+ FNINLL TKEQA  I+  L E      +  + + +Q  GW+ +E N+AQ+S N++DFE T +H +++ A   A E+N  V+GSQ+VG VPL  LL  A    + EKL +L+++ +IRLV+ +LGL+SL+PF+PKE++IEY+V     +SG       E +LL+ +L  F++ V AR++ PG GSVA+ V+ LGA+LA+M G ++YG   Q D+  +  +R+LIP  H  S +L   +D  A            P  + +++  +     + L + +    ++ E +  LW  + EL+   + S + +L++A   + T + G ++ +L
Sbjct:    7 CVPNFSEGNNQEVIDAISQAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALSAARTASQLIDMRKHKGEHPRMGALDVCPFIPVRGVSMDECVLCAKAFGQRLAEELNVPVYLYGEAAQMPSRQT-LPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARKFLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLEEKNLAQVSTNLLDFEVTALHTVYEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDKEKLFVLEEEHRIRLVVNRLGLDSLAPFDPKERIIEYLV----PDSGP------EQSLLDASLRAFVREVGARSAAPGGGSVAAAVAALGAALASMVGQMTYGR-RQFDH-LDSTMRRLIPPFHAASAQLTSLVDADARAFAACLGAIKLPKNTPEERDRRTCALQEGLRQAVAVPLKLAETVSQLWPALQELAQCGNLSCLSDLQVAAKALETGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. UniProt/SwissProt
Match: sp|Q9YH58|FTCD_CHICK (Formimidoyltransferase-cyclodeaminase OS=Gallus gallus OX=9031 GN=FTCD PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 1.415e-110
Identity = 196/523 (37.48%), Postives = 312/523 (59.66%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHY-LILTYPDENNVKVKTEIDK 1686
            C PN SEG +K+VIE    AIS   G  L+DVD+  + NRTV+ FVG   +V+E AL+ +R A+ LID+S+HKG  PR+G +  CPFVP+ N  + +C+  A+ F  +L+EE+  PVY+YGE+   E R+T +  +   EYE L  K+ K E  PDFG   FVPQWGAT+ GAR FL+ +NINLL TKE A  I+  + E      +    + +Q  GW+ +E N+AQ+S N++DFE TP+H +++     A  +   V+GSQ+VG VP   +L  AE  ++ EKL +L+++ KI+LV+ +LGL+SLSPFNP+E++IEY+V+A +E+ G          L+   LG F++AV  R++ PG GSVA+  + LGA+L  M GL+SYG   +     +  +R +IP +H+   +L+  +D  +     Y +    P  + ++++ +     + L+  +E    +   ++NLWS +  L+   + +   +L++    +  A+ G ++ +++   D  + K KTE  +
Sbjct:    7 CVPNFSEGCNKEVIEALGRAISQTPGCTLLDVDAGASTNRTVYTFVGTPEAVVEGALSAARMAWELIDMSRHKGEHPRMGALDVCPFVPVMNISMEECVICAHVFGQRLSEELGVPVYLYGEAARQESRRT-LPAIRAGEYEALPKKLEKPEWVPDFGPPAFVPQWGATVTGARTFLIAYNINLLCTKELAHRIALNIREQGRGADQPGSLKKVQGIGWYLEEENIAQVSTNLLDFETTPLHAVYEEVCYNAEALKLPVVGSQLVGLVPKKAMLDAAEFYIKKEKLFILEEEHKIKLVVSRLGLDSLSPFNPRERIIEYLVQAGQEDKG----------LVTKPLGAFVRAVGGRSAAPGGGSVAATAASLGAALGCMVGLMSYG--KRQFEQLDSIMRNVIPPLHQAMDELVAMVDADSRAFSSYMEAMKLPKSTPEERERRVVAMQQGLKTAVEVPCTLAVKVNNLWSSLKMLAHHGNLACKSDLQVGAKMLEAAVFGAYFNVMINLKDITDEKFKTETSQ 516          
BLAST of formimidoyltransferase-cyclodeaminase vs. UniProt/SwissProt
Match: sp|O95954|FTCD_HUMAN (Formimidoyltransferase-cyclodeaminase OS=Homo sapiens OX=9606 GN=FTCD PE=1 SV=2)

HSP 1 Score: 346.28 bits (887), Expect = 3.328e-110
Identity = 193/506 (38.14%), Postives = 299/506 (59.09%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEG++++VI+  S AI+   G +L+DVD+ P+ NRTV+ FVG    V+E ALN +R A  LID+S+H+G  PR+G +  CPF+P++   V++C+  A  F  +LAEE+  PVY+YGE+   + R+T +  +   EYE L  K+ + +  PDFG + FVP WGAT  GARKFL+ FNINLLGTKEQA  I+  L E      +  + + +Q  GW+ DE N+AQ+S N++DFE T +H +++     A E++  V+GSQ+VG VPL  LL  A    E E L +L+++Q+IRLV+ +LGL+SL PF+PKE++IEY+V       G  S           +L  F+  V AR++ PG GSVA+  + +GA+L +M GL++YG   +     +  +R+LIP   + S KL   +D  A     Y +    P  + ++K  +     + L R +     + E + +LW  + EL+   + +   +L++A   +   + G ++ +L
Sbjct:    7 CVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRT-LPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSK----------SLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYG--RRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVL 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. TrEMBL
Match: V4ACP6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_139083 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.270e-125
Identity = 223/529 (42.16%), Postives = 337/529 (63.71%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITD--EQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILT----YPDEN-NVKVKTEIDK 1686
            C PN SEGR+K+VIE  +SAI+S +G  L+DVD   + NRTV+ FVG+  +VIE ALN +RA Y+LID+ +H+G  PR+G +  CPF+P+++  + +C+E A EF  +L  E+  P+Y+YGE+  D  E R++ + ++   EYE L +K+ +D  KPDFG AEFVP WGAT VGARKFL+ +N+NLL TKEQA  I+  L E      E  + + +Q  GW+ +E N+AQ+S+N+ D E TP+H  ++     A E+N + +GSQIVG VPL  +L TA+  ++ EKL +L++DQK+RLVI +LGLNS+  FNPKE++IEY+V    +N  +   VS+E       + DFI  V +R+ TPG GSVA++ + LGA+L  M G L+YG  N+   D + K+RKLIP ++K  + L PFID  A    EY      P  +E++K+V++    + L   ++    V +++ +LW P+ EL+++ + +   +L++    + TA+ G +Y I T      DE+   K + EID+
Sbjct:    7 CVPNFSEGRNKEVIEAIASAIASTEGCSLLDVDPGISTNRTVYTFVGSPGAVIEGALNAARAGYHLIDMRQHQGEHPRMGALDVCPFIPVQDVSMEECVECAKEFGDRLTTELGVPLYLYGEAAKDNAEHRQS-LPQVRAGEYEGLPEKLRQDMWKPDFGSAEFVPSWGATAVGARKFLIAYNVNLLATKEQAHRIALNLREQGRSKEEPGRLKKLQAIGWYMEEANLAQVSMNLQDHEVTPLHVAYEECCKDAEELNLATVGSQIVGLVPLQAMLVTAQYFIDKEKLFILEEDQKLRLVIMRLGLNSIGSFNPKERIIEYMV----QNDTDGPLVSME-------VKDFILTVGSRSPTPGGGSVAAMSAALGAALGAMVGFLTYG--NKKFADLDSKMRKLIPPLYKGMKDLSPFIDADAAAFSEYMLALKLPHTNEEEKKVRQTALQQGLSTAVKVPLCVAKIVTSLWQPLKELAEIGNINCKSDLQVGVRQLETAVWGTYYNIATNMAEITDEDFKAKTQAEIDE 521          
BLAST of formimidoyltransferase-cyclodeaminase vs. TrEMBL
Match: A0A1S3JQE7 (formimidoyltransferase-cyclodeaminase OS=Lingula unguis OX=7574 GN=LOC106175096 PE=4 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.441e-122
Identity = 221/544 (40.62%), Postives = 328/544 (60.29%), Query Frame = 1
Query:   88 IQL*RMIYDIL------CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILT-----YPDENNVKVKTEIDK 1686
            +QL + +Y +       C PN SEGR K+VIE  ++AI+S +G  L+DVD  P+ NRTV+ FVG   +VIE ALN +R AY LID+ +H G  PR+G +  CPF+P++   ++ CI  A EF  +LA E+  PVY+Y E+ T+E RKT+ +          E  IS D + PDFG AEF+P WGAT  GARKFL+ +N+NLL TKEQA  I+  + E      E  +   +Q  GW+ DE N+AQIS+N+ D E TPIHQ ++ +   A E+N +V+GSQIVG VPL  +L  A+   E E L LL++DQKIRLVI +LGL+SL  FNPKE++IEY++  SEE+ G          L+++ L +F+  V  R++ PG GSV++L++ LGA+L TM G LSYG  N+     +  +RKLIP +++  +++LPF+D  A    +Y   +  P  +E+D +++     ++L   +     V + ++ LW  + EL+ V + +   +L++    + T   G +Y ++T        E   KV TE D+
Sbjct:  250 LQLLKAVYKLAMARIVECVPNFSEGRQKEVIEAIANAIASTEGCSLLDVDPGPSTNRTVYTFVGGPDAVIEGALNAARVAYQLIDMRRHSGEHPRMGALDVCPFIPVRGVSMDDCIGCAREFGERLAAELNVPVYLYNEAATEEHRKTLPQIRAGEYEGLEEKLISPDWI-PDFGPAEFIPSWGATATGARKFLIAYNVNLLATKEQAHRIALNIREQGRGKDEPGRLPKVQAIGWYLDEANIAQISMNLTDHEVTPIHQAYEESCKDAQELNIAVVGSQIVGLVPLRAMLQAADYYCEKEGLFLLEEDQKIRLVINRLGLSSLGGFNPKERIIEYMI--SEESDG---------PLVSMDLREFVYTVGGRSACPGGGSVSALIASLGAALGTMVGFLSYG--NKKFAHLDSTMRKLIPPLYQGMKEILPFVDADAAAFNQYMIATKLPHNTEEDAEIRTAAMRQALMMAIRVPMTVLKAINKLWPTLSELAKVGNLNCKSDLQVGARSLETGAWGAYYNVMTNLKDVEDGELKTKVNTEADE 779          

HSP 2 Score: 240.736 bits (613), Expect = 2.199e-65
Identity = 117/255 (45.88%), Postives = 159/255 (62.35%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMD---FEKTPIHQIFKSAENLA 876
            C PN SEGR K+VIE  ++AI+S +G  L+DVD  P+ NRTV+ FVG   +VIE ALN +R AY LID+ +H G  PR+G +  CPF+P++   ++ CI  A EF  +LA E+  PVY+Y E+ T+E RKT+ +          E  IS D + PDFG AEF+P WGAT  GARKFL+ +N+NLL TKEQA  I+  + E      E  +   +Q  GW+ DE N+AQIS+N+ D   F +    Q+ K+   LA
Sbjct:    7 CVPNFSEGRQKEVIEAIANAIASTEGCSLLDVDPGPSTNRTVYTFVGGPDAVIEGALNAARVAYQLIDMRRHSGEHPRMGALDVCPFIPVRGVSMDDCIGCAREFGERLAAELNVPVYLYNEAATEEHRKTLPQIRAGEYEGLEEKLISPDWI-PDFGPAEFIPSWGATATGARKFLIAYNVNLLATKEQAHRIALNIREQGRGKDEPGRLPKVQAIGWYLDEANIAQISMNLTDHXYFGEVRKLQLLKAVYKLA 260          
BLAST of formimidoyltransferase-cyclodeaminase vs. TrEMBL
Match: T1JH96 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 2.518e-121
Identity = 214/558 (38.35%), Postives = 337/558 (60.39%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILT---------YPDENNVKVKTEIDKYNSESKINRQSLEDKFSEKNKTK*NLQ 1767
            C PN SEG+SK+VI++ +SAISS + V L+DVD   + NRTV+ FVG+  +V+EAAL  +R A+ LID+SKHKG  PR+G +  CPF+P++  ++ +CI  A +F  KLA E+  PVY+YG + T + RKT + ++   EYE L +K+   + KPDFG +EFV  WGAT+ G RKFL+ +N+NLL TKEQA  I+  + E      +  + +  Q  GW+ +E N+AQ+SIN+ D ++TPIH  ++     A E+N +V GSQIVG VPL  +L  A   +++E L +L++DQKI L + +LGLNSL PFNPKE++IEYI+ + +++S           L++  L  FI  VAAR   PG GSVA+  + LG++L TM GL++YG       D   ++RKLIP IHK  + ++P ID       EY +    PS + ++   +       L R ++    +   ++ +W  +LEL+++ + +   +L++A  C+ T + G  Y ++          Y ++ +++++ E+D+  +  K+    + D  SE++    NL+
Sbjct:    7 CVPNFSEGQSKEVIDSIASAISSEENVSLLDVDPGSSTNRTVYTFVGSPDAVVEAALKAARIAWKLIDMSKHKGEHPRMGALDVCPFIPVQGVEIEECIYCAKKFGEKLAAELNVPVYLYGLASTQDYRKT-MPQIRAGEYEGLIEKLKHPQWKPDFGPSEFVSNWGATVTGVRKFLIAYNVNLLSTKEQAHRIALNVREQGRGKDKPGRLQHCQAIGWWLEEHNLAQVSINLTDHDETPIHTAYEEVRKDAMELNLAVTGSQIVGMVPLKAMLQIANYYIQNENLFVLEEDQKIHLAVNRLGLNSLGPFNPKERIIEYILPSEKKDS-----------LIHQNLDHFIHGVAARTPAPGGGSVAATTAALGSALGTMVGLMTYGKKQWEHLDG--QMRKLIPVIHKTMKDIIPIIDADTHAFAEYMEACKLPSNTPEETTTRDSATQSGLMRAIDVPMNLARTINTVWDSVLELANICNLNTKSDLQVAVRCLETGVWGAFYNVMINVDGIVDEGYRNKVSMEIQMEVDRAQAFCKM----VLDTLSERSTKNLNLK 546          
BLAST of formimidoyltransferase-cyclodeaminase vs. TrEMBL
Match: R7V4K2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_151128 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 2.168e-119
Identity = 214/560 (38.21%), Postives = 335/560 (59.82%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKL--------------------LPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILTYPD-----ENNVKVKTEIDKYNSESKINRQSLE 1725
            C PN SEG+ K+VIE  ++AI++ DG  L+DVD   + NRTV+ FVG+  +V+E ALN +RAA  LID+++H G  PR+G +  CPF+P++   ++ C+E A E  +KL EE+  PVY+YG++  +E R TV  +L   EYE L +K+ K E KPDFG AEFVP WGA+L+GARKFL+ +NIN+L TKEQA  I+  + E      E  + + +Q  GW+ +E N+AQ+S+N+ D EKTPIH +++     A E+N +++GSQIVG VPL  +L  A+  M+ E L LL++DQK+RLV+ +LGL+S+  FNPKE++IEY++++  +             LL++ + DFI  V AR+ TPG GSVA+L + +GA+L++M G L+YG       D N  +R+L+P ++   ++L                    LPF+D    L  +YS     P    ++++ ++E   + L   +     + +  + LW  + EL  + + S   ++++   C+ T + G +  +LT  D     +   KV +EI+    E KI +++ E
Sbjct:   11 CVPNFSEGQHKEVIEAIANAIATTDGCNLLDVDPGISTNRTVYTFVGSPDAVVEGALNAARAASQLIDMTRHHGEHPRIGAMDVCPFIPVRGVTMDDCVECARELGMKLGEELGVPVYLYGDAAKEEYRTTV-PQLRAGEYESLPEKLEKPEWKPDFGPAEFVPSWGASLIGARKFLIAYNINMLATKEQAHRIALNVREQGRGKGEPGRLKHVQAIGWYLEEANMAQVSLNLTDHEKTPIHTVYEEVSRDARELNLAMVGSQIVGLVPLRAILQVADYYMDKENLFLLEEDQKVRLVVDRLGLHSVGGFNPKERIIEYMIDSERDGP-----------LLSMDVKDFILTVGARSPTPGGGSVAALTATMGAALSSMAGFLTYGNRKFEHLDGN--MRQLLPPLYSTMKELMHYIDADAAAFNDYMGLKEMLPFVDPDVALFSDYSAAIKLPHRDPEEEKFREEALQRGLRTAISVPMAMAKKANCLWPTLAELCKIANISCKSDVQVGMKCLETGVWGAYKNVLTNLDSIQDADYKQKVLSEIE---GEWKIAQENCE 553          
BLAST of formimidoyltransferase-cyclodeaminase vs. TrEMBL
Match: C3Z8L4 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_125780 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 5.593e-119
Identity = 202/506 (39.92%), Postives = 313/506 (61.86%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            C PN SEGR K+VIE  ++AI+S DGV L+DVD  P+ NRTV+ FVG+  SV+E A+N +RAA  LID+++H G  PR+G +  CPF+P++      CI+ ANEF  +LAEE+  PVY+YG++  +E+R   +  +   EYE LE+K+     +PDFG A+F+P WGAT  G RKFL+ +N+NLL TKEQA  I+  L E    P E  + + +Q  GW+ DE N+AQIS+N+ DF+ TP+H  ++ A   A E+N  V+GSQ+VG VPL  ++  AE  ME + L L+++DQK+RL I +LGLNSL PF PKE++IEY++  SE+  G  ++ S+ N         FI+ V AR+  PG GSV++ V+ +GA+L  M   ++YG       D   K+R+LIP ++    +L+PFIDK      +Y      P  + +++ V+ +     L++ ++    V +  + +W  + EL+   + + + +L++    + T + G ++ ++
Sbjct:    7 CVPNFSEGRHKEVIEAIANAIASTDGVSLLDVDPGPSTNRTVYTFVGSPESVVEGAMNGARAASQLIDMTRHHGEHPRMGALDVCPFIPVRGVTEEDCIQCANEFGKQLAEELGVPVYLYGKAAKEEKR-VKLPSIRAGEYEGLEEKLKNPAWQPDFGPADFIPSWGATATGCRKFLIAWNVNLLATKEQAHRIALNLREQGRGPNEPGRLKCVQGIGWWLDEANMAQISMNLTDFDVTPLHTAYEEACKDAKELNLPVVGSQVVGLVPLQAIMMAAEFYMEKDNLFLVEEDQKVRLAIDRLGLNSLGPFTPKERIIEYMIR-SEDEPGPLASTSVFN---------FIKNVGARSPAPGGGSVSACVAAMGAALGAMVAFMTYGKRQFEQLDG--KMRQLIPPLYTTMNELIPFIDKDTTAFNDYMAACKLPKGTPEEQAVRDQAMQAGLQKAIQVPLAVMQTANRVWGQLQELAQSGNFTTMSDLQVGARSLETGVWGAYHNVM 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Cavefish
Match: ftcd (formimidoyltransferase cyclodeaminase [Source:NCBI gene;Acc:103024962])

HSP 1 Score: 353.984 bits (907), Expect = 4.170e-114
Identity = 193/508 (37.99%), Postives = 311/508 (61.22%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            I C PN SEGR+K+VI+  + AIS+ +G  L+DVD   + NRTV+ FVG   +V+E ALN +R A+ +ID+SKH G  PR G +  CPF+P++N  + +C+E ANEF  +L + +  PVY+YGE+   E R++ +  +   EYE L +K+ K E  PD+G A FVP WGAT+ GARKFL+ +N+NLL TKEQA  I+  + E      +    + +Q  GW+ +E N+AQ+S NI+DFE TP+H++++     A E+N  V+GSQIVG +PL  +L  A+  ++ +KL +++++ K+RLVI KLGL+SL PF PKE++IEY+VEA+++          E  L++L+L  F+++V AR + PG GSV++ ++ +GA+L  M G ++YG       D    +RKLIP  ++    LL  +D  +     Y      P  +  + + ++E   + L++ +     + E ++ LW  + E+    + +   + ++A   + TA+ G +Y ++
Sbjct:    5 IECVPNFSEGRNKEVIDAIADAISATEGCSLLDVDPGSSTNRTVYTFVGPPQAVVEGALNAARTAFTIIDMSKHTGEHPRTGAMDVCPFIPVQNASMEECVECANEFGRRLGDLLHVPVYLYGEAARTESRRS-LPSVRAGEYEALSEKLKKSEWVPDYGPATFVPSWGATVTGARKFLIAYNVNLLSTKEQAHRIALDVREQGRGKDQPGTLKKVQGMGWYLEESNLAQVSTNILDFELTPLHKVYEEICKDAKELNLPVVGSQIVGLIPLKAMLDCADFYIQKDKLFVVEEEHKVRLVISKLGLDSLGPFVPKERIIEYMVEANQD----------EGRLVSLSLQQFVRSVGARTAAPGGGSVSAAIAAMGAALGCMVGQMTYGKRQFESLDG--VMRKLIPPFYQAMNDLLLTVDADSTAFNSYMAALKLPKGTPDEVKRREEAMQEGLKKAVGVPMSLAERVNVLWPALKEIVQYGNVACKSDAQVAAKALETAVYGAYYNVI 499          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Cavefish
Match: ftcd (formimidoyltransferase cyclodeaminase [Source:NCBI gene;Acc:103024962])

HSP 1 Score: 296.59 bits (758), Expect = 9.742e-93
Identity = 177/508 (34.84%), Postives = 285/508 (56.10%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLIL 1638
            I C PN SEGR+K+VI+  + AIS+ +G  L+DVD   + NRTV+ FVG   +V+E ALN +R A+ +ID+SKH G  PR G +  CPF+P++N  + +C+E ANEF  +L + +  PVY+YGE+   E R++ +  +   EYE L +K+ K E  PD+G A FVP WGAT+ GARKFL+ +N+NLL TKEQA  I+  + E                 G   D+                              E+N  V+GSQIVG +PL  +L  A+  ++ +KL +++++ K+RLVI KLGL+SL PF PKE++IEY+VEA+++          E  L++L+L  F+++V AR + PG GSV++ ++ +GA+L  M G ++YG   +     +  +RKLIP  ++    LL  +D  +     Y      P  +  + + ++E   + L++ +     + E ++ LW  + E+    + +   + ++A   + TA+ G +Y ++
Sbjct:    5 IECVPNFSEGRNKEVIDAIADAISATEGCSLLDVDPGSSTNRTVYTFVGPPQAVVEGALNAARTAFTIIDMSKHTGEHPRTGAMDVCPFIPVQNASMEECVECANEFGRRLGDLLHVPVYLYGEAARTESRRS-LPSVRAGEYEALSEKLKKSEWVPDYGPATFVPSWGATVTGARKFLIAYNVNLLSTKEQAHRIALDVRE----------------QGRGKDQ------------------------------ELNLPVVGSQIVGLIPLKAMLDCADFYIQKDKLFVVEEEHKVRLVISKLGLDSLGPFVPKERIIEYMVEANQD----------EGRLVSLSLQQFVRSVGARTAAPGGGSVSAAIAAMGAALGCMVGQMTYG--KRQFESLDGVMRKLIPPFYQAMNDLLLTVDADSTAFNSYMAALKLPKGTPDEVKRREEAMQEGLKKAVGVPMSLAERVNVLWPALKEIVQYGNVACKSDAQVAAKALETAVYGAYYNVI 453          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Cavefish
Match: zgc:153901 (glutamate formimidoyltransferase-like [Source:NCBI gene;Acc:103028101])

HSP 1 Score: 61.2326 bits (147), Expect = 1.079e-9
Identity = 47/194 (24.23%), Postives = 90/194 (46.39%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCSSAI------SSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNE-DVNKCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINL 672
            + C  NISE R K ++E+ + A           G  ++++ S    NR+V   V + + + EA       A++LID+ +H G  P +G +   PF P+  E D+  C + A   A  L E V+    + +G +    +R        +  ++++ +  +    +PD G  +   Q+G T +GA  +++  N+ +
Sbjct:   10 VACLLNISEARQKSLVESVAQAAITDKHGRRRKGTTVLNIFSDYNYNRSVITIVASITLIKEAVFCACAKAFSLIDMDQHVGVHPCMGAVDLVPFYPLGEEVDLEDCGKEAQGLATALTERVLGTSAFFFGWADVPLRRGLAQRRKEMGWFQKIPNMAAS---QPDIG-PQPTRQYGLTGIGASPYVMNCNVTI 199          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Cavefish
Match: zgc:153901 (glutamate formimidoyltransferase-like [Source:NCBI gene;Acc:103028101])

HSP 1 Score: 51.6026 bits (122), Expect = 1.341e-6
Identity = 38/161 (23.60%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  196 GVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNE-DVNKCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINL 672
            G  ++++ S    NR+V   V + + + EA       A++LID+ +H G  P +G +   PF P+  E D+  C + A   A  L E V+    + +G +    +R        +  ++++ +  +    +PD G  +   Q+G T +GA  +++  N+ +
Sbjct:   39 GTTVLNIFSDYNYNRSVITIVASITLIKEAVFCACAKAFSLIDMDQHVGVHPCMGAVDLVPFYPLGEEVDLEDCGKEAQGLATALTERVLGTSAFFFGWADVPLRRGLAQRRKEMGWFQKIPNMAAS---QPDIG-PQPTRQYGLTGIGASPYVMNCNVTI 195          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Sea Lamprey
Match: ftcd (formimidoyltransferase cyclodeaminase [Source:ZFIN;Acc:ZDB-GENE-030131-9643])

HSP 1 Score: 310.842 bits (795), Expect = 4.218e-98
Identity = 192/560 (34.29%), Postives = 311/560 (55.54%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAP---VYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEK-----------DKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHY-LILTYPDENN----VKVKTEIDKYNSESKINRQSLEDKFSEK 1743
            C PN SEGR ++VIE  + AI    G  L+DVD   +++RTV+ FV    + +E ALN +R A+  ID+ +H+G  PRLG +  CPFVP++   V +C+  A EF+ +LAEE+  P   VY+YGE+   + RK  +  +   EYE+L DK+      PD+G A  VP WGAT+ G RKFLV FN+N+LGTKEQA  I+  L E    P++  +   +Q  GW+ +E ++AQ+S NI+D E TP+H++++     A E+  + +GSQ+VG VPL  LL +A   ++ + L +L+++ KIRLV+ +LGL+S+SPFN KE++IEY+  A E              L +L L  FI +V +R+  PG GSVA+ V+ +GA+L +M GL++YG   +   + +E +R+    +H+    L   +D  A     Y K  S    +                 + E    +L   +     V E +   W  +LEL+   + +   ++++    +   +EG +Y +++  PD ++     KV+ ++++  + ++ N   + D  S +
Sbjct:    7 CVPNFSEGRDREVIEAIAEAIRRTPGCRLLDVDPGESSHRTVYTFVAPPGAAVEGALNAARVAFQKIDMRRHRGEHPRLGALDVCPFVPVRGVTVLECVRCAEEFSERLAEELHVPGWAVYLYGEAARKDDRKA-LPSIRAGEYEKLGDKLKDPAWAPDYGPATLVPSWGATVAGTRKFLVAFNVNVLGTKEQAHRIALNLREQGRGPSQPGRLRCVQAIGWYLEEQDLAQVSTNILDHEVTPMHEVYEEVCKDAKELCVAAVGSQVVGLVPLQALLTSAAFYIKRDHLFVLEEENKIRLVVNRLGLDSISPFNAKERIIEYMTGALEGGP-----------LSSLPLHRFISSVGSRSPAPGGGSVAAAVASMGAALGSMVGLMTYG--KRQFEEVDEVVRRATAPLHEAMGLLSLAVDADACAFNRYMKRDSLSRATAAMRLLRAARACRAACRRNEEVQAALAEAVAVPLSVAEHVDAAWPFMLELAAHGNYACRSDVQVGVKALELGVEGAYYNVLINLPDIHSESFKTKVREKMERLLARARENSAHILDVVSSR 552          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Nematostella
Match: EDO45893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV9])

HSP 1 Score: 346.665 bits (888), Expect = 2.371e-111
Identity = 197/538 (36.62%), Postives = 325/538 (60.41%), Query Frame = 1
Query:   76 INSSIQL*RMIYDILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLI-LTYPDENNVKVKTEIDK 1686
            +  +IQ  RM   + C PN SEGR+  VI+  + AIS   GV L+DVD   + NRTV+ FVG+   V++ ALN ++ A  LID+ KHKG  PRLG +  CPF+P++   +  C   A  F  + A+E+   VY+YG +   + RKTV  ++   EYE L  +I   E KPD+G AEF  +WGAT+ GARKFL+ +NIN+LGTKEQA  I+  L E      +  + + +Q  GW+ +E N+AQ+S+N++D+E TP+H  F+     A E+   V GSQ+VG +PL+ +L  A+  +E E L +L++DQKIRLVI +LGL+S++PF+PK ++IEY++ +++++            L+++T+ +FI+A+ AR S PG GS A+ ++ +GA+L TM G +SYG  N+  ++ +  +R LIP + +    L   +DK      ++ +    P ++ ++++ ++    + L+  ++    V +  +  W P++ELS V +P+ + +L++    + T + G +Y + +  PD  + + K E+ K
Sbjct:   24 VARAIQSRRMSRIVECVPNFSEGRNSKVIDAIAKAISETAGVSLLDVDPGASTNRTVYTFVGSPEDVVQGALNGAKIAKELIDMRKHKGEHPRLGALDVCPFIPVRGVTMEDCAACARSFGERAAKELGIAVYLYGFASEQDYRKTV-PQIRAGEYEGLNKRIVMPEWKPDYGPAEFDAKWGATVAGARKFLIAYNINILGTKEQAHRIALNLRETGRGNNQPGRLKCVQGIGWWLEEANLAQLSLNLVDYEVTPMHVAFEECVKDAKELKLPVCGSQVVGLIPLDAILKAADHYIEKENLFILEEDQKIRLVIQRLGLSSVTPFDPKTRIIEYMISSADKSP-----------LVSMTVREFIKAIGARTSAPGGGSAAAAIAAIGAALGTMVGFMSYG--NKKYDNLDPLMRSLIPSLRQAMLDLTEMVDKDTNAFNDFMQARKMPKKTPEEEEKREAAMQEGLKSAVQVPMAVIQTANKAWPPLVELSKVSNPTTLSDLQVGARSLETGVWGAYYNVKINLPDIKDEQYKAEVLK 547          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Nematostella
Match: EDO44840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE4])

HSP 1 Score: 65.0846 bits (157), Expect = 2.138e-11
Identity = 72/292 (24.66%), Postives = 131/292 (44.86%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSVDGV---------ILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIK-NEDVNKCIEVANEFAIKLAEEV-VAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINL------LGTKEQAITISTKLEEIYNKPTEKSKNEA---IQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVP 927
            + C  N+SE RSK ++E+ + SAI +   +          ++++ S    NR+V        S+ E+     + AY  ID+SKH+G  PRLG +   P  PI  +  + +C ++A     ++ + +  + V+ +G +    +R  V     V+ YE   D ++ D +  D G A   P++G T VGA  ++   N+ +      LG K  A   +T  E +    +    +E    I C     +EL+      +   F  T  + I +  + +A+     + G+++VG  P
Sbjct:    7 VACLLNVSEARSKPIVESIAHSAIGNTKPLNETSLKCSSTVLNIFSDLDYNRSVITIAAPVDSIEESVFRACKTAYEEIDLSKHRGGHPRLGAVDLVPLHPITPSVTLEECGKIAINIGRRITDTIKGSSVFFFGHADLPLKRGLVTRRKAVSWYEGKGD-MTFDGIGWDIGPAP-TPRYGCTGVGAIPYVTNCNVTIDTKDLSLGKKIAASIRATSSEGLPGVQSMAFAHEGMVEIACNVEALEELS------DEGTFNYTSANNIEERIKEMASTAGVELYGTKVVGYTP 290          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Medaka
Match: ftcd (formimidoyltransferase cyclodeaminase [Source:NCBI gene;Acc:101171459])

HSP 1 Score: 348.591 bits (893), Expect = 7.796e-110
Identity = 186/475 (39.16%), Postives = 287/475 (60.42%), Query Frame = 1
Query:  121 CSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILEL 1545
            C PN SEGR++ VI+  S+AIS   G  L+DVD   + NRTV+ FVG   +V+E ALN +R A++LID++KH G  PR G +  CPF+P++N  ++ C+  +  F  KLA+ +  PVY+YGE+     R+  +  +   EYE L DK+S+ E  PDFG A FVP WGAT+ GARKFL+ +N+NL+ TKEQA  ++  + E      +    + +Q  GW+ +E N+AQ+S NI+D+E TP+H +++     A E+   ++GSQIVG +PL  LL  A+  +  ++L +L+++ K+RLV+ KLGL+SL PFNPKE++IEY+V+  EE             L +LTL  F+ +V AR + PG GSV++ ++ LGA+L  M G ++YG   Q +N  +  +RKLIP +H+     L  +D  A     Y      P  + ++K+ +++     L++ L     + E +  LW  + E+
Sbjct:  200 CVPNFSEGRNQQVIDAISAAISGTAGCSLLDVDPGASTNRTVYTFVGPPDAVVEGALNAARQAFSLIDMTKHSGEHPRTGALDVCPFIPVQNVTMDDCVGCSRAFGQKLADMLHVPVYLYGEAAGTPARR-ALPSVRAGEYEALPDKLSRQEWTPDFGPAAFVPSWGATVTGARKFLIAYNVNLISTKEQAHRVALDIREQGRGQNQPGLLKKVQGMGWYLEEANIAQVSTNILDYEVTPLHAVYEEVCRAAEELRLPLVGSQIVGLIPLKALLDAADFYIHRDQLFILEEEHKVRLVVSKLGLDSLGPFNPKERIIEYMVKGQEEGQ-----------LRSLTLRQFVHSVGARTAAPGGGSVSAAIAALGAALGAMVGQMTYGK-RQYEN-LDGVMRKLIPPLHRAMNDFLQMVDADASAFNSYMAALKMPKNTAEEKKRREDAMQDGLQQALAVPEALAERISALWPHLKEM 660          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Medaka
Match: zgc:153901 (formimidoyltransferase-cyclodeaminase [Source:NCBI gene;Acc:101162880])

HSP 1 Score: 60.8474 bits (146), Expect = 1.553e-9
Identity = 53/196 (27.04%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSVDGV-----ILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNE-DVNKCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQ--WGATLVGARKFLVYFNINL 672
            + C  NISE R KD++ET + +A+ + +GV      ++++ +    NR+V   V +  S+ EA L+    A  LI++  H G  P LG +   P  P+  E  +  C + A   A  L E V     +++G + +  QR        +  +++  D      ++PD G     PQ  +G T VGA  +++  N+ +
Sbjct:   11 VACLLNISEARRKDLVETVARAALYNTEGVKREGTTVLNIFNDYDYNRSVITIVASIGSIREAVLSACVKACGLINMCTHTGVHPCLGAVDLIPIYPLGEEVGIEDCAQEARAVAQGLTESVQGTSAFLFGWADSLLQRGLAQRRKEMGWFKKTPD---MQAVRPDVGPQ---PQRRYGLTGVGASPYVMNCNVTI 200          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Medaka
Match: zgc:153901 (formimidoyltransferase-cyclodeaminase [Source:NCBI gene;Acc:101162880])

HSP 1 Score: 60.8474 bits (146), Expect = 1.553e-9
Identity = 53/196 (27.04%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSVDGV-----ILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNE-DVNKCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQ--WGATLVGARKFLVYFNINL 672
            + C  NISE R KD++ET + +A+ + +GV      ++++ +    NR+V   V +  S+ EA L+    A  LI++  H G  P LG +   P  P+  E  +  C + A   A  L E V     +++G + +  QR        +  +++  D      ++PD G     PQ  +G T VGA  +++  N+ +
Sbjct:   11 VACLLNISEARRKDLVETVARAALYNTEGVKREGTTVLNIFNDYDYNRSVITIVASIGSIREAVLSACVKACGLINMCTHTGVHPCLGAVDLIPIYPLGEEVGIEDCAQEARAVAQGLTESVQGTSAFLFGWADSLLQRGLAQRRKEMGWFKKTPD---MQAVRPDVGPQ---PQRRYGLTGVGASPYVMNCNVTI 200          
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Medaka
Match: zgc:153901 (formimidoyltransferase-cyclodeaminase [Source:NCBI gene;Acc:101162880])

HSP 1 Score: 60.8474 bits (146), Expect = 2.166e-9
Identity = 53/196 (27.04%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  115 ILCSPNISEGRSKDVIETCS-SAISSVDGV-----ILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNE-DVNKCIEVANEFAIKLAEEVVA-PVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQ--WGATLVGARKFLVYFNINL 672
            + C  NISE R KD++ET + +A+ + +GV      ++++ +    NR+V   V +  S+ EA L+    A  LI++  H G  P LG +   P  P+  E  +  C + A   A  L E V     +++G + +  QR        +  +++  D      ++PD G     PQ  +G T VGA  +++  N+ +
Sbjct:   89 VACLLNISEARRKDLVETVARAALYNTEGVKREGTTVLNIFNDYDYNRSVITIVASIGSIREAVLSACVKACGLINMCTHTGVHPCLGAVDLIPIYPLGEEVGIEDCAQEARAVAQGLTESVQGTSAFLFGWADSLLQRGLAQRRKEMGWFKKTPD---MQAVRPDVGPQ---PQRRYGLTGVGASPYVMNCNVTI 278          
BLAST of formimidoyltransferase-cyclodeaminase vs. Planmine SMEST
Match: SMESG000070969.1 (SMESG000070969.1)

HSP 1 Score: 1050.43 bits (2715), Expect = 0.000e+0
Identity = 550/551 (99.82%), Postives = 550/551 (99.82%), Query Frame = 1
Query:  103 MIYDILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIXXXXXXXXXXXXDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPXXXXXXXXXXXXXXXXXTMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILTYPDENNVKVKTEIDKYNSESKINRQSLEDKFSEKNKTK 1755
            MIYDILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIEELFVTEYEELEDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPGLGSVASLVSVLG SLATMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILTYPDENNVKVKTEIDKYNSESKINRQSLEDKFSEKNKTK
Sbjct:    1 MIYDILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFNFVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNEDVNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIEELFVTEYEELEDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITISTKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQIFKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQKIRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLTLGDFIQAVAARNSTPGLGSVASLVSVLGTSLATMGGLLSYGTCNQTDNDKNEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKKEMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCIATALEGLHYLILTYPDENNVKVKTEIDKYNSESKINRQSLEDKFSEKNKTK 551          
The following BLAST results are available for this feature:
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FTCD6.929e-11138.14formimidoyltransferase cyclodeaminase [Source:HGNC... [more]
FTCD6.929e-11138.14formimidoyltransferase cyclodeaminase [Source:HGNC... [more]
FTCD1.647e-11038.14formimidoyltransferase cyclodeaminase [Source:HGNC... [more]
FTCD1.898e-10642.62formimidoyltransferase cyclodeaminase [Source:HGNC... [more]
FTCD1.898e-10642.62formimidoyltransferase cyclodeaminase [Source:HGNC... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftcd3.101e-11538.54formimidoyltransferase cyclodeaminase [Source:ZFIN... [more]
zgc:1539011.075e-1429.74zgc:153901 [Source:ZFIN;Acc:ZDB-GENE-060929-820][more]
zgc:1539011.802e-1429.74zgc:153901 [Source:ZFIN;Acc:ZDB-GENE-060929-820][more]
zgc:1539011.802e-1429.74zgc:153901 [Source:ZFIN;Acc:ZDB-GENE-060929-820][more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clock5.265e-11639.72clock circadian regulator [Source:Xenbase;Acc:XB-G... [more]
clock1.790e-11539.53clock circadian regulator [Source:Xenbase;Acc:XB-G... [more]
clock1.720e-10939.07clock circadian regulator [Source:Xenbase;Acc:XB-G... [more]
clock3.669e-10838.82clock circadian regulator [Source:Xenbase;Acc:XB-G... [more]
clock1.059e-10637.83clock circadian regulator [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ftcd5.250e-11539.72formiminotransferase cyclodeaminase [Source:MGI Sy... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53603|FTCD_PIG1.177e-11838.62Formimidoyltransferase-cyclodeaminase OS=Sus scrof... [more]
sp|Q91XD4|FTCD_MOUSE3.672e-11439.72Formimidoyltransferase-cyclodeaminase OS=Mus muscu... [more]
sp|O88618|FTCD_RAT1.338e-11239.33Formimidoyltransferase-cyclodeaminase OS=Rattus no... [more]
sp|Q9YH58|FTCD_CHICK1.415e-11037.48Formimidoyltransferase-cyclodeaminase OS=Gallus ga... [more]
sp|O95954|FTCD_HUMAN3.328e-11038.14Formimidoyltransferase-cyclodeaminase OS=Homo sapi... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4ACP61.270e-12542.16Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3JQE72.441e-12240.63formimidoyltransferase-cyclodeaminase OS=Lingula u... [more]
T1JH962.518e-12138.35Uncharacterized protein OS=Strigamia maritima OX=1... [more]
R7V4K22.168e-11938.21Uncharacterized protein OS=Capitella teleta OX=283... [more]
C3Z8L45.593e-11939.92Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftcd4.170e-11437.99formimidoyltransferase cyclodeaminase [Source:NCBI... [more]
ftcd9.742e-9334.84formimidoyltransferase cyclodeaminase [Source:NCBI... [more]
zgc:1539011.079e-924.23glutamate formimidoyltransferase-like [Source:NCBI... [more]
zgc:1539011.341e-623.60glutamate formimidoyltransferase-like [Source:NCBI... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ftcd4.218e-9834.29formimidoyltransferase cyclodeaminase [Source:ZFIN... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO458932.371e-11136.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448402.138e-1124.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftcd7.796e-11039.16formimidoyltransferase cyclodeaminase [Source:NCBI... [more]
zgc:1539011.553e-927.04formimidoyltransferase-cyclodeaminase [Source:NCBI... [more]
zgc:1539011.553e-927.04formimidoyltransferase-cyclodeaminase [Source:NCBI... [more]
zgc:1539012.166e-927.04formimidoyltransferase-cyclodeaminase [Source:NCBI... [more]
back to top
BLAST of formimidoyltransferase-cyclodeaminase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000070969.10.000e+099.82SMESG000070969.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002286 ID=SMED30002286|Name=formimidoyltransferase-cyclodeaminase|organism=Schmidtea mediterranea sexual|type=transcript|length=1999bp
TGAGACATATTGTTGAATCATTTAAATCGCGATAATTTAACTGTCGATTA
TTTTATCAGTTTACTGTTGGAAAAGATAAACAGTTCAATACAACTCTGAA
GAATGATTTATGATATTCTCTGTTCACCAAATATTTCTGAAGGACGAAGC
AAGGATGTAATTGAAACCTGCAGCTCAGCTATATCATCAGTTGATGGAGT
AATTCTAATCGATGTTGACTCAAGTCCCACCAACAATAGAACTGTTTTTA
ATTTCGTTGGCAATTCATCTAGTGTAATTGAAGCTGCTTTAAATCTATCT
AGAGCTGCGTACAACTTGATTGATATTTCAAAGCATAAAGGTTACCAGCC
TAGATTAGGAGTGATATCAGCTTGTCCTTTCGTCCCGATCAAAAACGAAG
ACGTTAATAAATGTATAGAAGTTGCCAACGAATTCGCAATTAAACTTGCC
GAAGAAGTAGTGGCTCCAGTTTATATTTATGGTGAGAGCATCACAGATGA
ACAACGAAAGACAGTGATTGAAGAACTATTTGTCACCGAATATGAGGAAC
TCGAAGACAAGATTTCGAAAGATGAGCTGAAACCGGATTTTGGTGTTGCT
GAATTTGTTCCACAATGGGGGGCTACTTTAGTTGGAGCTAGGAAATTTTT
GGTGTACTTTAACATAAATCTATTGGGAACAAAAGAACAAGCAATAACAA
TATCAACTAAACTTGAAGAGATATACAATAAACCAACGGAGAAGTCTAAA
AATGAAGCAATCCAATGTGCTGGCTGGTTTTCTGATGAACTGAATGTTGC
TCAAATTTCCATTAATATAATGGACTTCGAAAAAACGCCAATTCATCAAA
TTTTTAAATCAGCAGAGAATTTAGCAACGGAGGTGAATGCTAGTGTTATT
GGATCTCAAATTGTTGGAGCAGTTCCTTTAAATCTTCTTTTATTTACTGC
CGAACAAATAATGGAATCAGAAAAACTTCTTTTATTAGATGATGATCAAA
AGATAAGATTGGTTATTGGAAAACTTGGACTAAATAGTTTAAGTCCATTC
AATCCCAAAGAAAAAGTGATTGAATATATAGTCGAAGCATCTGAAGAAAA
TAGTGGAAATTCTTCAACTGTCAGTTTAGAAAATGCTCTCTTGAATTTAA
CTCTCGGAGATTTTATTCAAGCTGTTGCTGCTCGAAATTCTACACCGGGA
TTGGGATCTGTCGCTTCATTGGTATCTGTTTTAGGAGCTTCTCTTGCCAC
AATGGGTGGATTACTCAGCTATGGAACGTGCAATCAAACTGATAATGACA
AAAATGAAAAGTTACGAAAGTTGATTCCGGAAATTCATAAAATCAGCAGA
AAGTTACTCCCATTCATTGATAAACACGCCTTATTAGCCTTCGAATATTC
AAAAATTTCATCATTTCCATCGGAATCCGAAAAAGACAAACAAGTGAAAA
AGGAAATGGAAATTAAATCTCTTGAACGTTGCCTTGAATGTTCTCGACAA
GTTGGAGAAATGTTGCATAATTTATGGAGTCCAATATTGGAATTATCTGA
CGTAATTGACCCATCAAAAATTGGCGAATTGAAAATGGCAGGAAATTGCA
TTGCCACTGCTTTGGAAGGGCTGCACTATTTAATATTAACATATCCAGAT
GAAAATAATGTCAAAGTTAAAACTGAAATAGACAAATACAATTCTGAGAG
TAAAATAAATCGTCAAAGCCTGGAAGATAAATTTTCTGAGAAAAATAAAA
CAAAATAGAATTTGCAGTTGTTTTTAATAGGGATATTTTTTTGATTGTAT
TTATTTATCACTTCCTTAGAATTGGTCATGTAATCTATTTGATATTATTT
AGTTAGAAGGCTTTTAGATAATTGCTTGTTTCATTTATATACGCATTCAA
ACAAAGTTTTGAAAATAATATTTATCAAAAAATGTTTTCTATGATATTTT
TTTTTGTTTTTGACGTGAAGTGTTTGAGAATTTTTATTGTCGATGATTG
back to top

protein sequence of SMED30002286-orf-1

>SMED30002286-orf-1 ID=SMED30002286-orf-1|Name=SMED30002286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=552bp
MIYDILCSPNISEGRSKDVIETCSSAISSVDGVILIDVDSSPTNNRTVFN
FVGNSSSVIEAALNLSRAAYNLIDISKHKGYQPRLGVISACPFVPIKNED
VNKCIEVANEFAIKLAEEVVAPVYIYGESITDEQRKTVIEELFVTEYEEL
EDKISKDELKPDFGVAEFVPQWGATLVGARKFLVYFNINLLGTKEQAITI
STKLEEIYNKPTEKSKNEAIQCAGWFSDELNVAQISINIMDFEKTPIHQI
FKSAENLATEVNASVIGSQIVGAVPLNLLLFTAEQIMESEKLLLLDDDQK
IRLVIGKLGLNSLSPFNPKEKVIEYIVEASEENSGNSSTVSLENALLNLT
LGDFIQAVAARNSTPGLGSVASLVSVLGASLATMGGLLSYGTCNQTDNDK
NEKLRKLIPEIHKISRKLLPFIDKHALLAFEYSKISSFPSESEKDKQVKK
EMEIKSLERCLECSRQVGEMLHNLWSPILELSDVIDPSKIGELKMAGNCI
ATALEGLHYLILTYPDENNVKVKTEIDKYNSESKINRQSLEDKFSEKNKT
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037070Formiminotransferase_C_sf
IPR036178Formintransfe-cycloase-like_sf
IPR004227Formiminotransferase_cat
IPR037064Formiminotransferase_N_sf
IPR013802Formiminotransferase_C
IPR012886Formiminotransferase_N
IPR007044Cyclodeamin/CycHdrlase
IPR022384FormiminoTrfase_cat_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0005542folic acid binding
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0044237cellular metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 537..551
NoneNo IPR availablePANTHERPTHR12234FORMIMINOTRANSFERASE-CYCLODEAMINASEcoord: 6..343
NoneNo IPR availablePANTHERPTHR12234:SF0FORMIMIDOYLTRANSFERASE-CYCLODEAMINASEcoord: 6..343
IPR013802Formiminotransferase, C-terminal subdomainSMARTSM01221FTCD_2coord: 182..326
e-value: 1.7E-32
score: 123.9
IPR013802Formiminotransferase, C-terminal subdomainPFAMPF02971FTCDcoord: 182..325
e-value: 1.4E-40
score: 138.6
IPR012886Formiminotransferase, N-terminal subdomainSMARTSM01222FTCD_N_2coord: 5..181
e-value: 2.8E-57
score: 206.3
IPR012886Formiminotransferase, N-terminal subdomainPFAMPF07837FTCD_Ncoord: 5..180
e-value: 4.3E-48
score: 163.4
IPR037070Formiminotransferase, C-terminal subdomain superfamilyGENE3DG3DSA:3.30.70.670coord: 183..327
e-value: 1.3E-36
score: 127.7
IPR036178Formimidoyltransferase-cyclodeaminase-like superfamilyGENE3DG3DSA:1.20.120.680coord: 350..548
e-value: 1.9E-19
score: 71.9
IPR036178Formimidoyltransferase-cyclodeaminase-like superfamilySUPERFAMILYSSF101262Methenyltetrahydrofolate cyclohydrolase-likecoord: 346..513
IPR004227Formiminotransferase catalytic domainTIGRFAMTIGR02024TIGR02024coord: 5..295
e-value: 3.0E-83
score: 277.2
IPR037064Formiminotransferase, N-terminal subdomain superfamilyGENE3DG3DSA:3.30.990.10coord: 4..182
e-value: 1.1E-49
score: 170.4
IPR007044Cyclodeaminase/cyclohydrolasePFAMPF04961FTCD_Ccoord: 350..511
e-value: 8.8E-21
score: 74.5
IPR022384Formiminotransferase catalytic domain superfamilySUPERFAMILYSSF55116Formiminotransferase domain of formiminotransferase-cyclodeaminase.coord: 182..327
IPR022384Formiminotransferase catalytic domain superfamilySUPERFAMILYSSF55116Formiminotransferase domain of formiminotransferase-cyclodeaminase.coord: 5..180