Cystinosin

Overview
NameCystinosin
Smed IDSMED30002267
Length (bp)2797
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cystinosin (SMED30002267) t-SNE clustered cells

Violin plots show distribution of expression levels for Cystinosin (SMED30002267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cystinosin (SMED30002267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cystinosin (SMED30002267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30002267h1SMcG0012444 dd_Smed_v4_4571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002267h1SMcG0012444 dd_Smed_v4_4571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 55.8398 bits (133), Expect = 2.558e-8
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ++ I+E   E+++    TN   F +T + +G + + +         +     +  VIRS  + I+  +IGW YFV+W+ISFYPQ+I+N R+K
Sbjct:   66 NITILELPDEVVVPPGVTNS-SFQVTSQNVGQLTVYLHGNH---SNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRK 153          
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 55.8398 bits (133), Expect = 2.418e-7
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ++ I+E   E+++    TN   F +T + +G + + +         +     +  VIRS  + I+  +IGW YFV+W+ISFYPQ+I+N R+K
Sbjct:   66 NITILELPDEVVVPPGVTNS-SFQVTSQNVGQLTVYLHGNH---SNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRK 153          
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 55.4546 bits (132), Expect = 2.530e-7
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ++ I+E   E+++    TN   F +T + +G + + +         +     +  VIRS  + I+  +IGW YFV+W+ISFYPQ+I+N R+K
Sbjct:   66 NITILELPDEVVVPPGVTNS-SFQVTSQNVGQLTVYLHGNH---SNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRK 153          
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 55.4546 bits (132), Expect = 2.530e-7
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ++ I+E   E+++    TN   F +T + +G + + +         +     +  VIRS  + I+  +IGW YFV+W+ISFYPQ+I+N R+K
Sbjct:   66 NITILELPDEVVVPPGVTNS-SFQVTSQNVGQLTVYLHGNH---SNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRK 153          
BLAST of Cystinosin vs. Ensembl Celegans
Match: ctns-1 (Cystinosin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09500])

HSP 1 Score: 56.9954 bits (136), Expect = 3.411e-8
Identity = 23/48 (47.92%), Postives = 34/48 (70.83%), Query Frame = 3
Query: 1452 EKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKKR 1595
            + +  + ++ VIRSH L IL  I+GW YF +W+ISFYPQ+ LN ++K 
Sbjct:  109 DLEDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRKS 156          
BLAST of Cystinosin vs. Ensembl Celegans
Match: ctns-1 (Cystinosin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09500])

HSP 1 Score: 56.9954 bits (136), Expect = 3.506e-8
Identity = 23/47 (48.94%), Postives = 34/47 (72.34%), Query Frame = 3
Query: 1452 EKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            + +  + ++ VIRSH L IL  I+GW YF +W+ISFYPQ+ LN ++K
Sbjct:  109 DLEDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRK 155          
BLAST of Cystinosin vs. Ensembl Fly
Match: CG17119 (gene:FBgn0039045 transcript:FBtr0084357)

HSP 1 Score: 56.6102 bits (135), Expect = 6.912e-8
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 3
Query: 1389 ITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ITG   G++ +   S D   +  K V+ +V V +S  LI    I GW YFV+W++SFYPQ+  N R+K
Sbjct:   91 ITGLKAGNVKVVADSDDANKEIVKDVFVRVTVAKSRALIYTSIIFGWVYFVAWSVSFYPQIWSNYRRK 158          
BLAST of Cystinosin vs. Ensembl Fly
Match: CG17119 (gene:FBgn0039045 transcript:FBtr0344299)

HSP 1 Score: 56.6102 bits (135), Expect = 6.912e-8
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 3
Query: 1389 ITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ITG   G++ +   S D   +  K V+ +V V +S  LI    I GW YFV+W++SFYPQ+  N R+K
Sbjct:   91 ITGLKAGNVKVVADSDDANKEIVKDVFVRVTVAKSRALIYTSIIFGWVYFVAWSVSFYPQIWSNYRRK 158          
BLAST of Cystinosin vs. Ensembl Zebrafish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:ZFIN;Acc:ZDB-GENE-050522-352])

HSP 1 Score: 59.3066 bits (142), Expect = 1.272e-8
Identity = 34/125 (27.20%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1218 TVRLSNNMSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            T+ LS+ ++  + ++F    +  N ++         I++   E+++   +T+ V F +  K +G +   + S D R K   +   +  ++RS+ L I+  IIGW YFV+W++SFYPQ   N +++
Sbjct:   45 TITLSSPLNTSVTVYFNITYESNNVSL---------IIQLPNEVVVPAGNTS-VSFAVQAKGVGQVTAYLSSNDTRIKSLDA-RIRFLIVRSNALFIINQIIGWIYFVAWSVSFYPQAYENWKRR 158          
BLAST of Cystinosin vs. Ensembl Mouse
Match: Ctns (cystinosis, nephropathic [Source:MGI Symbol;Acc:MGI:1932872])

HSP 1 Score: 51.9878 bits (123), Expect = 2.068e-6
Identity = 29/92 (31.52%), Postives = 50/92 (54.35%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            +L IVE   E+++   + N   F +T + IG + + +         +     +  VI S  + I+  +IGW YF++W++SFYPQ+I N R+K
Sbjct:   66 NLTIVELPDEVIVPRGEKN-ASFQVTSQNIGQVTVFLHGNH---SNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYPQVIQNWRRK 153          
BLAST of Cystinosin vs. Ensembl Mouse
Match: Ctns (cystinosis, nephropathic [Source:MGI Symbol;Acc:MGI:1932872])

HSP 1 Score: 51.9878 bits (123), Expect = 2.068e-6
Identity = 29/92 (31.52%), Postives = 50/92 (54.35%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            +L IVE   E+++   + N   F +T + IG + + +         +     +  VI S  + I+  +IGW YF++W++SFYPQ+I N R+K
Sbjct:   66 NLTIVELPDEVIVPRGEKN-ASFQVTSQNIGQVTVFLHGNH---SNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYPQVIQNWRRK 153          
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|A8WN56|CTNS_CAEBR (Cystinosin homolog OS=Caenorhabditis briggsae OX=6238 GN=ctns-1 PE=3 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.811e-8
Identity = 35/115 (30.43%), Postives = 62/115 (53.91%), Query Frame = 3
Query: 1269 FQLKGENKTVYNQSCLDLQIVEPI--PEILIKFNDTNHVPFN----ITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKKR 1595
            FQ+K    +  NQ+ + L     I  P++++  N   +V  +    + G+ + ++      ++V   +    Y ++ VIRSH L IL  I+GW YF +W++SFYPQ+ LN ++K 
Sbjct:   41 FQIKNHTSSTLNQTRIQLSQSPYITNPDVVLVDNWWANVTVSGERPVAGEILEALNCTTDGEEVCSLDLLDAYSRITVIRSHWLAILIQIVGWTYFAAWSVSFYPQMYLNFKRKS 155          
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|Q09500|CTNS_CAEEL (Cystinosin homolog OS=Caenorhabditis elegans OX=6239 GN=ctns-1 PE=3 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 4.339e-7
Identity = 23/48 (47.92%), Postives = 34/48 (70.83%), Query Frame = 3
Query: 1452 EKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKKR 1595
            + +  + ++ VIRSH L IL  I+GW YF +W+ISFYPQ+ LN ++K 
Sbjct:  109 DLEDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRKS 156          
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|Q9VCR7|CTNS_DROME (Cystinosin homolog OS=Drosophila melanogaster OX=7227 GN=CG17119 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 6.928e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 3
Query: 1389 ITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ITG   G++ +   S D   +  K V+ +V V +S  LI    I GW YFV+W++SFYPQ+  N R+K
Sbjct:   91 ITGLKAGNVKVVADSDDANKEIVKDVFVRVTVAKSRALIYTSIIFGWVYFVAWSVSFYPQIWSNYRRK 158          
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|O60931|CTNS_HUMAN (Cystinosin OS=Homo sapiens OX=9606 GN=CTNS PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.215e-6
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1317 DLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ++ I+E   E+++    TN   F +T + +G + + +         +     +  VIRS  + I+  +IGW YFV+W+ISFYPQ+I+N R+K
Sbjct:   66 NITILELPDEVVVPPGVTNS-SFQVTSQNVGQLTVYLHGNH---SNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRK 153          
BLAST of Cystinosin vs. TrEMBL
Match: K1QAH4 (Cystinosin OS=Crassostrea gigas OX=29159 GN=CGI_10021597 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.915e-11
Identity = 40/102 (39.22%), Postives = 59/102 (57.84%), Query Frame = 3
Query: 1305 QSCLDLQIVE------PIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            Q+  ++Q+VE      PIP I I  N T  V  NIT   +G + LGI S   +F      + ++ ++ S  L+++  IIGW YFV+W+ISFYPQ+  N R+K
Sbjct:   85 QTGDEIQLVETNNYITPIPNISIVANQTKAVSINITSTGVGHLNLGINSSSDQFIGLSQQFVRITIVHSSALVVINSIIGWIYFVAWSISFYPQVFENWRRK 186          
BLAST of Cystinosin vs. TrEMBL
Match: A0A2P2IAW1 (Cystinosin homolog (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.803e-10
Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 3
Query: 1269 FQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKKR 1595
            F+  GE   V + +  D+ I+  I  I+IK   T++V   +  KT+G   +   +           Y +V V  SH L    +++GW YFV+W++SFYPQ  +N ++K 
Sbjct:   17 FEGAGEEDVVISFNISDVAILNSIENIVIKSGHTHNVTVQLEAKTVGHAVIYADANPSNMTNMSEAYVRVSVSHSHNLDYAVEVVGWVYFVAWSVSFYPQTYMNFKRKS 125          
BLAST of Cystinosin vs. TrEMBL
Match: G4VMC2 (Putative cystinosin OS=Schistosoma mansoni OX=6183 GN=Smp_169870 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.143e-8
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 3
Query: 1269 FQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIR-SKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            FQ   +N ++ +    +  ++ PI  + I    +    F I  KT G IYLGI+ +  V+        C V V+    L IL  +IGW YF +WT+SFYPQ ILN R+K
Sbjct:   60 FQYWDQNGSLISLKESNNSVIRPIDNVTIGKMQSGPSNFTIFAKTPGHIYLGIKPTPSVKIVNAGKPICSVTVVHFRWLNILQIVIGWLYFTAWTVSFYPQFILNCRRK 168          
BLAST of Cystinosin vs. TrEMBL
Match: A0A087VZP3 (Cystinosin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000164700 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.417e-8
Identity = 37/123 (30.08%), Postives = 62/123 (50.41%), Query Frame = 3
Query: 1224 RLSNNMSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            RLS    E +    IF     N    + +  D   +EP+    ++         +I     G++ LG+ S D+     + ++ ++ V R  +L IL  I+GW YF++WT+SFYPQ+ILN ++K
Sbjct:    8 RLSVEFREPLPNRSIFTFTYRNSAGAHFNATDKLPIEPLGSFTVESGSNKSYQMSIFTSKPGTVELGLASTDINITHLEYLHARINVCRQKSLSILQQIVGWAYFLAWTLSFYPQVILNCQRK 130          
BLAST of Cystinosin vs. TrEMBL
Match: A0A267DPQ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014488g2 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.555e-8
Identity = 39/125 (31.20%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1218 TVRLSNNMSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            ++RL+ + S    L+F +Q   ++  +  Q   + Q+V P+P + +  N T     NITG   G + +G+ S +  F    SV+ +V V +S  +     ++G  Y V W++SFYPQ +LN R+K
Sbjct:   45 SIRLNQSFSAGDYLYFTYQADSQSPVLPYQ---EHQVVLPLPAVYLPPNAT-AAELNITGWDAGRLSIGVNSTNPDFFNNHSVFVRVTVAKSDVIDDFNFVVGILYVVLWSMSFYPQTVLNYRRK 165          
BLAST of Cystinosin vs. Ensembl Cavefish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:103043999])

HSP 1 Score: 58.9214 bits (141), Expect = 1.289e-8
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1338 IPEILIKFNDTNHVPFNITGKTIGSI--YLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            +PE +I       V F +  K +G +  YL   + D+   E      +  V+RS+TL ++  IIGW YF++W+ISFYPQ   N R+K
Sbjct:   75 LPEEVILSAGNTSVTFEVQAKKVGQVTAYLFSNTTDI---ESMRTRIRFLVVRSNTLAVINQIIGWIYFLAWSISFYPQAYENWRRK 158          
BLAST of Cystinosin vs. Ensembl Cavefish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:103043999])

HSP 1 Score: 58.9214 bits (141), Expect = 1.289e-8
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1338 IPEILIKFNDTNHVPFNITGKTIGSI--YLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            +PE +I       V F +  K +G +  YL   + D+   E      +  V+RS+TL ++  IIGW YF++W+ISFYPQ   N R+K
Sbjct:   75 LPEEVILSAGNTSVTFEVQAKKVGQVTAYLFSNTTDI---ESMRTRIRFLVVRSNTLAVINQIIGWIYFLAWSISFYPQAYENWRRK 158          
BLAST of Cystinosin vs. Ensembl Nematostella
Match: EDO46894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ1])

HSP 1 Score: 48.9062 bits (115), Expect = 3.955e-6
Identity = 19/48 (39.58%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 1449 KEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
                 ++  V+V+    L I+  +IGW YF +W++SFYPQ+ILN ++K
Sbjct:    1 SNGTGIHVTVRVVHYAPLTIINAVIGWIYFAAWSVSFYPQVILNWKRK 48          
BLAST of Cystinosin vs. Ensembl Medaka
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:101155673])

HSP 1 Score: 55.0694 bits (131), Expect = 2.384e-7
Identity = 30/96 (31.25%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1305 QSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
             S L+   +  +P+ L+    +  + FN+    +G +   + S         SV  +  VI S  L +L  +IGW YFV+W++SFYPQ   N R+K
Sbjct:  188 SSKLNFSSIISLPDQLLLPAGSTSLTFNVMAHEVGQVTSYLLSNGTNLPSW-SVRIRFMVIHSSVLSVLSQVIGWIYFVAWSVSFYPQAWENWRRK 282          
BLAST of Cystinosin vs. Planmine SMEST
Match: SMESG000079054.1 (SMESG000079054.1)

HSP 1 Score: 239.965 bits (611), Expect = 2.739e-71
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 3
Query: 1239 MSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 1592
            MSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK
Sbjct:    1 MSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFNITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYFVSWTISFYPQLILNIRKK 118          
The following BLAST results are available for this feature:
BLAST of Cystinosin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CTNS2.558e-832.61cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS2.418e-732.61cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS2.530e-732.61cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS2.530e-732.61cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctns-13.411e-847.92Cystinosin homolog [Source:UniProtKB/Swiss-Prot;A... [more]
ctns-13.506e-848.94Cystinosin homolog [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of Cystinosin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG171196.912e-841.18gene:FBgn0039045 transcript:FBtr0084357[more]
CG171196.912e-841.18gene:FBgn0039045 transcript:FBtr0344299[more]
back to top
BLAST of Cystinosin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctns1.272e-827.20cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cystinosin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ctns2.068e-631.52cystinosis, nephropathic [Source:MGI Symbol;Acc:MG... [more]
Ctns2.068e-631.52cystinosis, nephropathic [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Cystinosin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|A8WN56|CTNS_CAEBR2.811e-830.43Cystinosin homolog OS=Caenorhabditis briggsae OX=6... [more]
sp|Q09500|CTNS_CAEEL4.339e-747.92Cystinosin homolog OS=Caenorhabditis elegans OX=62... [more]
sp|Q9VCR7|CTNS_DROME6.928e-741.18Cystinosin homolog OS=Drosophila melanogaster OX=7... [more]
sp|O60931|CTNS_HUMAN1.215e-632.61Cystinosin OS=Homo sapiens OX=9606 GN=CTNS PE=1 SV... [more]
back to top
BLAST of Cystinosin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QAH43.915e-1139.22Cystinosin OS=Crassostrea gigas OX=29159 GN=CGI_10... [more]
A0A2P2IAW15.803e-1031.19Cystinosin homolog (Fragment) OS=Hirondellea gigas... [more]
G4VMC21.143e-836.70Putative cystinosin OS=Schistosoma mansoni OX=6183... [more]
A0A087VZP31.417e-830.08Cystinosin OS=Echinococcus multilocularis OX=6211 ... [more]
A0A267DPQ91.555e-831.20Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cystinosin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctns1.289e-836.78cystinosin, lysosomal cystine transporter [Source:... [more]
ctns1.289e-836.78cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cystinosin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cystinosin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO468943.955e-639.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cystinosin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctns2.384e-731.25cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079054.12.739e-71100.00SMESG000079054.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002267 ID=SMED30002267|Name=Cystinosin|organism=Schmidtea mediterranea sexual|type=transcript|length=2797bp
GAACCGTATATTCAAAATATAATATTATAATTTTATGATTTAATTTTTTA
TACTAATTTATTTTAGAAGTTTCGATTAATATATTTATTGGTATTAAATG
GAACTATATATTTTAATAAAGATTCTGTTTTTATTTTTAATACAATCTGT
ATTTACTGTTCAAACCACTGAAAGAAATACAACAACTGCTAAATTTCAAT
CAAAAAAAGTTTTAATTGAAATAAAAGAAACATATAATAATAGTTTATAT
TTAGAGTCTGTTTAAAAATTGTGTTTTTATACGTTTTAGGTACCTAAGCC
AAATAATGTTTGATGTGTAAACCATATTTCGATTAAAATTTTTAAAACTA
TTATATAAGGGAACGTCCCTCCAAAAATAAGCAATTTTTGACCCTTCTCT
TAATTCATTGAGCTTGGAATATCAGTAACACTAAAATTGTTTTTTATATT
AAATATTCTTTTAGAACTGACACTCATAATTCCAACAAATTTTTATTTTT
AATTTTCCTGATATTTCAATTGGACTGCTGGCTTTGATTTTTAATTATGA
GAAAAATGGATGAATTATTTATTTGGACTTTGAGTTGGGCGACGAAATCA
CGAAAAAAAAATAATCATGAATTAAAAAAACGACAATATCCCGAATTTTT
AAATAAGATCGTAATCTTGTAACTTAATTAAAGGAAGGTGACACAGATGA
AGTTATTGTTTGTGAATTAGGCGGTATTATTAATGTAATGACAACCTCTT
TTGGTTCAATGTCTGATTGATGTGATAAATCTGGAAGCTCTGGGAAAAAT
TCTTCGGAAACTTCAGTCGACAGAAAAGCCAAATCTTTACTTTCTCGGAC
TTTCCATTGTTTTCCTTCAAAAACAAAGTTTATCTTTTTTGCAACTTTTT
TGATTGAATCCTTCCATTTCGTAAAACTAAAAAAATGTGATGTTGAGTGC
CTGACAATTATTTTACAATGGATTGTTAAACTTACTTATGGTTAATCAAT
TTAAAAGTTTTATATACCTATTAATTTAATTTAACACTAAAAATTCAAAT
TTAAATAATGTAAATAAATTGTAATTTTGTTAAAACCAAATTTAGTCACA
ACTATCATCCAGATTCGGGATTTTGTCGCCACACGATAATAAGTTGCCGG
TTTATGTACCTAAAACAAAAGATGAATAGACATTTTCTCAATTAATTTGT
GACTTTAATTTAGAAATACGGTTCGTCTTTCTAATAACATGAGTGAAATT
ATAAAATTGTTTTTTATTTTTCAATTAAAAGGAGAAAACAAAACTGTTTA
TAATCAGTCATGTTTAGATTTACAAATTGTTGAGCCGATTCCTGAGATAT
TAATAAAATTTAATGATACAAATCACGTTCCATTTAATATAACGGGAAAA
ACAATAGGTTCAATTTATTTAGGTATTAGAAGTAAAGATGTTAGATTCAA
GGAGAAGAAATCTGTTTATTGCCAAGTGCAAGTTATACGTTCACATACTT
TGATAATTCTTGGCGACATCATTGGGTGGTTTTATTTTGTTTCATGGACT
ATCTCCTTTTATCCGCAACTGATACTTAATATACGCAAGAAAAGAAAGCA
TGAAAAAGAAAGCATAAGAATACAAAGAAGAGTTCGGTATTTCAGAGAAT
AATCGTGTATCATTAACAATGGAAAAATGGTTGCAATTGATTAAAACATC
TCTAAAACCTTAATCGCTAAATGATCAAAAAATAAACATGTGACAACTAA
AAATCTGAACTATTTAATAAACGTATATGCAATTATCGATTTTTCAAATA
TATTAATTTAAGTGAATATTTGTCGACTTTTCGTATCATTGCTAGCGTAT
AGCTTTATAATTTACAGATTAGAGGCTAACAGAACAATAGTGGCGTGACC
TGATTGTACAATACAAGAATATTCATCTCTCTCATCAACTATATTGTTTC
AAAATATTTCCAAACCCACGAATATATTCCGTTTTGCAGAACTATGTATA
CTCATATGCATACCTCATACTACGACTGAAAGAAGTATGAGGCCAGGAAG
ATTACCTATAACAATGCCAGAAAATTAGGAATATCCTAATAATTTATATT
CAAAAACTTTCACTCAAACGGCCTTTGCTCTTACAAAAACAAAAATTTAC
AGCAAAGCAGCTCATTATTCAAAAGCTCTGACTTGACTGTCTTTATCACG
AAATTTTATTAAGAAATCTGGAATCAACATTTATTCTGGACGAGTCATAT
TTTACATTTTCTGGAATCAACATGCCTAAAAATAATCATTCTTATTTAAC
AGCATGTAGGTTTACGAAAAATAGCCTTAAGTTTCGTTCTCAGTCAAAGT
TCCAAAATAAAGTGATGTACTGGATTACAGTCAGTGATCGCAGGATTTCA
AAGCCAAGCGTATTCGACAACACTTTCCATTTATCCATTCTCATCACGAG
GACAACAATACATCTGGCCAGATCTTCATGTCATTACGCTTTATCAACCA
TGGACATTTTTGATGAGCTCGATATTGAAGTAGTACCCAAAGACAAGAAT
TCCCAAAATTATCCACAGAGGATTTTTGGGGCATTCTCAAGCAGTCAGTA
AATGCCAAGGGCTGAGTGACAAGTACCCATGCATGAATACAACATCTCAT
TAAGTTTTGTTTAATGAAGGTTGATGTACAGATTGTACAGAAAATGATGC
TTTCAGTTAAGACCAAGATTATTAGAGCCCGAGCTTTTGGAATAGAAAAT
CAAGTTCACAAAGGCATATGTCTTATATTGAGTGTATTTAAATGTGC
back to top

protein sequence of SMED30002267-orf-1

>SMED30002267-orf-1 ID=SMED30002267-orf-1|Name=SMED30002267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=138bp
MSEIIKLFFIFQLKGENKTVYNQSCLDLQIVEPIPEILIKFNDTNHVPFN
ITGKTIGSIYLGIRSKDVRFKEKKSVYCQVQVIRSHTLIILGDIIGWFYF
VSWTISFYPQLILNIRKKRKHEKESIRIQRRVRYFRE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005282LC_transporter
IPR006603PQ-loop_rpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006603PQ-loop repeatPFAMPF04193PQ-loopcoord: 92..118
e-value: 3.4E-7
score: 29.9
IPR005282Lysosomal cystine transporterPANTHERPTHR13131CYSTINOSINcoord: 79..118
NoneNo IPR availablePANTHERPTHR13131:SF5CYSTINOSINcoord: 79..118
NoneNo IPR availableTMHMMTMhelixcoord: 94..113