Heat shock cognate 71 kDa protein

Overview
NameHeat shock cognate 71 kDa protein
Smed IDSMED30002262
Length (bp)2265
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock cognate 71 kDa protein (SMED30002262) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock cognate 71 kDa protein (SMED30002262) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock cognate 71 kDa protein (SMED30002262) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock cognate 71 kDa protein (SMED30002262) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002262

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002262SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 SmedASXL_013802SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002262SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 SmedASXL_013802SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30002262SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002262SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002262SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002262SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30002262SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002262SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002262SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 515/611 (84.29%), Postives = 558/611 (91.33%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGETKTFFPEEISSMVL KMKEIAEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  +DR+A KN+LESY Y +K TVEDEKL+ KISE D+  I+DKCQE INWL++NQ A K+E+E+  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 515/611 (84.29%), Postives = 558/611 (91.33%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGETKTFFPEEISSMVL KMKEIAEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  +DR+A KN+LESY Y +K TVEDEKL+ KISE D+  I+DKCQE INWL++NQ A K+E+E+  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 516/608 (84.87%), Postives = 559/608 (91.94%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETG-RPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
             +GIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+ +VQSDMKHW F VI+  G +PK++VE+KGE K F PEEISSMVL+KMKE AEA+LG TVKDAVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA++EIDSL+EGIDFYT+ITRARFEEL ADLFRST++PVEK+LRDAK+DK+ +HDIVLVGGSTRIPK+QKLL DLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTK  Q FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSKDDIERMVNEAEKYK +DE QKDRI  KN LESYA+ +K T+EDEKLKDKIS  D+K I DKC E + WL+ NQ A KEEFE+  K+LE L NPI++K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 516/608 (84.87%), Postives = 559/608 (91.94%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETG-RPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
             +GIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+ +VQSDMKHW F VI+  G +PK++VE+KGE K F PEEISSMVL+KMKE AEA+LG TVKDAVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA++EIDSL+EGIDFYT+ITRARFEEL ADLFRST++PVEK+LRDAK+DK+ +HDIVLVGGSTRIPK+QKLL DLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTK  Q FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSKDDIERMVNEAEKYK +DE QKDRI  KN LESYA+ +K T+EDEKLKDKIS  D+K I DKC E + WL+ NQ A KEEFE+  K+LE L NPI++K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 449/647 (69.40%), Postives = 526/647 (81.30%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
             IGIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FDES+VQSD KHW F V  + G+P I VE KGE + F PEEIS+MVL KMKE AE YLG TVKDAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEKALRDAKLDK+ I ++VLVGGSTR+PKIQKLL+D FNGKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  + FTTY+DNQPGV IQVYEGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV+EA++++KED EQ++R+  +N LE+YA+Q+K  +++     K+S  D     +   E + WL+ N  A K+E E   KEL+ +C  I+TKM+Q        +       G PG AG       QGPTVEEVD
Sbjct:    6 AIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ-----SGQSSASAGCAGNPGTAGFNPNNYPQGPTVEEVD 645          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 449/647 (69.40%), Postives = 526/647 (81.30%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
             IGIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FDES+VQSD KHW F V  + G+P I VE KGE + F PEEIS+MVL KMKE AE YLG TVKDAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEKALRDAKLDK+ I ++VLVGGSTR+PKIQKLL+D FNGKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  + FTTY+DNQPGV IQVYEGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV+EA++++KED EQ++R+  +N LE+YA+Q+K  +++     K+S  D     +   E + WL+ N  A K+E E   KEL+ +C  I+TKM+Q        +       G PG AG       QGPTVEEVD
Sbjct:    6 AIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ-----SGQSSASAGCAGNPGTAGFNPNNYPQGPTVEEVD 645          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 449/647 (69.40%), Postives = 526/647 (81.30%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
             IGIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FDES+VQSD KHW F V  + G+P I VE KGE + F PEEIS+MVL KMKE AE YLG TVKDAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEKALRDAKLDK+ I ++VLVGGSTR+PKIQKLL+D FNGKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  + FTTY+DNQPGV IQVYEGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV+EA++++KED EQ++R+  +N LE+YA+Q+K  +++     K+S  D     +   E + WL+ N  A K+E E   KEL+ +C  I+TKM+Q        +       G PG AG       QGPTVEEVD
Sbjct:    6 AIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ-----SGQSSASAGCAGNPGTAGFNPNNYPQGPTVEEVD 645          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 507/606 (83.66%), Postives = 559/606 (92.24%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE+QK+ IA KN LESY + MK+T++++ LK KIS+SDR  I+DKC E I WL+ NQ A KEE+E+  KELE +CNPI+TK+YQ
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 507/606 (83.66%), Postives = 559/606 (92.24%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE+QK+ IA KN LESY + MK+T++++ LK KIS+SDR  I+DKC E I WL+ NQ A KEE+E+  KELE +CNPI+TK+YQ
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 507/606 (83.66%), Postives = 559/606 (92.24%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE+QK+ IA KN LESY + MK+T++++ LK KIS+SDR  I+DKC E I WL+ NQ A KEE+E+  KELE +CNPI+TK+YQ
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 507/606 (83.66%), Postives = 559/606 (92.24%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE+QK+ IA KN LESY + MK+T++++ LK KIS+SDR  I+DKC E I WL+ NQ A KEE+E+  KELE +CNPI+TK+YQ
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 507/606 (83.66%), Postives = 559/606 (92.24%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE+QK+ IA KN LESY + MK+T++++ LK KIS+SDR  I+DKC E I WL+ NQ A KEE+E+  KELE +CNPI+TK+YQ
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1045.8 bits (2703), Expect = 0.000e+0
Identity = 534/609 (87.68%), Postives = 570/609 (93.60%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I WL+KNQ A +EEFE+  KELEK+CNPI+TK+YQ
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 617          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 534/609 (87.68%), Postives = 570/609 (93.60%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I WL+KNQ A +EEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 534/609 (87.68%), Postives = 570/609 (93.60%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I WL+KNQ A +EEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 534/609 (87.68%), Postives = 570/609 (93.60%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I WL+KNQ A +EEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1044.65 bits (2700), Expect = 0.000e+0
Identity = 534/609 (87.68%), Postives = 570/609 (93.60%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I WL+KNQ A +EEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1048.88 bits (2711), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 576/609 (94.58%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 617          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 547/648 (84.41%), Postives = 590/648 (91.05%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ AGGA +G                       GPT+EEVD
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGAPSGGAS-------------------SGPTIEEVD 632          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 576/609 (94.58%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    5 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 576/609 (94.58%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:   12 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 620          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 576/609 (94.58%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 1001.89 bits (2589), Expect = 0.000e+0
Identity = 513/611 (83.96%), Postives = 558/611 (91.33%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGE KTFFPEEISSMVL KMKEIAEAYLG  V+ AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  +DR+A KN++ESY Y +K TVEDEKL+ KISE D+  I+DKCQE INWL++NQ A K+E+E+  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 1001.89 bits (2589), Expect = 0.000e+0
Identity = 513/611 (83.96%), Postives = 558/611 (91.33%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGE KTFFPEEISSMVL KMKEIAEAYLG  V+ AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  +DR+A KN++ESY Y +K TVEDEKL+ KISE D+  I+DKCQE INWL++NQ A K+E+E+  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 518/609 (85.06%), Postives = 557/609 (91.46%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGK                   ATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E I+WL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK-------------------ATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 593          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 508/609 (83.42%), Postives = 556/609 (91.30%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKF++  VQSDMK W F VINE G+PK+ V +KGE K F+PEEISSMVL KMKE AEA+LG  V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK    ER+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HF++EFKRKHKKDIS NKRAVRRLRTACERAKRTLSSS QANLEIDSLYEGIDFYTSITRARFEEL ADLFR TLEPVEK+LRDAK+DK  IHDIVLVGGSTRIPK+QKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVAPLSLG+ETAGGVMT LIKRN+TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT+DNNLLG+F+L GIPPAPRGVPQIEVTFDIDANGILNV+A++K TGK NKITITNDKGRLSK++IERMV EAE+YK EDE Q+++IA KN+LESYA+ MKS V DE LKDKISESD+K I+DKC E ++WLE NQ A K+EF++  KELE +CNPI+TK+YQ
Sbjct:    6 GMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQ 614          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|Q71U34|HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus OX=9490 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|Q5NVM9|HSP7C_PONAB (Heat shock cognate 71 kDa protein OS=Pongo abelii OX=9601 GN=HSPA8 PE=2 SV=2)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLAKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|P11142|HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|A2Q0Z1|HSP7C_HORSE (Heat shock cognate 71 kDa protein OS=Equus caballus OX=9796 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|P19120|HSP7C_BOVIN (Heat shock cognate 71 kDa protein OS=Bos taurus OX=9913 GN=HSPA8 PE=1 SV=2)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/609 (88.01%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KI++ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: B0LVF7 (Heat shock protein 70 OS=Dugesia japonica OX=6161 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 1068.91 bits (2763), Expect = 0.000e+0
Identity = 560/648 (86.42%), Postives = 598/648 (92.28%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FD+++VQSDMKHWSFDV+ E GRPKI+V +KGE K FFPEEISSMVL+KMKE AE YLG+ V DAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+QEFKRKHKKDISDNKRAVRRLRTACERA+RTLSSSAQAN+EIDSLYEGIDFYTS+TRARFEELNADLFRSTLEPVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQDLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSA+EK TGKENKITI+NDKGRLSKDDIERMVNEAEKYK++DE QKDR+A KN+LES +YQMK+T+EDEKLKDK+SESDRK IIDKC E I WL+ NQ A KEE+E+H KELEK+CNPIMTK YQ +GG   G       G     A G  G   QGPT+EEVD
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRRFDDATVQSDMKHWSFDVVCEGGRPKIQVNYKGELKKFFPEEISSMVLLKMKETAEGYLGRPVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDISDNKRAVRRLRTACERARRTLSSSAQANIEIDSLYEGIDFYTSMTRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAIEKSTGKENKITISNDKGRLSKDDIERMVNEAEKYKQQDELQKDRVAAKNALESCSYQMKTTMEDEKLKDKLSESDRKTIIDKCSEVIGWLDHNQTAEKEEYEHHQKELEKVCNPIMTKFYQASGGMPGGFPGAAGGGPGAPGAHGTAG---QGPTIEEVD 648          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A3M0ITR5 (Uncharacterized protein OS=Hirundo rustica rustica OX=333673 GN=DUI87_31564 PE=4 SV=1)

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 539/609 (88.51%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+S VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KIS+ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:  372 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVVNDAGRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKISDDDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 980          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A1D5PYK0 (Heat shock cognate 71 kDa protein OS=Gallus gallus OX=9031 GN=HSPA8 PE=3 SV=2)

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 539/609 (88.51%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+S VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KIS+ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVVNDAGRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKISDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A1V4J7W8 (Heat shock cognate protein isoform B OS=Patagioenas fasciata monilis OX=372326 GN=HSPA8 PE=4 SV=1)

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 538/609 (88.34%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+S VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDI++NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KIS+ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:  412 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVVNDAGRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDITENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKISDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 1020          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A1U7RUB7 (heat shock cognate 71 kDa protein isoform X2 OS=Alligator sinensis OX=38654 GN=HSPA8 PE=3 SV=1)

HSP 1 Score: 1052.74 bits (2721), Expect = 0.000e+0
Identity = 539/609 (88.51%), Postives = 575/609 (94.42%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+S VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE+Q+D+++ KNSLESYA+ MK+TVEDEKL+ KIS+ D++ I+DKC E INWL+KNQ A KEEFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVVNDAGRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKISDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 573/609 (94.09%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F VIN++ RPK++VE+KGETK F+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK++IERMV +AEKYK ED+ Q+D++A KN LESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A K+EFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 1039.64 bits (2687), Expect = 0.000e+0
Identity = 528/609 (86.70%), Postives = 571/609 (93.76%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+FD+  VQSDMKHW F VIN++ RPK++V++KGE K+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSA +K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KNSLESYA+ MKSTVEDEKLK KIS+ D++ I+DKC E I+WL+KNQ A ++EFE+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDEKLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 528/609 (86.70%), Postives = 574/609 (94.25%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            GT +GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+F+++ VQSDMKHW F VI++ GRPK+ VE+KGETK F+PEEISSMVL+KMKEIAEAYLGK++ +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAKLDK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KNSLESYA+ MKSTVED+KL+ KIS+ D++ I+DKC E I+WL+KNQ A KEE+E+  +ELEK+CNPI+TK+YQ
Sbjct:    4 GTAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFKVISDGGRPKVEVEYKGETKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDDKLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 519/609 (85.22%), Postives = 565/609 (92.78%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGR+FD++ VQSDMKHW F V+++ G+PK+ VE+KGE KTF+PEE+SSMVL KMKEI+EAYLGK V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK KKDI+ NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELN+DLFR TL+PVEKALRDAKLDK  IHDIVLVGGSTRIPKIQKLLQD FNG++LNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNN+LGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EA++Y+ EDE Q++++  KN+LES A+ MKSTVEDEKLKDKIS  D+K I+DKC E I WL++NQ A KEE+E+  KELEK+CNPI+TK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFKVVSDGGKPKMEVEYKGEIKTFYPEEVSSMVLTKMKEISEAYLGKPVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNSDLFRGTLDPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTSKNTLESLAFNMKSTVEDEKLKDKISAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 515/648 (79.48%), Postives = 578/648 (89.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNT+FDAKRLIGR+FD++ VQSDMK W F VI++ G+PK+ VE+KGE KTF+PEEISSMVL+KM+EI+EAYLG+ V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK    ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMV HF++EFKRKHKKDI+ NKRAVRRLRTACERAKRTLSSS QA++EIDSL++GIDFYTSITRARFEELN++LFR TLEPVEKALRDAK+DK+ IHDIVLVGGSTRIPKIQKLLQ+ FNG++LNKSINPDEAVAYGAAVQAAIL GD SE VQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIP KQTQIF+TYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSA++K TGKENKITITNDKGRLSK++IERMV EA+KY+ EDE Q++++A KN+LESYA+ +K++VE+EKLK KISE D+K +IDKC+E I WLE NQ A KEE+E++ KELE +CNPI++K+YQ            G    +         +  QGPT+EE+D
Sbjct:    4 GVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDAVVQSDMKLWPFKVISDGGKPKVEVEYKGEVKTFYPEEISSMVLVKMREISEAYLGQRVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVQHFVEEFKRKHKKDITQNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFDGIDFYTSITRARFEELNSELFRGTLEPVEKALRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQEFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPNKQTQIFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIDKSTGKENKITITNDKGRLSKEEIERMVQEADKYRAEDEIQREKVAAKNNLESYAFNVKNSVEEEKLKGKISEDDKKKVIDKCKEVITWLENNQLAEKEEYEHYQKELESVCNPIISKLYQ------------GGMPPSGSCGAQAEPSSSQGPTIEEID 639          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 399/611 (65.30%), Postives = 501/611 (82.00%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVE-FKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVED-EKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMY 2061
            GTVIGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFDAKRLIGR + + +VQ D+K W F V+ + G+P I+VE   GE+KTF PEEIS+MVL KMKE AEAYLGK V  AVVTVPAYFND+QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ HFI+ +K+K  KD+  + RAV++LR   E+AKRTLS+  QA ++I+S Y+G DF  ++TRA+FEELN DLFRST++PV+K + D+ L K  I +IVLVGGSTRIPKIQ+L+++LFNGKE ++ INPDEAVAYGAAVQA +LSG+ +    DL+LLDV PL+LGIET GGVMT LI RNT +PTK++QIF+T +DNQP V IQV+EGER MTKDN+LLGKF+L GIPPAPRGVPQIEVTF+ID NGIL VSA +KGTG +NKITITND+ RL+ ++IERMV++AE++  +D+  K+R+  +N LESYAY +K+ + D EKL  K+S+ DR+ +    ++ I WLE +Q+A  ++F+   KELE++  PI++K+Y
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEG-EKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTG--DLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 320/617 (51.86%), Postives = 435/617 (70.50%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVE--------DE--KLKDKISESDRKLIIDKCQEAINWLEKN----QQATKEEFEYHYKEL 2025
            G VIGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D ERL+G  AK Q   NPNNT +  KRLIGR+FD+S VQ DM + S+ ++  +      VE  G  K + P +I + VL+KMKE AE ++G +VK+AV+TVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFDN ++ + ++EFKR+   D++ +  A++R+R A E+AK  LSSS Q ++ +   Y  +D          +TR++FE +  DL R T+ P +KAL+D ++ K+ I D++LVGG TR+PK+Q+ +Q++F G+  +K++NPDEAVA GAA+Q  +L+GD    V D+LLLDV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN  LG+F L G+PPAPRGVPQIEVTFDIDANGI++VSA +KGTG+E +I I +  G LSKD+IE MV  AEKY +ED  +KDR+   N  E   + ++S +E        DE  KLK++I++  R+L+  K  E    +++     QQ++ + FE  YK++
Sbjct:   53 GAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRAS-NGDAWVEAHG--KMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--ADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLP--YLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVF-GRAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEEFKDQLPADECTKLKEEIAKV-RELLTRKDTETGEAIKQAASTLQQSSLKLFEMAYKKM 655          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 283.493 bits (724), Expect = 3.169e-87
Identity = 167/504 (33.13%), Postives = 270/504 (53.57%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAER-NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKS-----EAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEG-ERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITI 1737
            +G+ LG+T +CV +++ G+ ++IAND G+R TP+ VAF D+E+++G AAK     N   TV   KR++G +F++  VQ  +   S  VI + G P   +      K     E+++++L KMKE A   +G   KDAV+T P  F   Q    + A   +G NVLRI++EP AA +A+G+ ++    +  VL++ LGG     + + +  G++ V  +  D  +GGE+F   +  +   EF++ H++D+  N RA+ +L T  E AK  LS+ A +N  +DSL++G+DF  +ITRARF+ L + LF+ +L+P+   L    L  +    +VL GGS RIPK+Q+LLQ+ F G EL  SI  DE +A GAA +A IL G  +     EA+          +    E      T +    T +P ++   F       P VL+ VYEG  +  + +   L +  L  +     G+  I   F +  +G L ++  ++ +G    +T+
Sbjct:    4 VGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAEAGILLGRDAVRFEPEALSIECASLDILVKEQDEAGQDCYTVVFPVGTPLPARRQHTFQA-PGTLPSVLVDVYEGVAKGSSFEGVHLAQLVLKDLQQQDNGLRDISTVFTMKRDGSLLITCTDQLSGTSETVTV 506          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 248.44 bits (633), Expect = 1.456e-74
Identity = 154/423 (36.41%), Postives = 234/423 (55.32%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVE-FKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKH---------------------KKDISDNKRAVRRLR----------TACERA------KRTLSSSAQAN-----LEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSG 1374
            ++GIDLGTTY  +GV+  G  +VE++A+  G R  PS VA  +D   L G  A  Q A NP+ T++DAKR IGR F    ++ +   + F V   +G     +    G  +T  PE + + +L +++ +AE  LG  V+ AV+ VPA F++ QR +T  A  ++GL VLR++NEPTAAA+AYGL ++     +VL+ DLGGGT DVS+LT + G+F  ++ AG+ HLGG+DF  R+V H       +H                     K +++ N RA   LR            C         +R L +   A+     L++   +  ++   ++TR  FE LN DLF+  +EP+ + LR  +L    +  +VLVGGSTRIP+++++L D F G E + S++P+ AV  G AVQA +L+G
Sbjct:   33 IVGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVS-SVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYF-GSEPDTSVDPELAVVTGVAVQAGVLAG 453          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 4.630e-6
Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 1
Query: 1123 RARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDE 1329
            R  FE+ +A LF   + PV + L+ A L  + +  I L+GG  RIPKIQ++L       +L   +N DE
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEMLIQTLQKNDLGVHLNGDE 69          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 478/646 (73.99%), Postives = 552/646 (85.45%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
             +GIDLGTTYSCV  F + +V+IIANDQGNRTTPS+VAFTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGR F++  VQ+DMKH+ F +I+  G+P+I+VEFKGETK F PE+ISSMVL KMKE AE+YLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E +VLIFDLGGGTFDVS+L+IEDGIFEVK+TAGDTHLGGEDFDNR+VNHFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTL+PVEK LRDAKLDK+ + +IVLVGGSTRIPK+QKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RN+TIPTK+++IF+TY+DNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQIEVTFD+D+NGILNVSAVEKGTGK NKITITNDKGRLSK+DIE+MV EAEK+K+EDE++  RIA KN LES AY +K+T+ +    DK+ ++D+  +  K +E I+WL+ N  A+KEEF+   KEL+ + NPIM+K+YQ  G  G  A                     +GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK-GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISE--AGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEA----EGPTVEEVD 642          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 479/646 (74.15%), Postives = 551/646 (85.29%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
             +GIDLGTTYSCV  F + +V+IIANDQGNRTTPS+V FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR F++  VQ DMKH+ F +I+  G+P+I+VEFKGETK F PE+ISSMVL KMKE AE+YLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E +VLIFDLGGGTFDVS+L+IEDGIFEVK+TAGDTHLGGEDFDNR+VNHFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTL+PVEK LRDAKLDK+ + +IVLVGGSTRIPK+QKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RN+TIPTK++++F+TY+DNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQIEVTFD+D+NGILNVSAVEKGTGK NKITITNDKGRLSK+DIE+MV EAEK+K+EDE++  RIA KN LES AY +K+T+ +    DK+ ++D+  +  K +E I WL+ N  ATKEEF+   KEL+++ NPIM+K+YQ  G     A  G   G  P           +GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK-GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISE--AGDKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQAGGAPEGAAPGGFPGGAPPAPEA-------EGPTVEEVD 639          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 886.715 bits (2290), Expect = 0.000e+0
Identity = 473/646 (73.22%), Postives = 549/646 (84.98%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
             +GIDLGTTYSCV  F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ A+NP+NTVFDAKRLIGRKFD+  V +D KH+ F VI+  G+P ++VE+KGETKTF PEEISSMVL KMKE AE YLG TV DAVVTVPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAAIAYGLDKK  AE NVLIFDLGGGTFDVS+L+I++G+FEVK+TAGDTHLGGEDFDNR+VNH   EFKRK KKDIS+N+R++RRLRTA ERAKR LSSS+Q ++EIDSL+EG+DFYTS+TRARFEEL ADLFRSTLEPVEK L+D+KLDK+ I +IVLVGGSTRIPKIQKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RN+TIPTK+++ F+TY+DNQPGVLIQV+EGER  TKDNNLLGKFEL+GIPPAPRGVPQI+VTFDIDANGILNVSA+EKGTGK NKITITNDKGRLSKDDI+RMV+EAEKY+ +DE + +R+  KN LESYA+ +K+T+ +   K+K+ E D K +    QE I+WL+ +Q A+ +E++   KELE + NPIMTK Y    GAG GA   G   G+   +G  GG    GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFYGAGAGAGPGAGESGGFPGSMPNSGATGGGEDTGPTVEEVD 649          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 454/606 (74.92%), Postives = 530/606 (87.46%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMY 2061
             +GIDLGTTYSCV  F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGRKFD+  V +D KH+ F VI++ G+P ++VE+KGETKTF PEEISSM+L KMKE AE +LG  VKDAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E NVLIFDLGGGTFDVS+L+I++G+FEVK+TAGDTHLGGEDFD+R+VN   +EFKRK+KKD++ N+R++RRLRTA ERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTLEPVEK L D+KLDK+ I +IVLVGGSTRIPK+QKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RN+TIPTK++++F+TY+DNQPGVLIQV+EGER  TKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGK NKITITNDKGRLSK+DI++MV EAEK+K EDE++  R+  KN LESYA+ +K++V +   K+K+ E D + +    Q+AINWL+ +Q A+ EE++   KELE + NPIM+K Y
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFY 609          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 384/610 (62.95%), Postives = 486/610 (79.67%), Query Frame = 1
Query:  235 YGTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKN-QQATKEEFEYHYKELEKLCNPIMTKMY 2061
            YGTVIGIDLGTTYSCV V ++GK EI+AN+QGNR TPSYVAFTD ERLIGDAAKNQVA NP NT+FD KRLIG K+++ SVQ D+KH  F+V+N+ G+P + V  KGE K F PEEIS M+L KMK+IAE YLG  V  AVVTVPAYFND+QRQATKDAG I+GLNVLRI+NEPTAAAIAYGLDK    E  ++++DLGGGTFDVS+L+IE+G+FEV++T+GDTHLGGEDFD ++V   I+ FK+KH  D+SDN +A+ +L+   E+AKR LSS     +EIDS  +GID   ++TRA+FEELN DLF+ TL+PVEK L+D+ L+K  + DIVLVGGSTRIPK+Q+LL+  F+GK+ +K INPDEAVAYGAAVQA +LSG+  E V+D++LLDV  L+LGIET GGVMT LIKRNT IPTK++QIF+T  DNQP V+I+VYEGERAM+KDNNLLGKFEL GIPPAPRGVPQIEVTF +DANGIL VSA +KGTGK   ITITNDKGRL++++I+RMV EAEK+  ED   K ++  +N LE+YA+ +K+ V  + L +K+ E D++ ++D   + + WL+ N + A  E+F+  ++ L K+  PI +K+Y
Sbjct:   49 YGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKS-DKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGE--EGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGD-LGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLY 654          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 522/649 (80.43%), Postives = 575/649 (88.60%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLD--KNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ--GPTVEEVD 2181
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFD+  V  DM HW F VI E  RPKI+VEFKGE K+FFPEEISSMVL KMKE AEAYLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLI+DLGGGTFDVS+LTIEDGIFEVKSTAGDTHLGGEDFDN+MV+HF+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EGIDFYTSITRARFEELN DLF+ T EPVE+A+RD+K+   K +IHDIVLVGGSTRIPKIQK+LQ+LF GKELNKSINPDEAVAYGAAVQAAIL GDK + V+DLLLLDVAPLS+GIETAGGVM+ LIKRN+TIPTKQTQ FTTYSDNQPGVLIQV+EGER+MT  NNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMVNEA KYK+EDE+Q+DRI  KNSLESYAY MKSTVED+K+KDKISE D+K I+DKC E + WL+ NQ A K+EFEYH KELEK+CNPI+TK+YQ AGGA  GA             G P    ++  GPT+EEVD
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQQAGGAPPGAGGMPGGMPGGFPGGAPPAGDQESSGPTIEEVD 655          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 493/607 (81.22%), Postives = 553/607 (91.10%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLD-KNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVAMNP NT+FDAKRLIGR+FD+  V+ DMKHWSF+V+NE GRPK++VE+KGETKTFF EEISSMVL KMKE AEAYLG  V DAVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVS+L+IEDGIFEVKST GDTHLGGEDFDN MV+ F+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA++EIDSLY+GIDFYTSITRARFEE+NA LF+ TLEPVEKA++D+KL+ K  I +IV+VGGSTRIPKIQ LLQ+ FNGKELNKSINPDEAVAYGAAVQAAIL GDKSEA QDLLLLDVAPL+LG+ETAGGVMTA IKRNTTIPTKQTQ FTTYSDNQ  VLIQVYEGER++TKDNNLLGKFEL+GIPPAPRGVPQI+VTFD+D+NGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEK+K  DE  ++RI  KNSLESYA+ MKST+EDEK+KDK+SE +R+ +I +C+  ++WLE NQ A KEE + H KELE +CNPI+TK+YQ
Sbjct:    7 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 449/607 (73.97%), Postives = 533/607 (87.81%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMY 2061
             IGIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA+NP NT+FDAKRLIGR++D+++VQSDMK W F +I++  +PKI+VE+KGE KTF  EEISSMVL KMKE AEAYLG+ V  AV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSILTI+DG +FEVKSTAGDTHLGGEDFDNR+VNHF+ EFKRK+KKD+S N RA+RRLRTACERAKRTLSSS +A++E+DSL+EGIDFYT I+RARFE+L +DLF S L+PV KAL DAK  K+ IH++VLVGGSTR+PKIQK+L++ F+GK LNKSINPDEAVAYGAAVQAAILSGDKS+ V+D+LL+DVAPLSLGIETAG VMT LI+RN  IPTK TQ FTTYSDNQP V I+V+EGER +TK NNLLGKF+L+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK   ITITNDKGRLSK++I+RM+N+AEKYK EDE Q+++IA +N LESYA+ +KS + +  L+ K+S+SD+  + +K +E +NWLEKN  A KEEFE   KEL+++C+PIM K++
Sbjct:    6 AIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 407/642 (63.40%), Postives = 514/642 (80.06%), Query Frame = 1
Query:  142 MKSITIIFISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVED-EKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMY 2061
            MK I  I    L  S+  AD  ++ K ++E  GTVIGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+  NP NTVFDAKRLIGR +D++SVQ+D+K + F V+++  +P ++V+ K E KTF  EEIS+MVL KMKE AEAYLGK V  AVVTVPAYFND+QRQATKDAGAI+GL V+RIINEPTAAAIAYG+DKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD  ++ HFI+ +K+K  K+I  + RAV++LR   E+AKR LS+  QA +EI+S +EG DF   +TRARFEELNA LF+STL+PV+K L DA L K+ IH+IVLVGGSTRIPK+Q+L++D F GKE ++ INPDEAVAYGAAVQA +L G+  E   +++LLDV PL+LGIET GGVMT LI RNT IPTK++Q+F+T +DNQ  V IQV+EGER MTKDN+ LGKF+L GIPPAPRGVPQIEVTF+ID NGIL VSA +KGTG + KITITND+ RL+ +DIERMVN+AEK+  ED++ K+++  +N LESYAY +K+ V D EKL  K+SE D+K I +  ++AI+W++KNQ A+ E+F+   KELE +  PI++K+Y
Sbjct:    1 MKCIYTICTLALASSLVFADKKEERKEQREKVGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEG-EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGE--EDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 525.398 bits (1352), Expect = 1.548e-178
Identity = 308/617 (49.92%), Postives = 428/617 (69.37%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVED----------EKLKDKISESDRKLIIDKCQEAINWLEKN----QQATKEEFEYHYKEL 2025
            G V GIDLGTT SCV V      ++I N +G+RTTPS VAFT + ERL+G  A+ Q   NP NT++  KR IGR+FD   ++ D+K+ S+ ++  +        F+   K + P ++ + VL+KMKE AE+YLG  V +AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK    ++ + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++   I EFK++   D+S +  A++RLR A E+AK  LSSS Q ++ +   Y  +D          ++R++FE L ADL   T+ P +K L+DA+++K  I D++LVGG TR+PK+Q+ +QD+F G+  +K++NPDEAVA GAA+Q  +L+GD    V+D+LLLDV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN LLG+F+L GIPPAPRGVPQ+EVTFDIDANGI+NVSA +KGTG+E +I I +  G LSKD IE M+ EAEKY + D+++K+     N  E   +  ++ +E+          EKLK++I++  R+++ +K  E    + +     QQ + + FE  YK++
Sbjct:   12 GAVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNG---DAWFEVAGKVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKT--EDKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLP--YITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVPSKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEEFKDQLPSEEVEKLKEEIAKV-REVLANKDNETGETIRQAYSELQQKSLKLFEMAYKKM 614          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 573/609 (94.09%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NPNNTVFDAKRLIGR+FD+S VQSDMKHW F VIN+  RPK++VE+KGETKTF+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTY+DNQPGVLIQV+EGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++ KN LESYA+ MKSTVE+EKLKDKISE DRK I+DKC E I+WL++NQ A KEEFE+  KELEK+CNPIMTK+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTVEEEKLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELEKVCNPIMTKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 1035.02 bits (2675), Expect = 0.000e+0
Identity = 528/606 (87.13%), Postives = 569/606 (93.89%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKL  KIS+ D++ I+DKC E I+WL+KNQ A ++E+E+  KELEK+CNPI+TK+YQ
Sbjct:    4 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 609          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 528/609 (86.70%), Postives = 570/609 (93.60%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+D+++ KN LESYA+ MKSTVEDEKL  KIS+ D++ I+DKC E I+WL+KNQ A ++E+E+  KELEK+CNPI+TK+YQ
Sbjct:   54 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 662          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 518/609 (85.06%), Postives = 567/609 (93.10%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            G  +GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFD++ VQSDMKHW F V+N++ +PK+ VE+KGE KTF+PEEISSMVL KMKEI+EAYLGK+V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMVNHFI EFKRK KK+I++NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG DFYTSITRARFEELNADLFR T+EPVEKALRDAK+DK+ IHD+VLVGGSTRIPKIQKLLQDLFNG++LNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNN+LGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAE++K EDE Q+D+I  KNSLES A+ MKSTV+DEKL+DKIS  D+K I+DKC E I WL+KNQ A K+E+E+  KELEK+CNPI++K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 517/606 (85.31%), Postives = 566/606 (93.40%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 2064
            +GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFD++ VQSDMKHW F V+N++ +PK+ VE+KGE KTF+PEEISSMVL KMKEI+EAYLGK+V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMVNHFI EFKRK KK+I++NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG DFYTSITRARFEELNADLFR T+EPVEKALRDAK+DK+ IHD+VLVGGSTRIPKIQKLLQDLFNG++LNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNN+LGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAE++K EDE Q+D+I  KNSLES A+ MKSTV+DEKL+DKIS  D+K I+DKC E I WL+KNQ A K+E+E+  KELEK+CNPI++K+YQ
Sbjct:   24 LGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 629          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 646/648 (99.69%), Postives = 646/648 (99.69%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 646/648 (99.69%), Postives = 646/648 (99.69%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 646/648 (99.69%), Postives = 646/648 (99.69%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051540.1 (SMESG000051540.1)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 646/648 (99.69%), Postives = 646/648 (99.69%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            G  IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 1131.32 bits (2925), Expect = 0.000e+0
Identity = 604/645 (93.64%), Postives = 618/645 (95.81%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQGPTVEEVD 2181
            IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDE SVQSDMKHWSFDVI+E GRPKI++EFKGE KTF+PEEISSMVLIKMKEIAEAYLGK VKDAV+TVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQAN+EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEK+LRDAKLDKN IHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDE+QK+RIA KNSLESY+YQMKSTVEDEKLKDKISESDRK II+KCQEAI WLEKNQQA+K+EF+YHYKELEKLCNPIM KMYQ           GGFPGG PGA G   G  KQGPTVEEVD
Sbjct:    6 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDEPSVQSDMKHWSFDVISEAGRPKIKIEFKGEKKTFYPEEISSMVLIKMKEIAEAYLGKIVKDAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANVEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKLDKNAIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEDQKERIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ------GAGGAGGFPGGFPGAPGAHSGDDKQGPTVEEVD 644          
The following BLAST results are available for this feature:
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA80.000e+088.01heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+088.01heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+088.01heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA20.000e+084.29heat shock protein family A (Hsp70) member 2 [Sour... [more]
HSPA20.000e+084.29heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-10.000e+084.87Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-10.000e+084.87Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.50.000e+069.40pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.50.000e+069.40pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.40.000e+069.40pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+087.68heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.68heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.68heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.68heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.68heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr260.000e+087.85WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+084.41WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.85WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.85WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.85WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa80.000e+087.85heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa20.000e+083.96heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa20.000e+083.96heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa80.000e+085.06heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa1l0.000e+083.42heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q71U34|HSP7C_SAGOE0.000e+088.01Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
sp|Q5NVM9|HSP7C_PONAB0.000e+088.01Heat shock cognate 71 kDa protein OS=Pongo abelii ... [more]
sp|P11142|HSP7C_HUMAN0.000e+088.01Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]
sp|A2Q0Z1|HSP7C_HORSE0.000e+088.01Heat shock cognate 71 kDa protein OS=Equus caballu... [more]
sp|P19120|HSP7C_BOVIN0.000e+088.01Heat shock cognate 71 kDa protein OS=Bos taurus OX... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LVF70.000e+086.42Heat shock protein 70 OS=Dugesia japonica OX=6161 ... [more]
A0A3M0ITR50.000e+088.51Uncharacterized protein OS=Hirundo rustica rustica... [more]
A0A1D5PYK00.000e+088.51Heat shock cognate 71 kDa protein OS=Gallus gallus... [more]
A0A1V4J7W80.000e+088.34Heat shock cognate protein isoform B OS=Patagioena... [more]
A0A1U7RUB70.000e+088.51heat shock cognate 71 kDa protein isoform X2 OS=Al... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b0.000e+087.19heat shock cognate 70 kDa protein-like [Source:NCB... [more]
hspa80.000e+086.70heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
ENSAMXT00000004733.20.000e+086.70pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hsc700.000e+085.22heat shock cognate 71 kDa protein-like [Source:NCB... [more]
hspa1b0.000e+079.48heat shock protein family A (Hsp70) member 1B [Sou... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+065.30heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa90.000e+051.86heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa143.169e-8733.13heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa131.456e-7436.41heat shock protein 70 family, member 13 [Source:ZF... [more]
ENSPMAT00000003663.14.630e-637.68pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA10.000e+073.99ATPase involved in protein folding and NLS-directe... [more]
SSA20.000e+074.15HSP70 family ATP-binding protein; involved in prot... [more]
SSA30.000e+073.22ATPase involved in protein folding and the respons... [more]
SSA40.000e+074.92Heat shock protein that is highly induced upon str... [more]
KAR20.000e+062.95ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372800.000e+080.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+081.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+073.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332960.000e+063.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477231.548e-17849.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b0.000e+087.85heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsc700.000e+087.13heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc700.000e+086.70heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-30.000e+085.06heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsp70-30.000e+085.31heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051570.10.000e+099.69SMESG000051570.1[more]
SMESG000051567.10.000e+099.69SMESG000051567.1[more]
SMESG000051541.10.000e+099.69SMESG000051541.1[more]
SMESG000051540.10.000e+099.69SMESG000051540.1[more]
SMESG000051815.10.000e+093.64SMESG000051815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002262 ID=SMED30002262|Name=Heat shock cognate 71 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2265bp
CTACGACCAATCAAAATTTCACACGAATATTAGAACACACAATAATTCTC
TTATACGTGTATATATTCATATAAAAGGGATTTATTTATATTATTTCTAT
CATTTCTGTATTGTTCTTTAATACGAAACTTATTTGAATCGATGAAATCG
ATAACAATTATCTTTATTTCATTATTGATTTGCAGTATTTATGCTGCAGA
CGATGATAAAAAGGAGAAAACTAAAAAGGAAGATTATGGAACTGTTATTG
GTATAGATTTGGGAACTACTTATTCATGCGTTGGTGTATTTCAACATGGT
AAAGTTGAAATTATTGCAAACGATCAAGGAAATCGCACAACGCCCAGTTA
TGTAGCATTTACTGATACAGAACGGTTGATTGGGGATGCTGCAAAAAACC
AAGTGGCAATGAATCCTAATAATACGGTTTTTGATGCAAAGCGATTGATA
GGTCGAAAATTTGATGAATCGTCAGTTCAAAGTGACATGAAACATTGGTC
GTTCGATGTAATAAATGAAACTGGTAGACCAAAAATTCGAGTCGAATTCA
AAGGTGAAACAAAAACATTTTTCCCCGAAGAAATTTCATCAATGGTTTTA
ATAAAAATGAAAGAAATTGCAGAAGCATACTTGGGTAAAACAGTGAAAGA
TGCAGTTGTAACTGTTCCAGCTTATTTCAATGATAGTCAAAGACAAGCAA
CTAAAGATGCTGGTGCAATTAGTGGATTGAACGTTTTAAGAATTATTAAT
GAACCAACAGCTGCTGCTATAGCTTATGGATTAGACAAAAAAGTGGGCGC
TGAACGCAATGTGTTAATATTTGATTTAGGCGGCGGAACTTTTGATGTTT
CGATTTTAACAATTGAAGATGGTATTTTTGAAGTTAAATCTACTGCTGGT
GATACTCATCTGGGCGGTGAAGATTTTGATAATCGTATGGTGAATCATTT
TATCCAAGAATTCAAGAGGAAGCATAAGAAAGATATTAGTGACAACAAAC
GAGCAGTTAGAAGACTGAGAACAGCTTGTGAGCGAGCAAAGAGAACTTTG
AGTTCTAGTGCACAGGCAAATTTGGAAATTGATTCATTGTATGAAGGTAT
TGATTTCTACACTTCAATTACAAGAGCAAGATTTGAGGAATTGAATGCTG
ATTTGTTTCGTTCGACTTTAGAGCCAGTAGAGAAGGCATTAAGAGATGCT
AAGTTGGACAAAAATACAATCCATGATATTGTGTTAGTTGGCGGATCAAC
AAGAATACCGAAAATTCAAAAGCTCCTTCAAGATTTATTCAATGGAAAGG
AATTGAACAAATCCATTAATCCCGATGAGGCAGTTGCGTACGGAGCAGCA
GTACAAGCAGCAATTTTGTCTGGAGATAAATCGGAAGCTGTGCAAGATTT
ATTATTGTTAGACGTGGCACCATTGAGTTTGGGTATAGAAACTGCTGGTG
GAGTAATGACGGCTTTGATTAAACGAAATACAACTATTCCAACAAAGCAA
ACGCAAATATTTACTACATATTCTGATAACCAGCCGGGAGTATTAATTCA
AGTTTATGAAGGTGAACGTGCAATGACAAAGGACAATAATTTGCTGGGTA
AATTTGAATTGGCTGGAATTCCTCCAGCTCCCAGAGGAGTTCCGCAAATT
GAAGTTACTTTTGATATAGATGCTAATGGTATTCTAAATGTGTCTGCTGT
TGAAAAGGGTACGGGAAAAGAGAATAAAATTACTATTACTAATGATAAAG
GGCGATTATCAAAAGATGATATTGAGCGTATGGTTAACGAGGCTGAAAAA
TATAAAAAAGAAGACGAAGAACAAAAAGACAGAATAGCGGGAAAGAATTC
ATTGGAAAGTTATGCATACCAAATGAAATCAACGGTTGAAGATGAAAAAT
TAAAAGATAAAATTTCTGAATCGGATAGAAAGCTGATAATTGATAAATGT
CAAGAAGCGATAAATTGGTTGGAAAAGAATCAACAAGCAACAAAGGAAGA
GTTTGAATATCATTATAAAGAATTGGAGAAGTTATGCAATCCAATAATGA
CTAAAATGTATCAAGGAGCTGGTGGAGCTGGAGCAGGAGCATTCCCTGGT
GGATTTCCAGGCGGCGCACCGGGTGCAGCTGGGGGACCAGGAGGGGCTGG
AAAACAAGGTCCGACAGTAGAAGAAGTTGATTAAATGTTTAAAATAAAAC
TTTTTGTGTATATATGAAACGATTTTTATTTTTTAATAAAAGTATGATTT
GTTATTGAAATGGCG
back to top

protein sequence of SMED30002262-orf-1

>SMED30002262-orf-1 ID=SMED30002262-orf-1|Name=SMED30002262-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=681bp
MKSITIIFISLLICSIYAADDDKKEKTKKEDYGTVIGIDLGTTYSCVGVF
QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAK
RLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISS
MVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLR
IINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKS
TAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAK
RTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKAL
RDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAY
GAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIP
TKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGV
PQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNE
AEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLII
DKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGA
FPGGFPGGAPGAAGGPGGAGKQGPTVEEVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR019651Glutamate_DH_NAD-spec
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
IPR018181Heat_shock_70_CS
Vocabulary: cellular component
TermDefinition
GO:0042470melanosome
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0008380RNA splicing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 565..585
NoneNo IPR availableCOILSCoilCoilcoord: 506..529
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 384..403
score: 84.67
coord: 27..39
score: 85.18
coord: 197..207
score: 81.05
coord: 465..481
score: 86.34
coord: 357..377
score: 81.87
coord: 325..341
score: 76.57
coord: 49..57
score: 76.1
coord: 136..156
score: 93.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 182..359
e-value: 7.7E-182
score: 605.9
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 223..300
e-value: 7.7E-182
score: 605.9
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 1..372
e-value: 7.7E-182
score: 605.9
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 62..108
e-value: 7.7E-182
score: 605.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 624..645
NoneNo IPR availablePANTHERPTHR19375:SF407HEAT SHOCK COGNATE 71 KDA PROTEIN-RELATEDcoord: 1..617
NoneNo IPR availableCDDcd10233HSPA1-2_6-8-like_NBDcoord: 1..375
e-value: 0.0
score: 878.212
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 1..606
e-value: 3.9E-262
score: 870.8
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 1..617
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 375..503
e-value: 3.4E-66
score: 222.7
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 381..537
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 504..607
e-value: 6.6E-39
score: 134.2
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 533..612
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 328..342
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 3..10
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 191..204
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 186..376
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 1..181