SMED30002257

Overview
NameSMED30002257
Smed IDSMED30002257
Length (bp)1436
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002257 (SMED30002257) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002257 (SMED30002257) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002257 (SMED30002257) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002257 (SMED30002257) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002257

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002257SMESG000010550.1 dd_Smed_v4_2590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002257SMESG000010550.1 dd_Smed_v4_2590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002257SMESG000010550.1 dd_Smed_v4_2590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002257SMESG000010550.1 dd_Smed_v4_2590_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30002257 vs. Ensembl Human
Match: VAMP3 (vesicle associated membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:12644])

HSP 1 Score: 85.1149 bits (209), Expect = 1.224e-19
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   21 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79          
BLAST of SMED30002257 vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 82.8037 bits (203), Expect = 1.494e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN+KM
Sbjct:   38 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of SMED30002257 vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 82.8037 bits (203), Expect = 1.723e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN+KM
Sbjct:   40 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 97          
BLAST of SMED30002257 vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 82.4185 bits (202), Expect = 1.813e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN+KM
Sbjct:   38 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of SMED30002257 vs. Ensembl Human
Match: AC129492.3 (novel protein)

HSP 1 Score: 82.4185 bits (202), Expect = 2.020e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN+KM
Sbjct:   38 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of SMED30002257 vs. Ensembl Celegans
Match: snb-1 (Synaptobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:O02495])

HSP 1 Score: 74.3294 bits (181), Expect = 4.552e-16
Identity = 33/58 (56.90%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V  +M+ N+ K LERD KLS++D+RA  LQ GA QF+ +A  ++RK+WWKNIKM
Sbjct:   30 QVDEVVGIMKVNVEKVLERDQKLSQLDDRADALQEGASQFEKSAATLKRKYWWKNIKM 87          
BLAST of SMED30002257 vs. Ensembl Celegans
Match: snb-2 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:Q19767])

HSP 1 Score: 66.6254 bits (161), Expect = 2.847e-13
Identity = 28/58 (48.28%), Postives = 44/58 (75.86%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QV++V +VMR N+ K +ERD +L+ +D RA  LQ GA QFQ ++  +++K+WW+NI+M
Sbjct:   36 QVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQNGASQFQQSSRTLRQKYWWQNIRM 93          
BLAST of SMED30002257 vs. Ensembl Celegans
Match: snb-2 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:Q19767])

HSP 1 Score: 66.6254 bits (161), Expect = 2.847e-13
Identity = 28/58 (48.28%), Postives = 44/58 (75.86%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QV++V +VMR N+ K +ERD +L+ +D RA  LQ GA QFQ ++  +++K+WW+NI+M
Sbjct:   36 QVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQNGASQFQQSSRTLRQKYWWQNIRM 93          
BLAST of SMED30002257 vs. Ensembl Celegans
Match: vamp-7 (VAMP (Vesicle Associated Membrane Protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q95XH1])

HSP 1 Score: 52.373 bits (124), Expect = 2.552e-7
Identity = 24/57 (42.11%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIK 373
            QVD V  VM +N+ + +ER  +L  M+ R   L+  A  F++TA +VQR F  KN+K
Sbjct:  178 QVDDVRQVMADNVERIMERGERLENMENRTEALRTSATSFKSTARRVQRHFCQKNLK 234          
BLAST of SMED30002257 vs. Ensembl Celegans
Match: vamp-8 (VAMP (Vesicle Associated Membrane Protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q95QZ1])

HSP 1 Score: 45.4394 bits (106), Expect = 7.126e-6
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIK 373
            QVD V  VM +N+ + LER  +L  ++ R+ +L   +  F+ TA KVQRKF   N K
Sbjct:   27 QVDSVKAVMVDNVERILERGERLDNIERRSEQLNATSANFKFTARKVQRKFCMLNAK 83          
BLAST of SMED30002257 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0331462)

HSP 1 Score: 77.7962 bits (190), Expect = 4.414e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+  A K++RKFW +N+KM
Sbjct:   48 QVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 105          
BLAST of SMED30002257 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0306578)

HSP 1 Score: 77.7962 bits (190), Expect = 7.014e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+  A K++RKFW +N+KM
Sbjct:   57 QVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 114          
BLAST of SMED30002257 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0302310)

HSP 1 Score: 77.7962 bits (190), Expect = 7.014e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+  A K++RKFW +N+KM
Sbjct:   57 QVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 114          
BLAST of SMED30002257 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0072815)

HSP 1 Score: 78.5666 bits (192), Expect = 1.014e-16
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+  A K++RKFW +N+KM
Sbjct:   48 QVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 105          
BLAST of SMED30002257 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0300893)

HSP 1 Score: 78.5666 bits (192), Expect = 1.014e-16
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+  A K++RKFW +N+KM
Sbjct:   48 QVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 105          
BLAST of SMED30002257 vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 87.4261 bits (215), Expect = 1.305e-20
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN+KMW
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of SMED30002257 vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 87.4261 bits (215), Expect = 1.305e-20
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN+KMW
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of SMED30002257 vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 87.0409 bits (214), Expect = 2.268e-20
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN+KMW
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of SMED30002257 vs. Ensembl Zebrafish
Match: vamp2 (vesicle-associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8225])

HSP 1 Score: 78.9518 bits (193), Expect = 1.765e-17
Identity = 35/58 (60.34%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++ K+WWKN KM
Sbjct:   32 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAKM 89          
BLAST of SMED30002257 vs. Ensembl Zebrafish
Match: zgc:92912 (zgc:92912 [Source:ZFIN;Acc:ZDB-GENE-040718-265])

HSP 1 Score: 75.8702 bits (185), Expect = 2.367e-16
Identity = 33/58 (56.90%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QV++V ++MR N+ K LERD KLSE+D+RA  LQ GA QF++ A K++ K+WWKN KM
Sbjct:   40 QVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESCAAKLKNKYWWKNCKM 97          
BLAST of SMED30002257 vs. Ensembl Xenopus
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:549726])

HSP 1 Score: 82.4185 bits (202), Expect = 1.137e-18
Identity = 36/59 (61.02%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QV++V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   23 QVNEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 81          
BLAST of SMED30002257 vs. Ensembl Xenopus
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:549726])

HSP 1 Score: 82.8037 bits (203), Expect = 1.322e-18
Identity = 36/59 (61.02%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QV++V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   23 QVNEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 81          
BLAST of SMED30002257 vs. Ensembl Xenopus
Match: idh1 (isocitrate dehydrogenase 1 (NADP+) [Source:Xenbase;Acc:XB-GENE-1004994])

HSP 1 Score: 77.0258 bits (188), Expect = 1.325e-16
Identity = 32/58 (55.17%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QV++V ++MR N+ K L+RD KL+E+D+RA  LQ GA QF+T+A K++RK+WW+N KM
Sbjct:   32 QVNEVVDIMRVNVDKVLDRDQKLAELDDRADALQAGASQFETSAAKLKRKYWWRNCKM 89          
BLAST of SMED30002257 vs. Ensembl Xenopus
Match: vamp8 (putative ferric-chelate reductase 1 [Source:Xenbase;Acc:XB-GENE-5813499])

HSP 1 Score: 54.6842 bits (130), Expect = 8.203e-9
Identity = 23/58 (39.66%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD V  +M +N+ + L R   L  +  +  +L+  ++ F+TT+ KV RK+WWKN KM
Sbjct:   25 QVDDVKGIMSQNVERILARGENLDHLRNKTEDLEASSEHFKTTSQKVARKYWWKNAKM 82          
BLAST of SMED30002257 vs. Ensembl Xenopus
Match: vamp8 (putative ferric-chelate reductase 1 [Source:Xenbase;Acc:XB-GENE-5813499])

HSP 1 Score: 54.299 bits (129), Expect = 1.098e-8
Identity = 23/58 (39.66%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD V  +M +N+ + L R   L  +  +  +L+  ++ F+TT+ KV RK+WWKN KM
Sbjct:   25 QVDDVKGIMSQNVERILARGENLDHLRNKTEDLEASSEHFKTTSQKVARKYWWKNAKM 82          
BLAST of SMED30002257 vs. Ensembl Mouse
Match: Vamp3 (vesicle-associated membrane protein 3 [Source:MGI Symbol;Acc:MGI:1321389])

HSP 1 Score: 85.5001 bits (210), Expect = 8.867e-20
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   25 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of SMED30002257 vs. Ensembl Mouse
Match: Vamp2 (vesicle-associated membrane protein 2 [Source:MGI Symbol;Acc:MGI:1313277])

HSP 1 Score: 82.8037 bits (203), Expect = 1.026e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN+KM
Sbjct:   38 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of SMED30002257 vs. Ensembl Mouse
Match: Vamp2 (vesicle-associated membrane protein 2 [Source:MGI Symbol;Acc:MGI:1313277])

HSP 1 Score: 81.6481 bits (200), Expect = 8.045e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN+KM
Sbjct:   38 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of SMED30002257 vs. Ensembl Mouse
Match: Vamp1 (vesicle-associated membrane protein 1 [Source:MGI Symbol;Acc:MGI:1313276])

HSP 1 Score: 78.5666 bits (192), Expect = 3.629e-17
Identity = 34/58 (58.62%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QV++V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++RK+WWKN KM
Sbjct:   40 QVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKM 97          
BLAST of SMED30002257 vs. Ensembl Mouse
Match: Vamp1 (vesicle-associated membrane protein 1 [Source:MGI Symbol;Acc:MGI:1313276])

HSP 1 Score: 78.1814 bits (191), Expect = 4.600e-17
Identity = 34/58 (58.62%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QV++V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++RK+WWKN KM
Sbjct:   40 QVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKM 97          
BLAST of SMED30002257 vs. UniProt/SwissProt
Match: sp|Q15836|VAMP3_HUMAN (Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3)

HSP 1 Score: 85.1149 bits (209), Expect = 5.879e-19
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   21 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79          
BLAST of SMED30002257 vs. UniProt/SwissProt
Match: sp|Q4R8T0|VAMP3_MACFA (Vesicle-associated membrane protein 3 OS=Macaca fascicularis OX=9541 GN=VAMP3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.995e-19
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   21 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79          
BLAST of SMED30002257 vs. UniProt/SwissProt
Match: sp|P63025|VAMP3_RAT (Vesicle-associated membrane protein 3 OS=Rattus norvegicus OX=10116 GN=Vamp3 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.203e-19
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   25 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of SMED30002257 vs. UniProt/SwissProt
Match: sp|P63024|VAMP3_MOUSE (Vesicle-associated membrane protein 3 OS=Mus musculus OX=10090 GN=Vamp3 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.203e-19
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   25 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of SMED30002257 vs. UniProt/SwissProt
Match: sp|Q2KJD2|VAMP3_BOVIN (Vesicle-associated membrane protein 3 OS=Bos taurus OX=9913 GN=VAMP3 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.346e-18
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN KMW
Sbjct:   25 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of SMED30002257 vs. TrEMBL
Match: B5X4D1 (Vesicle-associated membrane protein 3 OS=Salmo salar OX=8030 GN=VAMP3 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.895e-17
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN KMW
Sbjct:   22 QVDEVVDIMRVNVDKVLERDSKLSELDDRADALQAGASQFETSAAKLKRKFWWKNCKMW 80          
BLAST of SMED30002257 vs. TrEMBL
Match: Q6IQK3 (Vesicle-associated membrane protein 3 (Cellubrevin) OS=Danio rerio OX=7955 GN=vamp3 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.919e-17
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN+KMW
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of SMED30002257 vs. TrEMBL
Match: A0A4W5JW18 (Vesicle associated membrane protein 3 OS=Hucho hucho OX=62062 GN=VAMP3 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.031e-17
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN KMW
Sbjct:   17 QVDEVVDIMRVNVDKVLERDSKLSELDDRADALQAGASQFETSAAKLKRKFWWKNCKMW 75          
BLAST of SMED30002257 vs. TrEMBL
Match: T2MCV8 (Vesicle-associated membrane protein 3 OS=Hydra vulgaris OX=6087 GN=VAMP3 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.384e-17
Identity = 39/59 (66.10%), Postives = 47/59 (79.66%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVDQV ++MR+NM K LERDAKLSE+D RA  LQ GA QF+T A K++RK WW+N KMW
Sbjct:   20 QVDQVVDIMRQNMDKVLERDAKLSELDNRAENLQAGASQFETAAGKLKRKMWWQNCKMW 78          
BLAST of SMED30002257 vs. TrEMBL
Match: A0A0R4IJN3 (Vesicle-associated membrane protein 3 (cellubrevin) (Fragment) OS=Danio rerio OX=7955 GN=vamp3 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.075e-17
Identity = 38/59 (64.41%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RKFWWKN+KMW
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of SMED30002257 vs. Ensembl Cavefish
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:103022570])

HSP 1 Score: 86.2705 bits (212), Expect = 3.174e-20
Identity = 38/59 (64.41%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            QVD+V ++MR N+ K LERD+KLSE+D+RA  LQ GA QF+T A K++RKFWWKN KMW
Sbjct:   24 QVDEVVDIMRVNVDKVLERDSKLSELDDRADALQAGASQFETNAAKLKRKFWWKNCKMW 82          
BLAST of SMED30002257 vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 79.337 bits (194), Expect = 1.609e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++ K+WWKN KM
Sbjct:   42 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 99          
BLAST of SMED30002257 vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 79.337 bits (194), Expect = 1.609e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++ K+WWKN KM
Sbjct:   42 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 99          
BLAST of SMED30002257 vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 79.337 bits (194), Expect = 1.609e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++ K+WWKN KM
Sbjct:   42 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 99          
BLAST of SMED30002257 vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 79.337 bits (194), Expect = 1.609e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++ K+WWKN KM
Sbjct:   42 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 99          
BLAST of SMED30002257 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008529.1 (pep scaffold:Pmarinus_7.0:GL484641:5659:9131:-1 gene:ENSPMAG00000007726.1 transcript:ENSPMAT00000008529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 7.085e-19
Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++RK+WWKN KM
Sbjct:   39 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQQGASQFESSAAKLKRKYWWKNCKM 96          
BLAST of SMED30002257 vs. Ensembl Yeast
Match: SNC2 (Vesicle membrane receptor protein (v-SNARE); involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane; Snc2p levels regulated by Vps45p; member of the synaptobrevin/VAMP family of R-type v-SNARE proteins; SNC2 has a paralog, SNC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005854])

HSP 1 Score: 54.299 bits (129), Expect = 9.649e-10
Identity = 20/58 (34.48%), Postives = 40/58 (68.97%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            ++D    +MR+N+ K  ER  +L+ ++++A  L + AQ F+  A++V+++ WWK++KM
Sbjct:   34 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKM 91          
BLAST of SMED30002257 vs. Ensembl Yeast
Match: SNC1 (Vesicle membrane receptor protein (v-SNARE); involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane; proposed to be involved in endocytosis; member of the synaptobrevin/VAMP family of R-type v-SNARE proteins; SNC1 has a paralog, SNC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000028])

HSP 1 Score: 49.6766 bits (117), Expect = 4.190e-8
Identity = 19/58 (32.76%), Postives = 39/58 (67.24%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            ++D    +MR+N+ K  ER  +L+ ++++A  L + AQ F+  A++V++  W+K++KM
Sbjct:   35 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKM 92          
BLAST of SMED30002257 vs. Ensembl Nematostella
Match: EDO42383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1M0])

HSP 1 Score: 69.3218 bits (168), Expect = 5.245e-15
Identity = 33/58 (56.90%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++M+ N+ K LERDAKLSE+D RA  LQ GA QF+T+A +++RK WW+N K+
Sbjct:   12 QVDEVVDIMKVNVDKVLERDAKLSELDNRADALQAGASQFETSASRLKRKMWWQNCKV 69          
BLAST of SMED30002257 vs. Ensembl Nematostella
Match: EDO44396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVJ7])

HSP 1 Score: 57.7658 bits (138), Expect = 3.292e-10
Identity = 23/58 (39.66%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            ++  V +VM+ N+AK L+R AKL ++ +++  L M A QF++ + K+QRK WW+N ++
Sbjct:   59 EIKGVVDVMQTNIAKVLDRGAKLDDLQDKSENLDMNAFQFRSGSRKLQRKLWWQNCRL 116          
BLAST of SMED30002257 vs. Ensembl Nematostella
Match: EDO43738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXX6])

HSP 1 Score: 49.2914 bits (116), Expect = 8.033e-7
Identity = 21/59 (35.59%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            +VD+V +VM +N+ K LER  ++  + ++A  L   AQ FQ  + ++++K WW+N +M 
Sbjct:  135 EVDEVKDVMTKNIEKVLERGERIDILMDKAETLDNSAQTFQRHSSRLRKKMWWQNTRMC 193          
BLAST of SMED30002257 vs. Ensembl Medaka
Match: vamp2 (vesicle associated membrane protein 2 [Source:NCBI gene;Acc:101159693])

HSP 1 Score: 79.337 bits (194), Expect = 1.395e-17
Identity = 35/58 (60.34%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++ K+WWKN KM
Sbjct:   37 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAKM 94          
BLAST of SMED30002257 vs. Ensembl Medaka
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:101164413])

HSP 1 Score: 79.7221 bits (195), Expect = 2.065e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++ K+WWKN KM
Sbjct:   41 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 98          
BLAST of SMED30002257 vs. Ensembl Medaka
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:101164413])

HSP 1 Score: 78.1814 bits (191), Expect = 3.114e-17
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+++A K++ K+WWKN KM
Sbjct:   41 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 98          
BLAST of SMED30002257 vs. Ensembl Medaka
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 75.485 bits (184), Expect = 2.134e-16
Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN K+
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKV 81          
BLAST of SMED30002257 vs. Ensembl Medaka
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 75.485 bits (184), Expect = 2.134e-16
Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D+RA  LQ GA QF+T+A K++RK+WWKN K+
Sbjct:   24 QVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKV 81          
BLAST of SMED30002257 vs. Planmine SMEST
Match: SMESG000010550.1 (SMESG000010550.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.395e-55
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 2
Query:   83 MASNIKNPANTYGVYNQPYTIXXXXXXXXXXXXXXXXXXMQVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMWXXXXXXXXXXXXXXXXXXYFXXXXXXXXXXXXXXAVATPSSGKRK 514
            MASNIKNPANTYGVYNQPYTISGGQSLSSSGSTRLQQTQMQVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMWIILIAVIVVVIAIIAVAIYFSTKSDSTSNNNNNKAVATPSSGKRK
Sbjct:    1 MASNIKNPANTYGVYNQPYTISGGQSLSSSGSTRLQQTQMQVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMWIILIAVIVVVIAIIAVAIYFSTKSDSTSNNNNNKAVATPSSGKRK 144          
BLAST of SMED30002257 vs. Planmine SMEST
Match: SMESG000066166.1 (SMESG000066166.1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.638e-18
Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD+V ++MR N+ K LERD KLSE+D RA  LQ GA QF+ +A K++RKFWW+N KM
Sbjct:   38 QVDEVVDIMRVNVDKVLERDHKLSELDNRADALQAGASQFEASAGKLKRKFWWRNCKM 95          
BLAST of SMED30002257 vs. Planmine SMEST
Match: SMESG000057424.1 (SMESG000057424.1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.139e-17
Identity = 33/58 (56.90%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            QVD++ ++M+ N+ K LERD KLSE+D RA  LQ GA QF+ +A K++RKFW KN+KM
Sbjct:   37 QVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLKM 94          
BLAST of SMED30002257 vs. Planmine SMEST
Match: SMESG000033532.1 (SMESG000033532.1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.173e-15
Identity = 30/58 (51.72%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  203 QVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKM 376
            ++++V ++MR N+ K LERD KLSE+D RA  LQ GA QF+ +A +++ KFWW+N+KM
Sbjct:   35 KINEVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFEESAGRLKSKFWWRNVKM 92          
BLAST of SMED30002257 vs. Planmine SMEST
Match: SMESG000026855.1 (SMESG000026855.1)

HSP 1 Score: 61.2326 bits (147), Expect = 8.969e-12
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 2
Query:  227 MRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 379
            MR+NM K LERD +L ++  RA +++  A++F   A + +RKFWW+NIKMW
Sbjct:    1 MRQNMDKVLERDKRLDDLSTRAEDMEGNAREFHANAVRARRKFWWQNIKMW 51          
The following BLAST results are available for this feature:
BLAST of SMED30002257 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAMP31.224e-1962.71vesicle associated membrane protein 3 [Source:HGNC... [more]
VAMP21.494e-1862.07vesicle associated membrane protein 2 [Source:HGNC... [more]
VAMP21.723e-1862.07vesicle associated membrane protein 2 [Source:HGNC... [more]
VAMP21.813e-1862.07vesicle associated membrane protein 2 [Source:HGNC... [more]
AC129492.32.020e-1862.07novel protein[more]
back to top
BLAST of SMED30002257 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snb-14.552e-1656.90Synaptobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snb-22.847e-1348.28SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
snb-22.847e-1348.28SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
vamp-72.552e-742.11VAMP (Vesicle Associated Membrane Protein) homolog... [more]
vamp-87.126e-642.11VAMP (Vesicle Associated Membrane Protein) homolog... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nSyb4.414e-1758.62gene:FBgn0013342 transcript:FBtr0331462[more]
nSyb7.014e-1758.62gene:FBgn0013342 transcript:FBtr0306578[more]
nSyb7.014e-1758.62gene:FBgn0013342 transcript:FBtr0302310[more]
nSyb1.014e-1658.62gene:FBgn0013342 transcript:FBtr0072815[more]
nSyb1.014e-1658.62gene:FBgn0013342 transcript:FBtr0300893[more]
back to top
BLAST of SMED30002257 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp31.305e-2064.41vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp31.305e-2064.41vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp32.268e-2064.41vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp21.765e-1760.34vesicle-associated membrane protein 2 [Source:ZFIN... [more]
zgc:929122.367e-1656.90zgc:92912 [Source:ZFIN;Acc:ZDB-GENE-040718-265][more]
back to top
BLAST of SMED30002257 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp31.137e-1861.02vesicle associated membrane protein 3 [Source:NCBI... [more]
vamp31.322e-1861.02vesicle associated membrane protein 3 [Source:NCBI... [more]
idh11.325e-1655.17isocitrate dehydrogenase 1 (NADP+) [Source:Xenbase... [more]
vamp88.203e-939.66putative ferric-chelate reductase 1 [Source:Xenbas... [more]
vamp81.098e-839.66putative ferric-chelate reductase 1 [Source:Xenbas... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vamp38.867e-2062.71vesicle-associated membrane protein 3 [Source:MGI ... [more]
Vamp21.026e-1862.07vesicle-associated membrane protein 2 [Source:MGI ... [more]
Vamp28.045e-1862.07vesicle-associated membrane protein 2 [Source:MGI ... [more]
Vamp13.629e-1758.62vesicle-associated membrane protein 1 [Source:MGI ... [more]
Vamp14.600e-1758.62vesicle-associated membrane protein 1 [Source:MGI ... [more]
back to top
BLAST of SMED30002257 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15836|VAMP3_HUMAN5.879e-1962.71Vesicle-associated membrane protein 3 OS=Homo sapi... [more]
sp|Q4R8T0|VAMP3_MACFA5.995e-1962.71Vesicle-associated membrane protein 3 OS=Macaca fa... [more]
sp|P63025|VAMP3_RAT6.203e-1962.71Vesicle-associated membrane protein 3 OS=Rattus no... [more]
sp|P63024|VAMP3_MOUSE6.203e-1962.71Vesicle-associated membrane protein 3 OS=Mus muscu... [more]
sp|Q2KJD2|VAMP3_BOVIN1.346e-1862.71Vesicle-associated membrane protein 3 OS=Bos tauru... [more]
back to top
BLAST of SMED30002257 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B5X4D12.895e-1764.41Vesicle-associated membrane protein 3 OS=Salmo sal... [more]
Q6IQK32.919e-1764.41Vesicle-associated membrane protein 3 (Cellubrevin... [more]
A0A4W5JW183.031e-1764.41Vesicle associated membrane protein 3 OS=Hucho huc... [more]
T2MCV83.384e-1766.10Vesicle-associated membrane protein 3 OS=Hydra vul... [more]
A0A0R4IJN35.075e-1764.41Vesicle-associated membrane protein 3 (cellubrevin... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp33.174e-2064.41vesicle associated membrane protein 3 [Source:NCBI... [more]
vamp11.609e-1758.62vesicle-associated membrane protein 2-like [Source... [more]
vamp11.609e-1758.62vesicle-associated membrane protein 2-like [Source... [more]
vamp11.609e-1758.62vesicle-associated membrane protein 2-like [Source... [more]
vamp11.609e-1758.62vesicle-associated membrane protein 2-like [Source... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008529.17.085e-1960.34pep scaffold:Pmarinus_7.0:GL484641:5659:9131:-1 ge... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SNC29.649e-1034.48Vesicle membrane receptor protein (v-SNARE); invol... [more]
SNC14.190e-832.76Vesicle membrane receptor protein (v-SNARE); invol... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO423835.245e-1556.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443963.292e-1039.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437388.033e-735.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002257 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp21.395e-1760.34vesicle associated membrane protein 2 [Source:NCBI... [more]
vamp12.065e-1758.62vesicle-associated membrane protein 2-like [Source... [more]
vamp13.114e-1758.62vesicle-associated membrane protein 2-like [Source... [more]
vamp32.134e-1660.34vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp32.134e-1660.34vesicle-associated membrane protein 3 (cellubrevin... [more]
back to top
BLAST of SMED30002257 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010550.11.395e-55100.00SMESG000010550.1[more]
SMESG000066166.13.638e-1860.34SMESG000066166.1[more]
SMESG000057424.13.139e-1756.90SMESG000057424.1[more]
SMESG000033532.12.173e-1551.72SMESG000033532.1[more]
SMESG000026855.18.969e-1249.02SMESG000026855.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002257 ID=SMED30002257|Name=SMED30002257|organism=Schmidtea mediterranea sexual|type=transcript|length=1436bp
TTTTTGAATTAGCACAACAAAAAAATAAAATTTTAATTTTTTAAATTTTA
GTTTACTCTTGAATTGACATATCATATATAGTATGGCTTCAAATATTAAG
AATCCCGCTAATACTTATGGTGTTTATAATCAACCTTATACAATATCCGG
TGGTCAATCTCTGTCATCTAGTGGAAGCACAAGGTTGCAACAAACTCAAA
TGCAGGTAGATCAAGTCACAAATGTAATGAGAGAAAATATGGCAAAAGCA
TTAGAACGAGATGCTAAATTATCGGAAATGGATGAACGAGCCGCCGAGTT
GCAAATGGGTGCTCAACAGTTCCAAACCACAGCACATAAAGTGCAAAGAA
AATTTTGGTGGAAGAATATTAAAATGTGGATAATTTTGATTGCTGTAATT
GTGGTCGTGATAGCTATTATTGCCGTTGCGATATATTTCTCCACAAAGTC
GGACTCGACCTCAAATAACAACAACAACAAGGCGGTGGCTACTCCGTCAT
CTGGCAAGAGGAAGTAGCAGGAGGAGCTCGGAGGATGTCACAATGTCTCA
TTTGGATGCCTTATTACCATTGTTACCGTCGTGTCGAGGGGGGGGGAAAT
GTGATGATAAATGTTTGTTGTCTCATTCAATATCTATTCTGTATCTATTA
GAGATTATTAACATTAACATTAAAGTAATTAGTAATATTTTTTCATTTTT
TATGTTGTTGCAAAACTCAATTTTGCTTTCTGCTTGAATGCACACTGATC
ACAAATAACTAATCAGGCGCTTAACGTGCTAATTAGGGTGCAAATCACTC
GCCAAATCAATAAATCAATATTGGGATGACAATTGTTATTGTTGTTACGT
CATTGCTCAAGAAATAGTTGATCTTATCTGCATATCTAGATTTTTATTAT
TATTATCAATATTTGCTATTACGCTATCATCTTTATTTTTGTTTATCATA
TTATTGGAATTTTTGTTGATTAATTATAATTATTTCCTGTTGCGCCTTTC
CCGACTCTGAAACGATTTTTCAACACTGTTTTGCAAATATATATTTTATA
ATTTCTGATTGTCTTGTGTCATTTAGTGTGTTATGAAATTGATTTAATGA
GATGGATATTTTCATGATATGATAACGTTTTTATGTTAACTTTCATAAAA
ATTGTAATGATTCATTCGACTTCTAGGTACTGCACAAACTTTTAATATGC
CCGAAAATCCCAAAGAACTATTTGAATAACACAAGGCGATCTTTCATACT
TTGATTTCAGGAAATCTATATTTCAAGAATTTGATTTAAGAAATCTAGTC
TGAAAAATTTCAGTGATAGAAGGCCATCAGAAGCGCTGCATGTTATTCAG
ATCTTCTCAGATATGTAAATTAAAAGGCTTCAACAGCACCATAATGAGAT
TTTTCCACAATAATCACGATAGGCCTAGTTTTCCAC
back to top

protein sequence of SMED30002257-orf-1

>SMED30002257-orf-1 ID=SMED30002257-orf-1|Name=SMED30002257-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MASNIKNPANTYGVYNQPYTISGGQSLSSSGSTRLQQTQMQVDQVTNVMR
ENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMWI
ILIAVIVVVIAIIAVAIYFSTKSDSTSNNNNNKAVATPSSGKRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016444Synaptobrevin/VAMP
IPR042855V_SNARE_CC
IPR001388Synaptobrevin
Vocabulary: biological process
TermDefinition
GO:0016192vesicle-mediated transport
GO:0001921positive regulation of receptor recycling
GO:0006461protein complex assembly
GO:0006810transport
GO:0006887exocytosis
GO:0006906vesicle fusion
GO:0015031protein transport
GO:0017156calcium ion regulated exocytosis
GO:0034446substrate adhesion-dependent cell spreading
GO:0035493SNARE complex assembly
GO:0042147retrograde transport, endosome to Golgi
GO:0043001Golgi to plasma membrane protein transport
GO:1903531negative regulation of secretion by cell
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0005829cytosol
GO:0005886plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
GO:0030136clathrin-coated vesicle
GO:0030141secretory granule
GO:0030665clathrin-coated vesicle membrane
GO:0031201SNARE complex
GO:0031410cytoplasmic vesicle
GO:0043005neuron projection
GO:0043229intracellular organelle
GO:0043231intracellular membrane-bounded organelle
GO:0045202synapse
GO:0048471perinuclear region of cytoplasm
GO:0055037recycling endosome
Vocabulary: molecular function
TermDefinition
GO:0000149SNARE binding
GO:0005484SNAP receptor activity
GO:0005515protein binding
GO:0017075syntaxin-1 binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001388SynaptobrevinPRINTSPR00219SYNAPTOBREVNcoord: 95..114
score: 33.65
coord: 39..58
score: 46.49
coord: 59..78
score: 45.54
IPR001388SynaptobrevinPFAMPF00957Synaptobrevincoord: 33..117
e-value: 1.1E-30
score: 105.3
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 4..119
e-value: 6.2E-38
score: 131.2
NoneNo IPR availableCDDcd15870R-SNARE_VAMP2coord: 34..95
e-value: 2.9965E-27
score: 94.3745
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 31..96
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
IPR016444Synaptobrevin/Vesicle-associated membrane proteinPANTHERPTHR45701FAMILY NOT NAMEDcoord: 25..122
IPR042855v-SNARE, coiled-coil homology domainPROSITEPS50892V_SNAREcoord: 34..94
score: 16.643