Regulating synaptic membrane exocytosis protein 2

Overview
NameRegulating synaptic membrane exocytosis protein 2
Smed IDSMED30002255
Length (bp)5146
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulating synaptic membrane exocytosis protein 2 (SMED30002255) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulating synaptic membrane exocytosis protein 2 (SMED30002255) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulating synaptic membrane exocytosis protein 2 (SMED30002255) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulating synaptic membrane exocytosis protein 2 (SMED30002255) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002255

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30002255h1SMcG0022066 Contig4612newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002255h1SMcG0022066 Contig4612uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002255h1SMcG0021842 Contig4612newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002255h1SMcG0021842 Contig4612uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30002255h1SMcG0022066 dd_Smed_v4_15661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002255h1SMcG0022066 dd_Smed_v4_15661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002255h1SMcG0022066 dd_Smed_v4_15661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002255h1SMcG0022066 dd_Smed_v4_10734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002255h1SMcG0022066 dd_Smed_v4_10734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002255h1SMcG0022066 dd_Smed_v4_10734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30002255h1SMcG0022066 dd_Smed_v4_10734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002255h1SMcG0022066 dd_Smed_v4_10734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002255h1SMcG0022066 dd_Smed_v6_10734_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002255h1SMcG0022066 dd_Smed_v6_15661_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 226.868 bits (577), Expect = 7.669e-62
Identity = 136/353 (38.53%), Postives = 204/353 (57.79%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+     N  +        ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  316 RQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 664          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 228.409 bits (581), Expect = 4.774e-60
Identity = 136/353 (38.53%), Postives = 204/353 (57.79%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+     N  +        ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  512 RQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 860          

HSP 2 Score: 128.257 bits (321), Expect = 6.270e-29
Identity = 61/150 (40.67%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II  V+ RQK+EEEK   ++K L ++ + +++++           M            DA PTC +C KTKFADG G+ C YC+ + CARCGG+VS++  K           +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKK---------MGEESQQQQEQKGDA-PTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKEDKV------VMWVCNLCRKQQEILTKSGAWFYNSGSN 161          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 227.639 bits (579), Expect = 1.122e-59
Identity = 136/353 (38.53%), Postives = 204/353 (57.79%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+     N  +        ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  316 RQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 664          

HSP 2 Score: 182.185 bits (461), Expect = 1.528e-45
Identity = 81/149 (54.36%), Postives = 111/149 (74.50%), Query Frame = 3
Query: 4257 NEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct:  983 SDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1130          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 227.639 bits (579), Expect = 1.639e-59
Identity = 136/353 (38.53%), Postives = 204/353 (57.79%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+     N  +        ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  316 RQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 664          

HSP 2 Score: 114.005 bits (284), Expect = 1.670e-24
Identity = 69/188 (36.70%), Postives = 101/188 (53.72%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSI 4487
            +KRR S+G K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I
Sbjct: 1089 KKRRSSLGAKMVAIVGLSRKSRSASQLSQTEAGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCI 1252          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 227.254 bits (578), Expect = 4.544e-59
Identity = 136/353 (38.53%), Postives = 204/353 (57.79%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+     N  +        ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  508 RQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 856          

HSP 2 Score: 201.445 bits (511), Expect = 3.804e-51
Identity = 109/260 (41.92%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR S+G K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1325 KKRRSSLGAKMVAIVGLSRKSRSASQLSQTEAGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1559          

HSP 3 Score: 129.413 bits (324), Expect = 3.643e-29
Identity = 61/150 (40.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II  V+ RQK+EEEK   ++K L ++ + +++++           M            DA PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKK---------MGEESQQQQEQKGDA-PTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYNSGSN 157          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: unc-10 (Rab-3-interacting molecule unc-10 [Source:UniProtKB/Swiss-Prot;Acc:Q22366])

HSP 1 Score: 156.377 bits (394), Expect = 7.325e-38
Identity = 75/146 (51.37%), Postives = 103/146 (70.55%), Query Frame = 3
Query: 4269 VESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSI-VFGWYKLF 4703
            + +FV+ LGPGQ+VGRQVL  P LGEIQ++ +  +  ++VE+I+A+NLV K   K+ P PYVKV+L+E K  I K +T  ++ KT  PL+Q  + F+ S K K LQV+V GD+GRME+K FMG+  I L+DL L S  + GWYKLF
Sbjct: 1395 LGTFVDNLGPGQVVGRQVLASPVLGEIQIALMAGRSGIDVEIIKAKNLVVKPGVKVCPAPYVKVYLMEGKQCIAKAKTNAAT-KTTSPLFQQHLIFNDSPKKKTLQVTVLGDYGRMERKVFMGISQIRLEDLELGSQPLIGWYKLF 1539          

HSP 2 Score: 121.709 bits (304), Expect = 2.773e-27
Identity = 59/144 (40.97%), Postives = 90/144 (62.50%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWY 947
            DLSHL+ EER+IIE V  RQK+EE K ++I +   +E+ + +K++ T+ ++ S       L  T +D       C++C KTKFADG+G+ C YC+ R+CARCGG+   K            + +W C LC+K+Q++LAKTG+W+
Sbjct:    9 DLSHLSAEEREIIENVFKRQKDEEAKETQISQKASEELSELDKQI-TERKETSKK-----LVGTQDD-----AICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQSKN-----------KAIWACSLCQKRQQILAKTGKWF 130          

HSP 3 Score: 121.324 bits (303), Expect = 4.160e-27
Identity = 64/141 (45.39%), Postives = 91/141 (64.54%), Query Frame = 3
Query: 2247 PVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLP 2669
            PV W+ S D++ +IGHMIL +++      N   +  LGLK++GG+ T +G+LGAFIT+VK GS+AD  G L  GDEV+EWN +S +N TYE V + I  S++D  VELIV R+  + P      N+  S +MS+S   R+P
Sbjct:  628 PVTWQPSADQKKLIGHMILHRTE------NSAANGDLGLKIVGGRRTDTGKLGAFITQVKPGSVADTIGRLRPGDEVVEWNGQSLQNATYEQVYDSIAASRYDTSVELIVSRSA-IIPGGDDFLNLTPS-QMSSSAYSRVP 760          

HSP 4 Score: 68.1662 bits (165), Expect = 5.639e-11
Identity = 38/116 (32.76%), Postives = 66/116 (56.90%), Query Frame = 3
Query: 2670 RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVAL 3017
            R+++   YS  ++ L V LV+  +L P    +P    + +VK++LLPDR+E++ R+S ++  +  P W++VF ++      +    LE+ V+DYDK        GE +I+LA V L
Sbjct:  843 RIEVSFVYSHHDRQLSVALVRGFDLPPRSDGTPR---NPYVKIFLLPDRSEKSRRQSAVIAETLMPVWDEVFYYNGLTEPMLLQRVLELTVWDYDKFGTN-SFLGETLIDLASVPL 954          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: unc-10 (Rab-3-interacting molecule unc-10 [Source:UniProtKB/Swiss-Prot;Acc:Q22366])

HSP 1 Score: 122.865 bits (307), Expect = 1.456e-27
Identity = 59/144 (40.97%), Postives = 90/144 (62.50%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWY 947
            DLSHL+ EER+IIE V  RQK+EE K ++I +   +E+ + +K++ T+ ++ S       L  T +D       C++C KTKFADG+G+ C YC+ R+CARCGG+   K            + +W C LC+K+Q++LAKTG+W+
Sbjct:    9 DLSHLSAEEREIIENVFKRQKDEEAKETQISQKASEELSELDKQI-TERKETSKK-----LVGTQDD-----AICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQSK-----------NKAIWACSLCQKRQQILAKTGKWF 130          

HSP 2 Score: 122.479 bits (306), Expect = 1.571e-27
Identity = 64/141 (45.39%), Postives = 91/141 (64.54%), Query Frame = 3
Query: 2247 PVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLP 2669
            PV W+ S D++ +IGHMIL +++      N   +  LGLK++GG+ T +G+LGAFIT+VK GS+AD  G L  GDEV+EWN +S +N TYE V + I  S++D  VELIV R+  + P      N+  S +MS+S   R+P
Sbjct:  628 PVTWQPSADQKKLIGHMILHRTE------NSAANGDLGLKIVGGRRTDTGKLGAFITQVKPGSVADTIGRLRPGDEVVEWNGQSLQNATYEQVYDSIAASRYDTSVELIVSRSA-IIPGGDDFLNLTPS-QMSSSAYSRVP 760          

HSP 3 Score: 68.1662 bits (165), Expect = 6.150e-11
Identity = 38/118 (32.20%), Postives = 66/118 (55.93%), Query Frame = 3
Query: 2664 LPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVAL 3017
              R+++   YS  ++ L V LV+  +L P    +P    + +VK++LLPDR+E++ R+S ++  +  P W++VF ++      +    LE+ V+DYDK        GE +I+LA V L
Sbjct:  841 FGRIEVSFVYSHHDRQLSVALVRGFDLPPRSDGTPR---NPYVKIFLLPDRSEKSRRQSAVIAETLMPVWDEVFYYNGLTEPMLLQRVLELTVWDYDKFGTN-SFLGETLIDLASVPL 954          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 106.686 bits (265), Expect = 1.038e-22
Identity = 97/376 (25.80%), Postives = 172/376 (45.74%), Query Frame = 3
Query: 2046 NNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQP--------VIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVR----------------RNI---ELSP----------VATIEEN--INYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNL--RPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELA-RVALTDAPLWYSMQ 3047
            +N ++ R+P+        ED  + +  T+   R  +    S       +R +  R P+  S++ N +         V  + +++ R+ +  ++L +S   +   NDLG     ++V+GGK   +G L A+++++   +     G +  GDEV+EWN    +  T+E+V  I+  +K   E+E+++R                RN    +LSP          +  I  N  +++     +SC      +Q+ L Y   N  LV  +++A+ L  R     +PN     FVK+YLLP R   + RR+R V +S  P+WNQV  +       +  + LE  V DY ++ + + + G V I LA + A+   P WY +Q
Sbjct:  798 HNTFDARWPK--------EDALSRMYATASRRRAQETALTSSNKISTGSR-SYARRPIRPSSYRNPEATNSMPDRHVARRTAENSRYDVKRILLTRSYKHHNIYNDLG-----VRVVGGKRQMNGELSAYVSQLHSTANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIV--NKSHGEIEMVIRTYKNPSSGVYDTLPLNRNTMRDDLSPDRVPPVPMHRINGINNNSVLHHHTLSDSSCHG---HIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNP----FVKVYLLPGRKVSHKRRTRFVDSSCAPEWNQVLEYQ-VAPHTLNTMFLEFTVCDYQRDVDDLPL-GNVQIPLADKSAINTGPRWYPLQ 1147          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 106.686 bits (265), Expect = 1.038e-22
Identity = 97/376 (25.80%), Postives = 172/376 (45.74%), Query Frame = 3
Query: 2046 NNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQP--------VIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVR----------------RNI---ELSP----------VATIEEN--INYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNL--RPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELA-RVALTDAPLWYSMQ 3047
            +N ++ R+P+        ED  + +  T+   R  +    S       +R +  R P+  S++ N +         V  + +++ R+ +  ++L +S   +   NDLG     ++V+GGK   +G L A+++++   +     G +  GDEV+EWN    +  T+E+V  I+  +K   E+E+++R                RN    +LSP          +  I  N  +++     +SC      +Q+ L Y   N  LV  +++A+ L  R     +PN     FVK+YLLP R   + RR+R V +S  P+WNQV  +       +  + LE  V DY ++ + + + G V I LA + A+   P WY +Q
Sbjct:  798 HNTFDARWPK--------EDALSRMYATASRRRAQETALTSSNKISTGSR-SYARRPIRPSSYRNPEATNSMPDRHVARRTAENSRYDVKRILLTRSYKHHNIYNDLG-----VRVVGGKRQMNGELSAYVSQLHSTANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIV--NKSHGEIEMVIRTYKNPSSGVYDTLPLNRNTMRDDLSPDRVPPVPMHRINGINNNSVLHHHTLSDSSCHG---HIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNP----FVKVYLLPGRKVSHKRRTRFVDSSCAPEWNQVLEYQ-VAPHTLNTMFLEFTVCDYQRDVDDLPL-GNVQIPLADKSAINTGPRWYPLQ 1147          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 104.375 bits (259), Expect = 6.997e-22
Identity = 97/376 (25.80%), Postives = 172/376 (45.74%), Query Frame = 3
Query: 2046 NNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQP--------VIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVR----------------RNI---ELSP----------VATIEEN--INYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNL--RPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELA-RVALTDAPLWYSMQ 3047
            +N ++ R+P+        ED  + +  T+   R  +    S       +R +  R P+  S++ N +         V  + +++ R+ +  ++L +S   +   NDLG     ++V+GGK   +G L A+++++   +     G +  GDEV+EWN    +  T+E+V  I+  +K   E+E+++R                RN    +LSP          +  I  N  +++     +SC      +Q+ L Y   N  LV  +++A+ L  R     +PN     FVK+YLLP R   + RR+R V +S  P+WNQV  +       +  + LE  V DY ++ + + + G V I LA + A+   P WY +Q
Sbjct: 2209 HNTFDARWPK--------EDALSRMYATASRRRAQETALTSSNKISTGSR-SYARRPIRPSSYRNPEATNSMPDRHVARRTAENSRYDVKRILLTRSYKHHNIYNDLG-----VRVVGGKRQMNGELSAYVSQLHSTANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIV--NKSHGEIEMVIRTYKNPSSGVYDTLPLNRNTMRDDLSPDRVPPVPMHRINGINNNSVLHHHTLSDSSCHG---HIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNP----FVKVYLLPGRKVSHKRRTRFVDSSCAPEWNQVLEYQ-VAPHTLNTMFLEFTVCDYQRDVDDLPL-GNVQIPLADKSAINTGPRWYPLQ 2558          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336723)

HSP 1 Score: 215.312 bits (547), Expect = 6.310e-56
Identity = 121/258 (46.90%), Postives = 154/258 (59.69%), Query Frame = 3
Query: 3996 GFSRKSSSTSNLD-----------KKPRSSF--QRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISR-----KDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTA 4715
            G  +KS+STS L            KK ++SF   RSEEVLP  I  + R    + ++      A+  +               +        D     + S S RN+  +  FV+GLGPGQLVGRQVLG P LG+IQLS   +KG LEVEVIRAR L  K   K+LP PYVKV+L+  K  ++K +T  S+R+TLDPLYQ Q+ F  SY   ILQ++VWGD+GR+EKK FMG+  IMLDDLNLS+IV GWYKLFG T+
Sbjct: 1101 GMGKKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1357          

HSP 2 Score: 140.584 bits (353), Expect = 6.312e-33
Identity = 71/151 (47.02%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELD--TQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHA 962
            DLSHLT  ER  IE VL+RQK+EEEK +EI++  + EV   E ++   ++ QK + V +D+              TC +CLKTKFADG+G+ CHYC  R CARCGGKV+++          S + +W C LC+KKQELL+KTGQW + T A
Sbjct:    6 DLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDA--------------TCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLR----------SNKVIWVCILCRKKQELLSKTGQWINKTAA 132          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336715)

HSP 1 Score: 215.312 bits (547), Expect = 7.918e-56
Identity = 121/258 (46.90%), Postives = 154/258 (59.69%), Query Frame = 3
Query: 3996 GFSRKSSSTSNLD-----------KKPRSSF--QRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISR-----KDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTA 4715
            G  +KS+STS L            KK ++SF   RSEEVLP  I  + R    + ++      A+  +               +        D     + S S RN+  +  FV+GLGPGQLVGRQVLG P LG+IQLS   +KG LEVEVIRAR L  K   K+LP PYVKV+L+  K  ++K +T  S+R+TLDPLYQ Q+ F  SY   ILQ++VWGD+GR+EKK FMG+  IMLDDLNLS+IV GWYKLFG T+
Sbjct: 1142 GMGKKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1398          

HSP 2 Score: 140.969 bits (354), Expect = 5.237e-33
Identity = 71/151 (47.02%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELD--TQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHA 962
            DLSHLT  ER  IE VL+RQK+EEEK +EI++  + EV   E ++   ++ QK + V +D+              TC +CLKTKFADG+G+ CHYC  R CARCGGKV+++          S + +W C LC+KKQELL+KTGQW + T A
Sbjct:    6 DLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDA--------------TCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLR----------SNKVIWVCILCRKKQELLSKTGQWINKTAA 132          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336722)

HSP 1 Score: 214.157 bits (544), Expect = 2.005e-55
Identity = 121/258 (46.90%), Postives = 154/258 (59.69%), Query Frame = 3
Query: 3996 GFSRKSSSTSNL-----------DKKPRSSF--QRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISR-----KDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTA 4715
            G  +KS+STS L            KK ++SF   RSEEVLP  I  + R    + ++      A+  +               +        D     + S S RN+  +  FV+GLGPGQLVGRQVLG P LG+IQLS   +KG LEVEVIRAR L  K   K+LP PYVKV+L+  K  ++K +T  S+R+TLDPLYQ Q+ F  SY   ILQ++VWGD+GR+EKK FMG+  IMLDDLNLS+IV GWYKLFG T+
Sbjct: 1374 GMGKKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTS-SARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1630          

HSP 2 Score: 142.895 bits (359), Expect = 1.278e-33
Identity = 71/151 (47.02%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELD--TQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHA 962
            DLSHLT  ER  IE VL+RQK+EEEK +EI++  + EV   E ++   ++ QK + V +D+              TC +CLKTKFADG+G+ CHYC  R CARCGGKV+++          S + +W C LC+KKQELL+KTGQW + T A
Sbjct:    6 DLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDA--------------TCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLR----------SNKVIWVCILCRKKQELLSKTGQWINKTAA 132          

HSP 3 Score: 92.8189 bits (229), Expect = 2.333e-18
Identity = 47/126 (37.30%), Postives = 72/126 (57.14%), Query Frame = 3
Query: 2670 RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQ 3047
            RLQ+KL Y +    L+VTLV A  L    ++   A  + + K++LLPDR+ ++ RR++ V  +  P+W Q FV+S  +  D+    LE+ ++DY +     D  GEVVI+LA   L D   WY +Q
Sbjct:  841 RLQLKLGYDQNTLQLIVTLVCATGLS---LRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGAN-DFIGEVVIDLAHHILDDEAEWYQLQ 962          

HSP 4 Score: 88.5817 bits (218), Expect = 4.700e-17
Identity = 54/130 (41.54%), Postives = 71/130 (54.62%), Query Frame = 3
Query: 2247 PVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSG----------------RLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI 2588
            PV W+ S D   +IGHMIL+K           G  ILGLKV GG+   +G                  GA + KVKRGS+AD+ G +  GDE+LEWN R   N + ++V +II +S+ D +VELIV R I
Sbjct:  492 PVNWQTSADNTRLIGHMILRKYYD--------GEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPI 613          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336714)

HSP 1 Score: 214.157 bits (544), Expect = 2.492e-55
Identity = 121/258 (46.90%), Postives = 154/258 (59.69%), Query Frame = 3
Query: 3996 GFSRKSSSTSNL-----------DKKPRSSF--QRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISR-----KDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTA 4715
            G  +KS+STS L            KK ++SF   RSEEVLP  I  + R    + ++      A+  +               +        D     + S S RN+  +  FV+GLGPGQLVGRQVLG P LG+IQLS   +KG LEVEVIRAR L  K   K+LP PYVKV+L+  K  ++K +T  S+R+TLDPLYQ Q+ F  SY   ILQ++VWGD+GR+EKK FMG+  IMLDDLNLS+IV GWYKLFG T+
Sbjct: 1684 GMGKKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTS-SARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1940          

HSP 2 Score: 140.584 bits (353), Expect = 8.023e-33
Identity = 71/151 (47.02%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELD--TQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHA 962
            DLSHLT  ER  IE VL+RQK+EEEK +EI++  + EV   E ++   ++ QK + V +D+              TC +CLKTKFADG+G+ CHYC  R CARCGGKV+++          S + +W C LC+KKQELL+KTGQW + T A
Sbjct:    6 DLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDA--------------TCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLR----------SNKVIWVCILCRKKQELLSKTGQWINKTAA 132          

HSP 3 Score: 93.2041 bits (230), Expect = 2.284e-18
Identity = 47/126 (37.30%), Postives = 72/126 (57.14%), Query Frame = 3
Query: 2670 RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQ 3047
            RLQ+KL Y +    L+VTLV A  L    ++   A  + + K++LLPDR+ ++ RR++ V  +  P+W Q FV+S  +  D+    LE+ ++DY +     D  GEVVI+LA   L D   WY +Q
Sbjct: 1151 RLQLKLGYDQNTLQLIVTLVCATGL---SLRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGAN-DFIGEVVIDLAHHILDDEAEWYQLQ 1272          

HSP 4 Score: 90.1225 bits (222), Expect = 1.669e-17
Identity = 55/132 (41.67%), Postives = 72/132 (54.55%), Query Frame = 3
Query: 2241 KQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSG----------------RLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI 2588
            K PV W+ S D   +IGHMIL+K           G  ILGLKV GG+   +G                  GA + KVKRGS+AD+ G +  GDE+LEWN R   N + ++V +II +S+ D +VELIV R I
Sbjct:  800 KNPVNWQTSADNTRLIGHMILRKYYD--------GEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPI 923          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336716)

HSP 1 Score: 213.772 bits (543), Expect = 2.534e-55
Identity = 121/258 (46.90%), Postives = 154/258 (59.69%), Query Frame = 3
Query: 3996 GFSRKSSSTSNL-----------DKKPRSSF--QRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISR-----KDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTA 4715
            G  +KS+STS L            KK ++SF   RSEEVLP  I  + R    + ++      A+  +               +        D     + S S RN+  +  FV+GLGPGQLVGRQVLG P LG+IQLS   +KG LEVEVIRAR L  K   K+LP PYVKV+L+  K  ++K +T  S+R+TLDPLYQ Q+ F  SY   ILQ++VWGD+GR+EKK FMG+  IMLDDLNLS+IV GWYKLFG T+
Sbjct: 1374 GMGKKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTS-SARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1630          

HSP 2 Score: 142.895 bits (359), Expect = 1.309e-33
Identity = 71/151 (47.02%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELD--TQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHA 962
            DLSHLT  ER  IE VL+RQK+EEEK +EI++  + EV   E ++   ++ QK + V +D+              TC +CLKTKFADG+G+ CHYC  R CARCGGKV+++          S + +W C LC+KKQELL+KTGQW + T A
Sbjct:    6 DLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKAGVELDA--------------TCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLR----------SNKVIWVCILCRKKQELLSKTGQWINKTAA 132          

HSP 3 Score: 92.8189 bits (229), Expect = 2.658e-18
Identity = 47/126 (37.30%), Postives = 72/126 (57.14%), Query Frame = 3
Query: 2670 RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQ 3047
            RLQ+KL Y +    L+VTLV A  L    ++   A  + + K++LLPDR+ ++ RR++ V  +  P+W Q FV+S  +  D+    LE+ ++DY +     D  GEVVI+LA   L D   WY +Q
Sbjct:  841 RLQLKLGYDQNTLQLIVTLVCATGLS---LRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGAN-DFIGEVVIDLAHHILDDEAEWYQLQ 962          

HSP 4 Score: 88.5817 bits (218), Expect = 4.964e-17
Identity = 54/130 (41.54%), Postives = 71/130 (54.62%), Query Frame = 3
Query: 2247 PVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSG----------------RLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI 2588
            PV W+ S D   +IGHMIL+K           G  ILGLKV GG+   +G                  GA + KVKRGS+AD+ G +  GDE+LEWN R   N + ++V +II +S+ D +VELIV R I
Sbjct:  492 PVNWQTSADNTRLIGHMILRKYYD--------GEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPI 613          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1a (regulating synaptic membrane exocytosis 1a [Source:ZFIN;Acc:ZDB-GENE-090312-135])

HSP 1 Score: 230.72 bits (587), Expect = 1.997e-61
Identity = 158/406 (38.92%), Postives = 217/406 (53.45%), Query Frame = 3
Query: 1920 YRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSER-DYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMS---------------NSCDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
             RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER D+             P        PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGKVT +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IIL+S+ +P+VELIV R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA++L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  + + E+ D  GE++IEL    L D P WY +Q  D
Sbjct:  463 LRNDSLSSDQSE--------SLRPPPPR------PYKSKRGGNKR-------QMSVSSSEEEAGSTPEYTSCEDVE--IESVSERGDWEC----------CPLDPTAWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKVTETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILNSQAEPQVELIVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKDLPPRSDTRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPRIQEEESDFLGEILIELETALLDDKPHWYKLQTHD 828          

HSP 2 Score: 113.62 bits (283), Expect = 1.005e-24
Identity = 59/162 (36.42%), Postives = 87/162 (53.70%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWY 947
            DLSHLTEEER+II  V+ RQKEEE K+  ++K  EK ++                     ++     ++V   G +         ++D  PTC +C KTKFADG GN C YC+ + CARCGG+VS++          S   +W C  C+++Q++L K+G W+
Sbjct:   25 DLSHLTEEERKIIMAVMARQKEEEAKDEAMLKE-EKPIQAKTVNLVGNKKPPQQNDISLHQQFANYKEQVRRTGPEPQQ-RQQGQHKDDAPTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSLR----------SNNVMWVCNQCRRQQDMLTKSGDWF 174          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1a (regulating synaptic membrane exocytosis 1a [Source:ZFIN;Acc:ZDB-GENE-090312-135])

HSP 1 Score: 229.95 bits (585), Expect = 2.935e-60
Identity = 158/406 (38.92%), Postives = 217/406 (53.45%), Query Frame = 3
Query: 1920 YRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSER-DYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMSNS---------------CDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
             RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER D+             P        PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGKVT +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IIL+S+ +P+VELIV R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA++L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  + + E+ D  GE++IEL    L D P WY +Q  D
Sbjct:  463 LRNDSLSSDQSE--------SLRPPPPR------PYKSKRGGNKR-------QMSVSSSEEEAGSTPEYTSCEDVE--IESVSERGDWEC----------CPLDPTAWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKVTETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILNSQAEPQVELIVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKDLPPRSDTRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPRIQEEESDFLGEILIELETALLDDKPHWYKLQTHD 828          

HSP 2 Score: 191.815 bits (486), Expect = 1.713e-48
Identity = 116/295 (39.32%), Postives = 158/295 (53.56%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LPAHI--RGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    S            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P ++  R  +R +   S+N ++    S  NL  +    G                        ++    F++GLGP QLVGRQ L  P +G++Q+  +D+KG LEVEVIRAR L PK   K LP PYVKV+LLE      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I L++L+LSS V GWYKLF
Sbjct: 1154 RTDGSQSDTALGTLGSEG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKAKGSSQIQRSQETGMAVEYPRNVMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADSQFSDFLDGLGPAQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLENGACKAKKKTKI-ARKTLDPLYQQSLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQIFLEELDLSSTVIGWYKLF 1410          

HSP 3 Score: 115.161 bits (287), Expect = 5.354e-25
Identity = 62/174 (35.63%), Postives = 90/174 (51.72%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQ--DAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDI 977
            DLSHLTEEER+II  V+ RQKEEE K+  ++K  EK ++                     ++     ++V   G +   P      Q  D  PTC +C KTKFADG GN C YC+ + CARCGG+VS++          S   +W C  C+++Q++L K+G W+      P ++
Sbjct:   25 DLSHLTEEERKIIMAVMARQKEEEAKDEAMLKE-EKPIQAKTVNLVGNKKPPQQNDISLHQQFANYKEQVRRTGPE---PQQRQQGQHKDDAPTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSLR----------SNNVMWVCNQCRRQQDMLTKSGDWFPSQVPKPGEL 184          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1a (regulating synaptic membrane exocytosis 1a [Source:ZFIN;Acc:ZDB-GENE-090312-135])

HSP 1 Score: 229.95 bits (585), Expect = 3.145e-60
Identity = 158/406 (38.92%), Postives = 217/406 (53.45%), Query Frame = 3
Query: 1920 YRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSER-DYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMS---------------NSCDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
             RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER D+             P        PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGKVT +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IIL+S+ +P+VELIV R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA++L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  + + E+ D  GE++IEL    L D P WY +Q  D
Sbjct:  468 LRNDSLSSDQSE--------SLRPPPPR------PYKSKRGGNKR-------QMSVSSSEEEAGSTPEYTSCEDVE--IESVSERGDWEC----------CPLDPTAWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKVTETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILNSQAEPQVELIVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKDLPPRSDTRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPRIQEEESDFLGEILIELETALLDDKPHWYKLQTHD 833          

HSP 2 Score: 191.815 bits (486), Expect = 1.812e-48
Identity = 116/295 (39.32%), Postives = 158/295 (53.56%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LPAHI--RGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    S            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P ++  R  +R +   S+N ++    S  NL  +    G                        ++    F++GLGP QLVGRQ L  P +G++Q+  +D+KG LEVEVIRAR L PK   K LP PYVKV+LLE      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I L++L+LSS V GWYKLF
Sbjct: 1159 RTDGSQSDTALGTLGSEG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKAKGSSQIQRSQETGMAVEYPRNVMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADSQFSDFLDGLGPAQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLENGACKAKKKTKI-ARKTLDPLYQQSLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQIFLEELDLSSTVIGWYKLF 1415          

HSP 3 Score: 115.161 bits (287), Expect = 5.319e-25
Identity = 64/174 (36.78%), Postives = 93/174 (53.45%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQ--DAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDI 977
            DLSHLTEEER+II  V+ RQKEEE K+  ++K  EK ++                     ++     ++V   G +   P      Q  D  PTC +C KTKFADG GN C YC+ + CARCGG+VS++    S  K+  V  +W C  C+++Q++L K+G W+      P ++
Sbjct:   25 DLSHLTEEERKIIMAVMARQKEEEAKDEAMLKE-EKPIQAKTVNLVGNKKPPQQNDISLHQQFANYKEQVRRTGPE---PQQRQQGQHKDDAPTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSLR----SNNKEDKV-VMWVCNQCRRQQDMLTKSGDWFPSQVPKPGEL 189          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims2a (regulating synaptic membrane exocytosis 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1656])

HSP 1 Score: 209.149 bits (531), Expect = 2.422e-59
Identity = 120/258 (46.51%), Postives = 158/258 (61.24%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEV-LPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K + V+G SRKS S S L       KK RS+ QRS E  L   +R  +R T   S       D S N+     S+ G++         +    ++S+    ++    F++GLGP QLVGRQ L  P +G+IQ+  +++KG LEVEVIRAR LV K   K LP PYVKV+LLE    I K++T V +RKTLDPLYQ Q+ F  S   K+LQ+ VWGD+GRM+ KSFMG   I+LDDL+LS++V GW+KLF
Sbjct:   71 KKRRSSIGAKMAAVVGLSRKSRSASQLGQTEAGGKKLRSTIQRSTETGLAVEMR--SRMTRQASRES---TDGSMNSY----SSEGNL---------IFPGVRLSS----DSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKV-ARKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAAQILLDDLDLSNMVIGWFKLF 305          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1b (regulating synaptic membrane exocytosis 1b [Source:ZFIN;Acc:ZDB-GENE-101223-4])

HSP 1 Score: 221.09 bits (562), Expect = 1.648e-57
Identity = 143/357 (40.06%), Postives = 204/357 (57.14%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSER-DYGMNNRYNQPRHPV-PTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPV----------ATIEENINYSKKM-----------SNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE+  ++ + TSC+D +  IESVSE+ D+          HP+ PT   V   PV W+ SK+  H+IG + L K    +    + GS +LGLKV+GGK+T SGRLGAFITKVK+GS+AD+ G+L AGDEVL+WN ++    T ++V  IIL+S+  P+VE++V R I  +P           +T   +I+ S+KM           S      LP     +L +KL+Y K    L+V ++QA+ L P P   P    + +VKMY LPDR++++ RR++ V  S  PKWNQ F++S     D R   LEI V+D  + + E+ D  GE++IEL    L D   WY  Q  D
Sbjct:  464 RQMSISSSEEEGGSTPEYTSCEDVE--IESVSEKGDWDC--------HPLDPT---VWHHPVSWQPSKEGDHLIGRITLSKR---STMPREAGS-LLGLKVVGGKMTESGRLGAFITKVKKGSLADIVGHLRAGDEVLQWNGKALPGATKKEVYNIILESQSAPQVEIVVSRPIGETPRLPGTSHPPLESTGSSSIDESQKMDRPSISVMSPTSPGMLRDLPLVLPGQLSVKLWYDKVGHQLIVNVLQARELPPRPDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSAEPKWNQTFLYSHVHRRDFRERMLEITVWDQPRAQEEESDFLGEILIELETALLDDQAHWYKFQTHD 800          

HSP 2 Score: 180.644 bits (457), Expect = 3.797e-45
Identity = 84/160 (52.50%), Postives = 113/160 (70.62%), Query Frame = 3
Query: 4224 TDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            ++ + I  + R E     F++GLGP QLVGRQ L  P +G+IQ+  +++KG LEVEVIRAR L+ K   K LP PYVKV+LL     + K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ KSFMG+  I+L++L+LSS V GWYKLF
Sbjct: 1161 SEGSPIFPAVRVETQFSDFLDGLGPAQLVGRQTLATPAIGDIQIGMVNKKGQLEVEVIRARGLIQKPGSKSLPAPYVKVYLLHNGAYVAKKKTKI-ARKTLDPLYQQTLQFEESPQGKVLQVIVWGDYGRMDHKSFMGVAQILLEELDLSSNVIGWYKLF 1319          

HSP 3 Score: 122.479 bits (306), Expect = 2.693e-27
Identity = 63/170 (37.06%), Postives = 104/170 (61.18%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFE---KELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWY-HGTHANPVDIDIDFNDTSPNQI 1013
            DLSHLTEEER++I  V++RQ+EEEEK   ++K L ++ + ++   +++  +T++  +V            ++D  PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S   +W C LC+K+QE+L K+G+W+  G    P+ ++ +    S +Q+
Sbjct:   25 DLSHLTEEERKVIMAVMVRQREEEEKEQAMLKTLHQQFESYKEQVRKIGAETKRQQAV------------HKDDAPTCGICRKTKFADGCGHLCSYCQTKFCARCGGRVSLR----------SNNVMWVCNLCRKQQEILTKSGEWFSSGPGGRPLSLEKERKLRSRSQV 172          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 224.172 bits (570), Expect = 3.185e-58
Identity = 138/372 (37.10%), Postives = 206/372 (55.38%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPV---PTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-----------------------------------ELSPVATIEENINYSKKMSNSCDDR-----LPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+    +  YN   H       ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEW+ R  +  T+E+V  IIL+SK + +VEL+V R I                                    +SP    +     S ++S+   +R     +PR+QIKL+Y K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  437 RQVSLSSSEEELASTPEYTSCDDVEIESESVSEKG---DMDYNWVEHSSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSSQSLNRRTAPFVPRVQIKLWYDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 801          

HSP 2 Score: 206.453 bits (524), Expect = 7.790e-53
Identity = 114/260 (43.85%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS STS L       KK +S+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++ +    ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR LV K   K LP PYVKV+LLE  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L+LSS+V GWYKLF
Sbjct: 1235 KKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----------GLAVEMRNWMSRQASRESTDGSMNSYSSEGNL---------IFPGVRLGS----DSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKV-ARKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLF 1469          

HSP 3 Score: 93.9745 bits (232), Expect = 2.015e-18
Identity = 35/78 (44.87%), Postives = 53/78 (67.95%), Query Frame = 3
Query:  732 PTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + ++
Sbjct:   24 PTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYSSGSS 91          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 224.172 bits (570), Expect = 3.485e-58
Identity = 138/356 (38.76%), Postives = 204/356 (57.30%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNK---QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+    +  YN   H    S+  +     PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEW+ R  +  T+E+V  IIL+SK + +VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL+Y K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  516 RQVSLSSSEEELASTPEYTSCDDVEIESESVSEKG---DMDYNWVEHSSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 864          

HSP 2 Score: 207.223 bits (526), Expect = 6.033e-53
Identity = 114/260 (43.85%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS STS L       KK +S+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++ +    ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR LV K   K LP PYVKV+LLE  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L+LSS+V GWYKLF
Sbjct: 1481 KKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----------GLAVEMRNWMSRQASRESTDGSMNSYSSEGNL---------IFPGVRLGS----DSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKV-ARKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLF 1715          

HSP 3 Score: 112.079 bits (279), Expect = 6.719e-24
Identity = 60/151 (39.74%), Postives = 90/151 (59.60%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSS-VGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTE+ER+II  V+ RQK+EEEK   ++K  E++  Q  ++L  Q +     V           + +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++  K           +W C LC+K+QE+L K+G W++ + ++
Sbjct:   26 DLSHLTEDERKIIMAVMERQKKEEEKEQSVLKVKEEQKAQPAQKLHQQFEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKV------VMWVCNLCRKQQEILTKSGAWFYSSGSS 170          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 224.172 bits (570), Expect = 3.935e-58
Identity = 138/356 (38.76%), Postives = 204/356 (57.30%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNK---QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+    +  YN   H    S+  +     PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEW+ R  +  T+E+V  IIL+SK + +VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL+Y K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  516 RQVSLSSSEEELASTPEYTSCDDVEIESESVSEKG---DMDYNWVEHSSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 864          

HSP 2 Score: 207.223 bits (526), Expect = 6.808e-53
Identity = 114/260 (43.85%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS STS L       KK +S+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++ +    ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR LV K   K LP PYVKV+LLE  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L+LSS+V GWYKLF
Sbjct: 1484 KKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----------GLAVEMRNWMSRQASRESTDGSMNSYSSEGNL---------IFPGVRLGS----DSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKV-ARKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLF 1718          

HSP 3 Score: 112.079 bits (279), Expect = 7.567e-24
Identity = 60/148 (40.54%), Postives = 88/148 (59.46%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSS-VGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGT 956
            DLSHLTE+ER+II  V+ RQK+EEEK   ++K  E++  Q  ++L  Q +     V           + +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++  K           +W C LC+K+QE+L K+G W++ +
Sbjct:   26 DLSHLTEDERKIIMAVMERQKKEEEKEQSVLKVKEEQKAQPAQKLHQQFEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKV------VMWVCNLCRKQQEILTKSGAWFYSS 167          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 224.172 bits (570), Expect = 4.371e-58
Identity = 138/356 (38.76%), Postives = 204/356 (57.30%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNK---QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+    +  YN   H    S+  +     PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEW+ R  +  T+E+V  IIL+SK + +VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL+Y K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  516 RQVSLSSSEEELASTPEYTSCDDVEIESESVSEKG---DMDYNWVEHSSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 864          

HSP 2 Score: 207.223 bits (526), Expect = 6.550e-53
Identity = 114/260 (43.85%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS STS L       KK +S+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++ +    ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR LV K   K LP PYVKV+LLE  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L+LSS+V GWYKLF
Sbjct: 1477 KKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----------GLAVEMRNWMSRQASRESTDGSMNSYSSEGNL---------IFPGVRLGS----DSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKV-ARKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLF 1711          

HSP 3 Score: 111.694 bits (278), Expect = 7.749e-24
Identity = 60/148 (40.54%), Postives = 88/148 (59.46%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSS-VGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGT 956
            DLSHLTE+ER+II  V+ RQK+EEEK   ++K  E++  Q  ++L  Q +     V           + +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++  K           +W C LC+K+QE+L K+G W++ +
Sbjct:   26 DLSHLTEDERKIIMAVMERQKKEEEKEQSVLKVKEEQKAQPAQKLHQQFEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKV------VMWVCNLCRKQQEILTKSGAWFYSS 167          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 223.787 bits (569), Expect = 4.426e-58
Identity = 138/356 (38.76%), Postives = 204/356 (57.30%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNK---QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ ++ + TSCDD + + ESVSE+    +  YN   H    S+  +     PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEW+ R  +  T+E+V  IIL+SK + +VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL+Y K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  505 RQVSLSSSEEELASTPEYTSCDDVEIESESVSEKG---DMDYNWVEHSSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 853          

HSP 2 Score: 206.838 bits (525), Expect = 7.034e-53
Identity = 114/260 (43.85%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS STS L       KK +S+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++ +    ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR LV K   K LP PYVKV+LLE  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L+LSS+V GWYKLF
Sbjct: 1482 KKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----------GLAVEMRNWMSRQASRESTDGSMNSYSSEGNL---------IFPGVRLGS----DSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKV-ARKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLF 1716          

HSP 3 Score: 112.849 bits (281), Expect = 3.450e-24
Identity = 56/147 (38.10%), Postives = 89/147 (60.54%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGT 956
            DLSHLTE+ER+II  V+ RQK+EEEK   ++K L ++ + +++++    ++               + +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++  K           +W C LC+K+QE+L K+G W++ +
Sbjct:   26 DLSHLTEDERKIIMAVMERQKKEEEKEQSVLKKLHQQFEMYKEQVKKMGEEAQQQ----------QEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKV------VMWVCNLCRKQQEILTKSGAWFYSS 156          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 231.106 bits (588), Expect = 1.101e-60
Identity = 149/420 (35.48%), Postives = 226/420 (53.81%), Query Frame = 3
Query: 1872 PAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            P+    + ++ +M    RNDS+SSD +         + R PP             P  +        +Q S SSSEE++ ++ + TSCDD + + ESVSE+     +   Q       ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  230 PSSAVRKTKREKMETMLRNDSLSSDQSE--------SVRPPP-------------PRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDMEYSWLEQASWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 624          

HSP 2 Score: 202.216 bits (513), Expect = 1.001e-51
Identity = 109/260 (41.92%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + ++LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1030 KKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1264          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 213.386 bits (542), Expect = 4.808e-55
Identity = 155/467 (33.19%), Postives = 234/467 (50.11%), Query Frame = 3
Query: 1872 PAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESV-------------------------SERD-----YGMNN-----RYNQPRHP-----VPTSNFVN-------KQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            P+    + ++ +M    RNDS+SSD +         + R PP             P  +        +Q S SSSEE++ ++ + TSCDD + + ESV                         SER      YG ++      +++P+         +S  +N       K PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  502 PSSAVRKTKREKMETMLRNDSLSSDQSE--------SVRPPP-------------PRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 943          

HSP 2 Score: 200.29 bits (508), Expect = 5.045e-51
Identity = 109/260 (41.92%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + ++LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1263 KKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1497          

HSP 3 Score: 113.235 bits (282), Expect = 2.443e-24
Identity = 65/183 (35.52%), Postives = 99/183 (54.10%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKN-----------------------SEIVKNL---------EKEVK-QFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II  V+ RQK+EEEK                        +E+V N+         EKE + +  ++ +   ++V  +G +S       + +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIILAVMDRQKKEEEKEQSVLKIKEEHKAQPTQWFPFSGITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEES---QQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYNSGSN 197          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 213.386 bits (542), Expect = 4.958e-55
Identity = 155/467 (33.19%), Postives = 234/467 (50.11%), Query Frame = 3
Query: 1872 PAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESV-------------------------SERD-----YGMNN-----RYNQPRHP-----VPTSNFVN-------KQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            P+    + ++ +M    RNDS+SSD +         + R PP             P  +        +Q S SSSEE++ ++ + TSCDD + + ESV                         SER      YG ++      +++P+         +S  +N       K PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  462 PSSAVRKTKREKMETMLRNDSLSSDQSE--------SVRPPP-------------PRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 903          

HSP 2 Score: 200.29 bits (508), Expect = 5.054e-51
Identity = 109/260 (41.92%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + ++LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1283 KKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1517          

HSP 3 Score: 125.946 bits (315), Expect = 2.718e-28
Identity = 61/150 (40.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II  V+ RQK+EEEK   ++K L ++ + +++++           M            DA PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKK---------MGEESQQQQEQKGDA-PTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYNSGSN 157          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 213.386 bits (542), Expect = 5.206e-55
Identity = 155/467 (33.19%), Postives = 234/467 (50.11%), Query Frame = 3
Query: 1872 PAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESV-------------------------SERD-----YGMNN-----RYNQPRHP-----VPTSNFVN-------KQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            P+    + ++ +M    RNDS+SSD +         + R PP             P  +        +Q S SSSEE++ ++ + TSCDD + + ESV                         SER      YG ++      +++P+         +S  +N       K PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  462 PSSAVRKTKREKMETMLRNDSLSSDQSE--------SVRPPP-------------PRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 903          

HSP 2 Score: 200.29 bits (508), Expect = 6.008e-51
Identity = 109/260 (41.92%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + ++LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1305 KKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1539          

HSP 3 Score: 125.946 bits (315), Expect = 2.858e-28
Identity = 61/150 (40.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II  V+ RQK+EEEK   ++K L ++ + +++++           M            DA PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKK---------MGEESQQQQEQKGDA-PTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYNSGSN 157          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims1 (regulating synaptic membrane exocytosis 1 [Source:MGI Symbol;Acc:MGI:2152971])

HSP 1 Score: 176.792 bits (447), Expect = 1.319e-49
Identity = 82/148 (55.41%), Postives = 107/148 (72.30%), Query Frame = 3
Query: 4260 EAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR+L  K   K  P PYVKV+LLE    I K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS+V GWYKLF
Sbjct:   40 DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRI-ARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLF 186          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9JIS1|RIMS2_RAT (Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 6.275e-58
Identity = 151/439 (34.40%), Postives = 224/439 (51.03%), Query Frame = 3
Query: 1872 PAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNK---QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-----------------------------------ELSP-----VATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            P+    + ++ +M    RNDS+SSD +         + R PP             P  +        +Q S SSSEE++ ++ + TSCDD + + ESV E+    +  Y+   H    S+  +     PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R I                                    +SP     V         S+ +S      +PR+QIKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  462 PSSAVRKTKREKMETMLRNDSLSSDQSE--------SVRPPP-------------PRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVGEKG---DMEYSWLEHASWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDMPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSSQSLSRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 872          

HSP 2 Score: 202.601 bits (514), Expect = 6.876e-51
Identity = 110/260 (42.31%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + K+LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1288 KKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1522          

HSP 3 Score: 131.339 bits (329), Expect = 4.896e-29
Identity = 61/150 (40.67%), Postives = 92/150 (61.33%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II+ V+ RQK+EEEK   ++K L ++ + +++++           M            DA PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKEQVKK---------MGEESQQQQEQKGDA-PTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYNSGSN 157          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9JIR4|RIMS1_RAT (Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 9.401e-55
Identity = 137/357 (38.38%), Postives = 192/357 (53.78%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERD----YGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPR------------------------LQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE+  ++ + TSC+D + + ESVSE+     Y ++      R   P S+     PV W+ SK+   +IG +IL K       S     A+LGLKV+GGK+T  GRLGAFITKVK+GS+ADV G+L AGDEVLEWN +     T E+V  IIL+SK +P+VE+IV R I   P      +       S+    ++ R                        L +KL+Y K    L+V ++QA +L P     P    + +VKMY LPDR++++ RR++ V     PKWNQ FV+S     D R   LEI V+D  + + E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  540 RQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISS----HPVTWQPSKEGDRLIGRVILNKRTTMPKESG----ALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQTHD 885          

HSP 2 Score: 187.578 bits (475), Expect = 2.699e-46
Identity = 110/262 (41.98%), Postives = 148/262 (56.49%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAH-----IRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR S+  K   ++  SR+S STS L       KK +S+ QRS E   A      +R  +R +   S+N ++    S  NL       G                        ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR+L  K   K  P PYVKV+LLE    I K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS+V GWYKLF
Sbjct: 1351 KKRRSSLSAKVVAIV--SRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYS----SEGNLIFPGVRVG-----------------------PDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRI-ARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLF 1582          

HSP 3 Score: 105.916 bits (263), Expect = 2.307e-21
Identity = 66/205 (32.20%), Postives = 103/205 (50.24%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ-------------------------------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTS 1001
            DLSHLTEEER II  V+ RQKEEEEK   ++K + +++ +                                             ++ ++  ++V  +G ++       +++D  PTC +C KTKFADG G+ C YC+ + CARCGG+VS++    S  +D  V  +W C LC+K+QE+L K+G W+ G+       D   +DT+
Sbjct:   24 DLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPERDWRLHQQFESYKEQVRKIGEEAR--RYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLR----SNNEDKVV--MWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTA 220          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q86UR5|RIMS1_HUMAN (Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.193e-54
Identity = 137/357 (38.38%), Postives = 193/357 (54.06%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERD----YGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPR------------------------LQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE+  ++ + TSC+D + + ESVSE+     Y ++      R   P S+     PV W+ SK+   +IG +IL K         D G A+LGLKV+GGK+T  GRLGAFITKVK+GS+ADV G+L AGDEVLEWN +     T E+V  IIL+SK +P+VE+IV R I   P      +       S+    ++ R                        L +KL+Y K    L+V ++QA +L   P +      + +VKMY LPDR++++ RR++ V     PKWNQ FV+S     D R   LEI V+D  + + E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  526 RQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISS----HPVTWQPSKEGDRLIGRVILNKR---TTMPKDSG-ALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDL---PARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQEEESEFLGEILIELETALLDDEPHWYKLQTHD 871          

HSP 2 Score: 187.963 bits (476), Expect = 2.256e-46
Identity = 110/262 (41.98%), Postives = 148/262 (56.49%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAH-----IRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR S+  K   ++  SR+S STS L       KK +S+ QRS E   A      +R  +R +   S+N ++    S  NL       G                        ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR+L  K   K  P PYVKV+LLE    I K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS+V GWYKLF
Sbjct: 1428 KKRRSSLSAKVVAIV--SRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYS----SEGNLIFPGVRLG-----------------------ADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRI-ARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLF 1659          

HSP 3 Score: 116.316 bits (290), Expect = 1.925e-24
Identity = 66/182 (36.26%), Postives = 103/182 (56.59%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ--------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTS 1001
            DLSHLTEEER II  V+ RQKEEEEK   ++K + +++ +                      ++ ++  ++V  +G ++       +++D  PTC +C KTKFADG G+ C YC+ + CARCGG+VS++    S  +D  V  +W C LC+K+QE+L K+G W+ G+       D   +DT+
Sbjct:   24 DLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEAR--RYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLR----SNNEDKVV--MWVCNLCRKQQEILTKSGAWFFGSGPQQTSQDGTLSDTA 197          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9EQZ7|RIMS2_MOUSE (Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 3.363e-54
Identity = 155/467 (33.19%), Postives = 234/467 (50.11%), Query Frame = 3
Query: 1872 PAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESV-------------------------SERD-----YGMNN-----RYNQPRHP-----VPTSNFVN-------KQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            P+    + ++ +M    RNDS+SSD +         + R PP             P  +        +Q S SSSEE++ ++ + TSCDD + + ESV                         SER      YG ++      +++P+         +S  +N       K PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKVK+GS+AD  G+L  GDEVLEWN R  +  T+E+V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS      +P     +L IKL++ K    L+VT++ A++L   P +      + +VK+Y LPDR+++N RR++ V  +  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  502 PSSAVRKTKREKMETMLRNDSLSSDQSE--------SVRPPP-------------PRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSG-AMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDL---PSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 943          

HSP 2 Score: 200.29 bits (508), Expect = 3.529e-50
Identity = 109/260 (41.92%), Postives = 157/260 (60.38%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITA---SNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR SIG K   ++G SRKS S S L       KK RS+ QRS E              ++ +  +    ASR + D +    S+ G++         +    ++++    ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR LV K   K LP PYVKV+LL+  + I K++T V +RKTL+PLYQ  + F  S + ++LQ+ VWGD+GRM+ KSFMG+  I+LD+L LS++V GW+KLF
Sbjct: 1263 KKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----------GLAVEMRNWMTRQASRESTDGSMNSYSSEGNL---------IFPGVRLAS----DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKV-ARKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 1497          

HSP 3 Score: 113.235 bits (282), Expect = 1.709e-23
Identity = 65/183 (35.52%), Postives = 99/183 (54.10%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKN-----------------------SEIVKNL---------EKEVK-QFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN 965
            DLSHLTEEER+II  V+ RQK+EEEK                        +E+V N+         EKE + +  ++ +   ++V  +G +S       + +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G W++ + +N
Sbjct:   28 DLSHLTEEERKIILAVMDRQKKEEEKEQSVLKIKEEHKAQPTQWFPFSGITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEES---QQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGAWFYNSGSN 197          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q99NE5|RIMS1_MOUSE (Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 7.917e-54
Identity = 137/370 (37.03%), Postives = 193/370 (52.16%), Query Frame = 3
Query: 2031 DVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSER---DYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPR------------------------LQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            D PD   K  +    +      EE+  ++ + TSC+D + + ESVSE+   DY ++      R   P S+     PV W+ SK+   +IG +IL K       S     A+LGLKV+GGK+T  GRLGAFITKVK+GS+ADV G+L AGDEVLEWN +     T E+V  IIL+SK +P+VE+IV R I   P      +       S+    ++ R                        L +KL+Y K    L+V ++QA +L P     P    + +VKMY LPDR++++ RR++ V     PKWNQ FV+S     D R   LEI V+D  + + E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  348 DYPDRLEKREDGRVAEDEKQRKEEEGVSTPEYTSCEDVELESESVSEKGDLDYWLDPATWHSRETSPISS----HPVTWQPSKEGDRLIGRVILNKRTTMPKESG----ALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQTHD 706          

HSP 2 Score: 187.578 bits (475), Expect = 2.619e-46
Identity = 110/262 (41.98%), Postives = 148/262 (56.49%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAH-----IRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR S+  K   ++  SR+S STS L       KK +S+ QRS E   A      +R  +R +   S+N ++    S  NL       G                        ++    F++GLGP QLVGRQ L  P +G+IQ+   D+KG LEVEVIRAR+L  K   K  P PYVKV+LLE    I K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS+V GWYKLF
Sbjct: 1199 KKRRSSLSAKVVAIV--SRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYS----SEGNLIFPGVRVG-----------------------PDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRI-ARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLF 1430          

HSP 3 Score: 105.531 bits (262), Expect = 3.288e-21
Identity = 66/205 (32.20%), Postives = 103/205 (50.24%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ-------------------------------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTS 1001
            DLSHLTEEER II  V+ RQKEEEEK   ++K + +++ +                                             ++ ++  ++V  +G ++       +++D  PTC +C KTKFADG G+ C YC+ + CARCGG+VS++    S  +D  V  +W C LC+K+QE+L K+G W+ G+       D   +DT+
Sbjct:   24 DLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPDRNWRLHQQFESYKEQVRKIGEEAR--RYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLR----SNNEDKVV--MWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTA 220          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A0R3SIE4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4707 PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.839e-86
Identity = 162/288 (56.25%), Postives = 197/288 (68.40%), Query Frame = 3
Query: 3927 STSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNS---GHIQEERISRKDLTDSAKISTS--------------ERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQ 4739
            ++SQ    RKRR SIG +FS VLG S+K+++ S  DKK ++SFQRSEEVLPA+I+ + + T S       I         I AS++   G +   +      +   ++ST+              E  E HV  FVEGLGPGQLVGRQVLGMPCLGEIQLSF DRKGHLEVEVIRAR L  KN+ K LP PYVK+HLLE K S+EK RT   +R+TLDPL+Q Q  FS+SYK KILQVSVWG++GRM+KK F+GMC+I+LDDLNL SIVFGWYKLFGM A+ A HH Q
Sbjct:  740 ASSQSAAARKRRSSIGHRFSNVLGISKKNTTASGADKKTKASFQRSEEVLPAYIQTNEKATVSGGYKAPGIVAEGAGFGGIAASSAQSAGGVLGAQGGHHGSSLQHQLSTTLHSSGGSGRKDLALEMGEVHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEVEVIRARGLQQKNTSKPLPTPYVKLHLLEGKQSVEKMRTTAPARRTLDPLFQQQFSFSNSYKDKILQVSVWGEYGRMDKKVFLGMCEIVLDDLNLRSIVFGWYKLFGMIAATAQHHKQ 1027          

HSP 2 Score: 146.747 bits (369), Expect = 1.653e-31
Identity = 85/269 (31.60%), Postives = 148/269 (55.02%), Query Frame = 3
Query: 2235 VNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGS-AILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWY 3038
            V+ + V W  S+D   ++G + L+KS+    +S ++G  +  GLK++ GK  PS  +G F++ VK GS+AD+ G L  GDE+LEWN  + + L  E+V+EI+  S+   EV L V+R ++       ++        +    D  P LQ+KL Y +  Q L+V+++ A++L P  + +    C++F ++ +LP+ ++   R +R+  N+N+P W   F F  F +S     +LE+ V DY +   +  + GEV+I L    ++    WY
Sbjct:  209 VSSRSVFWSPSQDGESLVGQVYLRKSR----ASGEIGLLSSFGLKLVIGKRVPSDMVGTFVSSVKEGSVADLMGELQTGDEILEWNGHNLRGLHQEEVSEILALSRNTDEVWLTVQRVLDPGEDTKFQDEEEEEYGCAVGRRDADPHLQLKLRYDEGKQELIVSVLAARDL-PPQLNTQTWLCNSFCQITILPETSKYESRCTRVARNTNDPVWIHNFTFDNFVLS---GKELEVAVIDYRQ--GRTALIGEVLINLQVADISGRAYWY 467          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A5K3EKP2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.860e-86
Identity = 160/279 (57.35%), Postives = 197/279 (70.61%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASN-------SGHIQEERISRKDLTDSAKISTS---------ERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQ 4739
            RKRR SIGQ+FS VLG S+K+++TS +DKK ++SFQRSEEVLPAHI+ + + T S                 I AS+       +G+     I+ +  T ++ + ++         E  E HV  FVEGLGPGQLVGRQVLGMPCLGEIQLSF DRKGHLEVEVIRAR L  KN+ K LP PYVK+HLLE K S+EK RT   +R+TLDPL+Q Q  FS+SY+ KILQVSVWG++GRM+KK F+GMC+I+LDDL+L SIVFGWYKLFGM A+ A HH Q
Sbjct:  999 RKRRSSIGQRFSNVLGISKKNTATSAIDKKSKASFQRSEEVLPAHIQTNEKATVSGGYKAPGAVAEGAGFGGIAASSVQPGGGATGYQGSHHIAIQHHTSTSLLCSTAGRKDQLALEMGEVHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEVEVIRARGLQQKNTSKPLPTPYVKLHLLEGKQSVEKMRTTAPARRTLDPLFQQQFSFSNSYREKILQVSVWGEYGRMDKKVFLGMCEIVLDDLDLRSIVFGWYKLFGMIAATAQHHKQ 1277          

HSP 2 Score: 137.117 bits (344), Expect = 1.972e-28
Identity = 85/284 (29.93%), Postives = 150/284 (52.82%), Query Frame = 3
Query: 2235 VNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR----------NIELSPVATIEENINYSKKMSNSC------DDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWY 3038
             +K+   W  S D   + G + L+K  +  +S   L S+  GLK++ GK  PS  +G F++ VK GS+ADV G L  GDE+LEWN  S + L  ++V EI+  S+   E+ L V+R              S ++   E  N+ +   +        +D  P LQ+ L + ++ + L+V+++ A++L P    + +  C++F ++ +LP+ +E   R +++V N+N+P WN  F +  F   ++ + +LE+ V+DY +   +  + GEV+I L    L+    WY
Sbjct:  478 TSKRSAFWSSSPDGTSLTGQVYLRK--LRGSSGTGLLSS-FGLKLVIGKRVPSDMVGTFVSSVKEGSVADVMGELQIGDEILEWNGHSLRGLHQKEVTEILALSRKTDEIWLTVQRIFDDFNEESDGATSSSLSRHGEETNFPEDEDDDYRDTPVQEDADPHLQLTLLFDEK-RTLIVSILAARDL-PPQFNTKSWLCNSFCQISILPETDEIKTRCTKVVYNTNDPVWNHNFAYQDF---EVESRELEVAVFDYHQ--NKPALIGEVLINLQVADLSGRAYWY 751          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: K7F2H9 (Regulating synaptic membrane exocytosis 1 OS=Pelodiscus sinensis OX=13735 GN=RIMS1 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.821e-84
Identity = 271/898 (30.18%), Postives = 416/898 (46.33%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHAN-PVDIDIDFNDTSPNQIGXXXXXXXXXXXXFQRSTDHPELQRGNSKELKR-QYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYXXXXXXVSRHGHKRLPSIPPRS-------NYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHYPKISET--NSSYSDGMREPRRDSFHRSY--DPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIXXXXXXXXXXXXHS---GSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSP------QEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERD----YGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSP--------VATIEENINYSKKMSNSC---------------DDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            DLSHLTEEER II  V+ RQKEEEEK   ++K L ++ + ++       ++V  +G ++       +++D  PTC +CLKTKFADG G+ C YC+ + CARCGG+VS++          S   +W C LC+K+QE+L K+G W+ G+    P   D   +DT+                    S+D P  ++   +E  R Q  LS   A   S   +++S ++ D  K             +    R  S PPR        + Q     +      + ++     ++DD ++ + + S  +E   +  YP + E       +D  ++ + D +H  Y  DP   +  V         R    +S +     +S  + +++H  +     P       S   G+Q +   + T      +++G+ +         +     SPPT  +S     H  P      ++     P  A    + ++ +M    RNDS+SSD                    S    P    P  + +   +  +Q S SSSEE+  ++ + TSC+D + + ESVSE+     Y ++      R   P S+     PV W+ SK+   +IG +IL K       S     A+LGLKV+GGK+T  GRLGAFITKVK+GS+ADV G+L AGDEVLEWN +     T E+V  IIL+SK +P+VE+IV R I   P              +   S+KM   C                  LP +L +KL+Y K    L+V ++QA +L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ F++S     D R   LEI V+D  + + E+ +  GE++IEL    L D P WY +Q  D
Sbjct:   24 DLSHLTEEERNIILAVMDRQKEEEEKEEAMLKRLHQQFESYK-------EQVRKIGEEAR--RYQEEHKDDAPTCGICLKTKFADGCGHLCSYCRTKFCARCGGRVSLR----------SNNVMWVCNLCRKQQEILTKSGAWFFGSGPQPPSSQDGALSDTATGG-----------------SSDAPREKKARLQERSRSQTPLSTAAA---SAQEISSSSVQSDRRKGTELSQQAMGLEQKQASSRSRSEPPRERKKTALISEQNGKGGLKSERKRVPKSSLQHGQTDDRERKERHESRRLEKGKSQDYPDLPEKPEEGKVADEEKQRKEDEYHTRYRSDPNLARYPVKPHPEEQQMRMHAKVSKARHERRHS--DVALAHTEVEEADVPENKLGKRSQLQGTQDRKSLMETQRSYSIERTGDVRISVSKQLANH-----SPPTPRRSPVPTEHLEPKNHDSFKKQSRLDPGSAILMRKAKREKMETMLRNDSLSSD-------------------QSESVRPSPPKPHRSKRGGKK--RQMSVSSSEEEGASTPEYTSCEDVEIESESVSEKGDLDYYWLDPATWHSRETSPISS----HPVTWQPSKEGDRLIGRVILNKRTTMPKESG----ALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPCISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRGDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFLYSHVHRRDFRERMLEITVWDQPRVQEEESEFLGEILIELETALLDDEPHWYKLQTHD 843          

HSP 2 Score: 190.274 bits (482), Expect = 1.153e-44
Identity = 109/263 (41.44%), Postives = 148/263 (56.27%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLD------KKPRSSFQRSEEVLPAH------IRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +KRR S+  K   ++  SR+S STS L       KK +S+ QRS E   A       +R  +R +   S+N ++    S  NL       G                        ++    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVEVIRAR L  K   K  P PYVKV+LLE    + K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS+V GWYKLF
Sbjct: 1314 KKRRSSLSAKVVAIV--SRRSRSTSQLSQTDSGHKKLKSTIQRSTETGMAAEMRIRMVRQPSRESTDGSINSYS----SEGNLIFPGVRLG-----------------------ADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMVDKKGQLEVEVIRARGLTQKPGSKSTPAPYVKVYLLENGACVAKKKTRI-ARKTLDPLYQQTLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSVVIGWYKLF 1546          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A4S2M6M0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003332 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 4.521e-83
Identity = 159/265 (60.00%), Postives = 190/265 (71.70%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERI-------SRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNA 4724
            RK RPSIG KFS VLG S KSSSTSNLDKK R+ FQRSEEVLPA          S++L+      AS       +   G  Q++R        +  D+   A  + S RNE+HV  FVEGLGPGQLVGRQVLGMPCLGEIQLSF DRKGHLE+EVIRAR L  +N+ K LP PYVK+HLLE K S+EK RT  + R+TLDPLYQ Q+ FS  Y  KI+QVSVWG++GRM+KK F+GMC+++LDDL+L+S+VFGWYKLFGM AS+A
Sbjct:  782 RKNRPSIGNKFSVVLGRSHKSSSTSNLDKKARTRFQRSEEVLPA---------GSVNLSVDGAFHASGQETGDPSFRRGPFQQQRSVSSGNPDAGTDIESRASPNLS-RNESHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEIEVIRARGLQHRNTAKPLPAPYVKLHLLEGKQSVEKLRTTTAPRRTLDPLYQQQLTFSVPYNGKIMQVSVWGEYGRMDKKVFLGMCEVVLDDLDLNSVVFGWYKLFGMIASSA 1036          

HSP 2 Score: 142.895 bits (359), Expect = 3.138e-30
Identity = 83/215 (38.60%), Postives = 127/215 (59.07%), Query Frame = 3
Query: 2232 FVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYS------------------KKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNL--RPSPVKSPNAH--CSTFVKMYLLP 2810
                QPV W  S+D R +IGHM+L+K    N  S D+GS ILG+K+ GG+ + SGRL  FI++VK GS ADV G L  GDE+LEWN  S ++LT ++V++I+  SK D +VELIV+R++E +P   IEE+ + +                  + +S S     P +Q+KLF       L+V+L+ A++L  R S + +  A   C+++ ++ L+P
Sbjct:  287 MTGTQPVTWNPSRDGRRLIGHMLLRKQADRN--SADVGS-ILGVKLSGGRKSTSGRLATFISRVKSGSPADVIGQLRPGDEILEWNGHSLRDLTTDEVSQIVNGSKNDTQVELIVQRDLEETP-GFIEEDFDTTTSQSMQLAVPLYPKYRSEEGLSKSGYSWRPAVQLKLFMDSSKDQLIVSLLAARDLTSRSSLIGTTAAAAVCNSYCRIRLIP 497          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A504YRN2 (HMG-CoA synthase OS=Fasciola gigantica OX=46835 GN=FGIG_02172 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 6.227e-83
Identity = 162/271 (59.78%), Postives = 188/271 (69.37%), Query Frame = 3
Query: 3915 AENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITAS-NSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNA 4724
            A+  S S     RK RPSIG KFSTVLG S KSSSTSNLDKK R+SFQRSEEVLP               ++ +  + +R  L    S  SG +  +        DS       RNE+HV  FVEGLGPGQLVGRQVLGMPCLGEIQLSF DRKGHLEVEVIRAR L  KN+ K LP PYVK+HLLE K S+EK RT    R+TLDPLYQ Q+ FS  Y  KI+Q+S+WG++GRMEKK F+GMC+++LDDL+L S+VFGWYKLFGM ASNA
Sbjct: 1254 AQTSSGSNSRDGRKPRPSIGHKFSTVLGRSHKSSSTSNLDKKTRTSFQRSEEVLPQ---------TETQYDELSAGENARGRLQTQLSLRSGKMDAQSSGEGADYDSRGSPILMRNESHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEVEVIRARGLQHKNATKPLPAPYVKLHLLEGKQSVEKLRTTTPPRRTLDPLYQQQLTFSVPYHGKIIQISIWGEYGRMEKKVFLGMCEVVLDDLDLRSVVFGWYKLFGMIASNA 1515          

HSP 2 Score: 195.667 bits (496), Expect = 3.053e-46
Identity = 107/293 (36.52%), Postives = 176/293 (60.07%), Query Frame = 3
Query: 2244 QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNS------------------CDD--RLPRLQIKLFYSKQNQNLVVTLVQAQNLRPS--PVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
             PV W  S+D + +IGHMIL++ Q D   S D+GS +LGLK+ GGK   SGRL A+IT+VK GS ADV G L AGDEVLEWN  S ++ T +DV++I+  SK D +VELIV+R+++      ++E  + S   S++                  CD+  + P +Q+ L++      LVV L++A++L P+     S ++ C+++ ++ LLP R++   + S+L+  +N+P+WNQ F+FS +   +I   DLE+ V++    + +  + GE++I+L+   ++    WY +Q+ D
Sbjct:  692 HPVTWNPSRDGKRLIGHMILRR-QTDRGPS-DVGS-LLGLKIRGGKPNRSGRLCAYITRVKPGSPADVVGQLRAGDEVLEWNGLSLRDCTADDVSQIVHQSKADAQVELIVQRDLDSPFEYFVDEFRSQSSSPSDAFNLPAQQNSTQSLPDRWECDESRQRPSVQLSLWFDIDKSQLVVHLMRARDLIPTYQSTDSASSLCNSYCRIRLLPGRDDSTLKYSKLIARTNHPRWNQQFLFSDYTEDEIGQHDLELTVWNCALNSNEQTLMGEIIIDLSVADMSGTTYWYPLQMSD 981          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 233.802 bits (595), Expect = 1.663e-61
Identity = 161/404 (39.85%), Postives = 217/404 (53.71%), Query Frame = 3
Query: 1923 RNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMS---------------NSCDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER  G    Y       P    V   PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGK+T +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IILDS+ +P+VEL+V R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA+ L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  K + E+ D  GE++IEL    L D P WY MQ  D
Sbjct:  498 RNDSLSSDQSE--------SLRPPPPR------PYKSKRGSNKR-------QMSVSSSEEEGGSTPEYTSCEDVE--IESVSER--GDWECY-------PLDPTVWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKITETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKELPPRLDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETALLDDKPHWYKMQTHD 862          

HSP 2 Score: 188.348 bits (477), Expect = 1.682e-47
Identity = 115/295 (38.98%), Postives = 157/295 (53.22%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LP--AHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    +            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P  A  R  +R +   S+N ++    S  NL  +    G                        +     F++GLGP QLVGRQ L  P +G++Q+  I++KG LEVEVIRAR L PK   K LP PYVKV+LL+      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS V GWYKLF
Sbjct: 1162 RTDGSQSDTALGTLGAGG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKTKGSSQIQRSQETGMAVEYPRNAMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADNQFSDFLDGLGPAQLVGRQTLATPSMGDVQIGLINKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLDNGQCKAKKKTKI-ARKTLDPLYQQTLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSTVIGWYKLF 1418          

HSP 3 Score: 122.479 bits (306), Expect = 2.616e-27
Identity = 65/185 (35.14%), Postives = 99/185 (53.51%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIG 1016
            DLSHLTEEERQII  V++RQKEEE K   +++  EK ++                     +++ +  ++V  +  +           DA PTC +C KTKFADG GN C YC+ + CARCGG+VS+   +++  +D   R +W C  C+K+Q++L K+G+W+ G    P    +    + P   G
Sbjct:   25 DLSHLTEEERQIIMAVMVRQKEEEAKEQAMLRE-EKPIQAKTVNLVGNKKPPQQNDISMHQQVASYKEQVRRIAQEPQQRQQGQHKDDA-PTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSL---RSNNKEDK--RVMWVCNQCRKQQDILTKSGEWFPGQGPKPKPAGLGTAVSDPAMCG 202          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 233.417 bits (594), Expect = 2.310e-61
Identity = 161/404 (39.85%), Postives = 217/404 (53.71%), Query Frame = 3
Query: 1923 RNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMS---------------NSCDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER  G    Y       P    V   PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGK+T +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IILDS+ +P+VEL+V R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA+ L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  K + E+ D  GE++IEL    L D P WY MQ  D
Sbjct:  498 RNDSLSSDQSE--------SLRPPPPR------PYKSKRGSNKR-------QMSVSSSEEEGGSTPEYTSCEDVE--IESVSER--GDWECY-------PLDPTVWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKITETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKELPPRLDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETALLDDKPHWYKMQTHD 862          

HSP 2 Score: 187.963 bits (476), Expect = 2.128e-47
Identity = 115/295 (38.98%), Postives = 157/295 (53.22%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LP--AHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    +            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P  A  R  +R +   S+N ++    S  NL  +    G                        +     F++GLGP QLVGRQ L  P +G++Q+  I++KG LEVEVIRAR L PK   K LP PYVKV+LL+      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS V GWYKLF
Sbjct: 1213 RTDGSQSDTALGTLGAGG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKTKGSSQIQRSQETGMAVEYPRNAMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADNQFSDFLDGLGPAQLVGRQTLATPSMGDVQIGLINKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLDNGQCKAKKKTKI-ARKTLDPLYQQTLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSTVIGWYKLF 1469          

HSP 3 Score: 122.094 bits (305), Expect = 2.979e-27
Identity = 65/185 (35.14%), Postives = 99/185 (53.51%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIG 1016
            DLSHLTEEERQII  V++RQKEEE K   +++  EK ++                     +++ +  ++V  +  +           DA PTC +C KTKFADG GN C YC+ + CARCGG+VS+   +++  +D   R +W C  C+K+Q++L K+G+W+ G    P    +    + P   G
Sbjct:   25 DLSHLTEEERQIIMAVMVRQKEEEAKEQAMLRE-EKPIQAKTVNLVGNKKPPQQNDISMHQQVASYKEQVRRIAQEPQQRQQGQHKDDA-PTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSL---RSNNKEDK--RVMWVCNQCRKQQDILTKSGEWFPGQGPKPKPAGLGTAVSDPAMCG 202          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 233.417 bits (594), Expect = 2.310e-61
Identity = 161/404 (39.85%), Postives = 217/404 (53.71%), Query Frame = 3
Query: 1923 RNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMS---------------NSCDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER  G    Y       P    V   PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGK+T +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IILDS+ +P+VEL+V R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA+ L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  K + E+ D  GE++IEL    L D P WY MQ  D
Sbjct:  498 RNDSLSSDQSE--------SLRPPPPR------PYKSKRGSNKR-------QMSVSSSEEEGGSTPEYTSCEDVE--IESVSER--GDWECY-------PLDPTVWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKITETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKELPPRLDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETALLDDKPHWYKMQTHD 862          

HSP 2 Score: 188.348 bits (477), Expect = 1.975e-47
Identity = 115/295 (38.98%), Postives = 157/295 (53.22%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LP--AHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    +            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P  A  R  +R +   S+N ++    S  NL  +    G                        +     F++GLGP QLVGRQ L  P +G++Q+  I++KG LEVEVIRAR L PK   K LP PYVKV+LL+      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS V GWYKLF
Sbjct: 1235 RTDGSQSDTALGTLGAGG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKTKGSSQIQRSQETGMAVEYPRNAMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADNQFSDFLDGLGPAQLVGRQTLATPSMGDVQIGLINKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLDNGQCKAKKKTKI-ARKTLDPLYQQTLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSTVIGWYKLF 1491          

HSP 3 Score: 122.094 bits (305), Expect = 2.953e-27
Identity = 65/185 (35.14%), Postives = 99/185 (53.51%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIG 1016
            DLSHLTEEERQII  V++RQKEEE K   +++  EK ++                     +++ +  ++V  +  +           DA PTC +C KTKFADG GN C YC+ + CARCGG+VS+   +++  +D   R +W C  C+K+Q++L K+G+W+ G    P    +    + P   G
Sbjct:   25 DLSHLTEEERQIIMAVMVRQKEEEAKEQAMLRE-EKPIQAKTVNLVGNKKPPQQNDISMHQQVASYKEQVRRIAQEPQQRQQGQHKDDA-PTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSL---RSNNKEDK--RVMWVCNQCRKQQDILTKSGEWFPGQGPKPKPAGLGTAVSDPAMCG 202          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 233.417 bits (594), Expect = 2.501e-61
Identity = 161/404 (39.85%), Postives = 217/404 (53.71%), Query Frame = 3
Query: 1923 RNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMSNS---------------CDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER  G    Y       P    V   PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGK+T +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IILDS+ +P+VEL+V R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA+ L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  K + E+ D  GE++IEL    L D P WY MQ  D
Sbjct:  498 RNDSLSSDQSE--------SLRPPPPR------PYKSKRGSNKR-------QMSVSSSEEEGGSTPEYTSCEDVE--IESVSER--GDWECY-------PLDPTVWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKITETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKELPPRLDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETALLDDKPHWYKMQTHD 862          

HSP 2 Score: 188.348 bits (477), Expect = 2.132e-47
Identity = 115/295 (38.98%), Postives = 157/295 (53.22%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LP--AHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    +            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P  A  R  +R +   S+N ++    S  NL  +    G                        +     F++GLGP QLVGRQ L  P +G++Q+  I++KG LEVEVIRAR L PK   K LP PYVKV+LL+      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS V GWYKLF
Sbjct: 1266 RTDGSQSDTALGTLGAGG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKTKGSSQIQRSQETGMAVEYPRNAMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADNQFSDFLDGLGPAQLVGRQTLATPSMGDVQIGLINKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLDNGQCKAKKKTKI-ARKTLDPLYQQTLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSTVIGWYKLF 1522          

HSP 3 Score: 122.479 bits (306), Expect = 2.936e-27
Identity = 65/185 (35.14%), Postives = 99/185 (53.51%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIG 1016
            DLSHLTEEERQII  V++RQKEEE K   +++  EK ++                     +++ +  ++V  +  +           DA PTC +C KTKFADG GN C YC+ + CARCGG+VS+   +++  +D   R +W C  C+K+Q++L K+G+W+ G    P    +    + P   G
Sbjct:   25 DLSHLTEEERQIIMAVMVRQKEEEAKEQAMLRE-EKPIQAKTVNLVGNKKPPQQNDISMHQQVASYKEQVRRIAQEPQQRQQGQHKDDA-PTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSL---RSNNKEDK--RVMWVCNQCRKQQDILTKSGEWFPGQGPKPKPAGLGTAVSDPAMCG 202          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 233.417 bits (594), Expect = 2.548e-61
Identity = 161/404 (39.85%), Postives = 217/404 (53.71%), Query Frame = 3
Query: 1923 RNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI-------ELS--PVATIEENINYSKKMS---------------NSCDDRLP-RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            RNDS+SSD +         + R PP        PY      N +       Q S SSSEE+  ++ + TSC+D +  IESVSER  G    Y       P    V   PV W+ SK+  H+IG + L K     A   + G A+LGLKV+GGK+T +GRLGAFITKVK+GS+ADV G+L AGDEVL+WN +S   LT ++V  IILDS+ +P+VEL+V R I       E S  P+ +   +   S+KM                      LP +L +K++Y K    L+V ++QA+ L P     P    + +VKMY LPDR++++ RR++ V  S  PKWNQ FV+S     D R   LEI V+D  K + E+ D  GE++IEL    L D P WY MQ  D
Sbjct:  498 RNDSLSSDQSE--------SLRPPPPR------PYKSKRGSNKR-------QMSVSSSEEEGGSTPEYTSCEDVE--IESVSER--GDWECY-------PLDPTVWHHPVTWQPSKEGDHLIGRITLSKR---TAMPKEAG-ALLGLKVVGGKITETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKELPPRLDGRPR---NPYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETALLDDKPHWYKMQTHD 862          

HSP 2 Score: 188.348 bits (477), Expect = 2.052e-47
Identity = 115/295 (38.98%), Postives = 157/295 (53.22%), Query Frame = 3
Query: 3867 RSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGF-SRKSSSTSNLDK--------KPRSSFQRSEEV-----LP--AHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            R+DG  SD+ L    +            +KRR S+  +   ++G  SR+S STS L +        K  S  QRS+E       P  A  R  +R +   S+N ++    S  NL  +    G                        +     F++GLGP QLVGRQ L  P +G++Q+  I++KG LEVEVIRAR L PK   K LP PYVKV+LL+      K++T + +RKTLDPLYQ  + F  S + K+LQV VWGD+GRM+ K FMG+  I+L++L+LSS V GWYKLF
Sbjct: 1261 RTDGSQSDTALGTLGAGG----------KKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKTKGSSQIQRSQETGMAVEYPRNAMARQASRESTDGSMNSYS----SEGNLIFSGMRLG-----------------------ADNQFSDFLDGLGPAQLVGRQTLATPSMGDVQIGLINKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLDNGQCKAKKKTKI-ARKTLDPLYQQTLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSTVIGWYKLF 1517          

HSP 3 Score: 122.094 bits (305), Expect = 3.162e-27
Identity = 65/185 (35.14%), Postives = 99/185 (53.51%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQ------------------FEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIG 1016
            DLSHLTEEERQII  V++RQKEEE K   +++  EK ++                     +++ +  ++V  +  +           DA PTC +C KTKFADG GN C YC+ + CARCGG+VS+   +++  +D   R +W C  C+K+Q++L K+G+W+ G    P    +    + P   G
Sbjct:   25 DLSHLTEEERQIIMAVMVRQKEEEAKEQAMLRE-EKPIQAKTVNLVGNKKPPQQNDISMHQQVASYKEQVRRIAQEPQQRQQGQHKDDA-PTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSL---RSNNKEDK--RVMWVCNQCRKQQDILTKSGEWFPGQGPKPKPAGLGTAVSDPAMCG 202          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001274.1 (pep scaffold:Pmarinus_7.0:GL477827:23271:30299:-1 gene:ENSPMAG00000001145.1 transcript:ENSPMAT00000001274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.2 bits (487), Expect = 1.684e-55
Identity = 86/146 (58.90%), Postives = 112/146 (76.71%), Query Frame = 3
Query: 4266 HVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
             +  F++GLGP QLVGRQ L  P +GEIQ+S ID+KG LEVEVIRA+ LV K S K LP PYVKV+LLE  + I K++T + +RKTLDPLYQ  + F+   + K+LQV VWGD+GRM+ KSFMG+  I+L++L+LS++V GWYKLF
Sbjct:   59 QISDFLDGLGPAQLVGRQTLATPAMGEIQISMIDKKGQLEVEVIRAKGLVAKASAKTLPAPYVKVYLLESGICIGKKKTKI-ARKTLDPLYQQPLLFTDGPQGKVLQVIVWGDYGRMDHKSFMGVAQILLEELDLSNMVIGWYKLF 203          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001439.1 (pep scaffold:Pmarinus_7.0:GL476337:947677:1015027:-1 gene:ENSPMAG00000001272.1 transcript:ENSPMAT00000001439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.741 bits (491), Expect = 9.995e-50
Identity = 114/284 (40.14%), Postives = 163/284 (57.39%), Query Frame = 3
Query: 3864 IRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSS----TSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            +++DG  SD+ L    S            +KRRP++G K   ++G   +S+S    T +  +K RS+ +RS E             A+   ++ T  +++ +++      SG + E  +    L             A +  F++GLGP QLVGRQ L  P +GEIQ+S +D+KG LEVEVIRA+ L  K S K LP PYVKV+LLE    I K++T + +RKTLDPLYQ  + F  S   K+LQV VWGD+GRM+ KSFMG   I+L++L+LS++V GWYKLF
Sbjct: 1335 LKNDGSQSDTALGARGSGG----------KKRRPNLGSKMVAMVGLRSRSASQITQTDSSGRKLRSTVKRSTET----------GMATTLRSQLTRQESTDDSI-----TSG-MSEGSLMFPGLMFGGG--------AQITDFLDGLGPAQLVGRQTLATPPMGEIQISMVDKKGQLEVEVIRAKGLFAKPSSKTLPAPYVKVYLLENGAVIAKKKTKI-ARKTLDPLYQQPLVFEQSPSGKVLQVIVWGDYGRMDHKSFMGAARIVLEELDLSNMVIGWYKLF 1583          

HSP 2 Score: 159.458 bits (402), Expect = 2.622e-39
Identity = 114/357 (31.93%), Postives = 180/357 (50.42%), Query Frame = 3
Query: 2082 SFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVN------KQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLK-VIGGKVTPSGRLGAFITKVK-RGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVA-----------------------TIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKE-TEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            S SSSEE++ ++ +C+SC+D + + E  +ER    N  Y    H    S++ N       QPV W+ S +   +IG ++L K+  ++A   D G A+LGLK ++  K T    + AF T +  +G +  +   +   DEVLEWN +S +  T+++V  IIL+SK +P VEL+V R I   P                         +I  N   S  + +       RL IKL+Y K    LVVT + A +L   P++      + ++K+Y LPDR++++ RR+  V  S  P+WNQ F + P +  + R   LE+ ++D  +   E+    GE++IEL    L D P WY +Q  D
Sbjct:  464 SVSSSEEELASTPECSSCEDAEVESEGFAERG---NLDYYWLEH----SSWHNDGSSTPAQPVTWQPSNEGDRLIGKIVLNKTLTESAMPKDSG-ALLGLKRILFWKKTNMVFMLAFCTTLHIKGKLQCILNRIHEWDEVLEWNGQSLQGATFQEVYNIILESKPEPLVELLVSRPIGDLPRIPDGTHGHQESSSSSFESQKLERRSISLNTPTSPGLRDVPQTMPGRLSIKLWYDKVGFQLVVTTLGATDL---PLRDDGQPRNPYIKIYFLPDRSDKSKRRTTTVGRSLEPQWNQTFAYCPVQRREFREHMLELTLWDQQRSPGEESVFLGEILIELETALLDDNPHWYKLQSHD 809          

HSP 3 Score: 88.5817 bits (218), Expect = 1.021e-17
Identity = 37/106 (34.91%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  633 QFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYH 950
            +F++++++  +++  +G D        + +D  PTC +C KTKFA+G GN C YC+ R CARCG + +++P   +I        +W C  C+K+Q+LL K+G  +H
Sbjct:    1 RFQQQIESYKEQIKKIGDDGKKQLGTIEQKDEAPTCGICHKTKFAEGCGNVCSYCQTRFCARCGFRFALRP--GTIPNI----VMWLCTRCRKQQDLLVKSGTLFH 100          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002750.1 (pep scaffold:Pmarinus_7.0:GL476598:410398:413378:1 gene:ENSPMAG00000002507.1 transcript:ENSPMAT00000002750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 1.091e-46
Identity = 73/148 (49.32%), Postives = 102/148 (68.92%), Query Frame = 3
Query: 4260 EAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            ++    F++GLGP ++VGRQ L   C G+IQ+  +DR GHLEVE++RAR L  K   K  P PYVK++LLE    + K++T V +R++LDP+YQ    F  +   K+LQ+ VWGD+GRM+ K FMG   ++L+DL+LSS V GWYKLF
Sbjct:   16 DSQFSDFLDGLGPNEMVGRQTLATHCSGDIQVGMVDRTGHLEVEIVRARGLSAKRGSKSPPAPYVKLYLLESGTCLAKKKTKV-ARRSLDPVYQQHFIFEENPHGKVLQIIVWGDYGRMDNKCFMGAAQVLLEDLDLSSAVIGWYKLF 162          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005024.1 (pep scaffold:Pmarinus_7.0:GL478469:55581:62474:-1 gene:ENSPMAG00000004561.1 transcript:ENSPMAT00000005024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 6.274e-30
Identity = 61/117 (52.14%), Postives = 81/117 (69.23%), Query Frame = 3
Query: 2238 NKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI 2588
            N  PV W+ S++   +IG ++L K   D +   D G A+LGLKV+GGK+T  G+L AFITKVKRGS+AD+ G L AGDEVLEWN R  +  ++E+V  IIL SK  P+VEL+V R +
Sbjct:  400 NFHPVTWQPSREGDRLIGRIVLNKRLKDGSVPRDSG-AVLGLKVVGGKMTEPGKLCAFITKVKRGSLADIMGRLQAGDEVLEWNGRLLRGASFEEVYNIILQSKPSPQVELLVARPL 515          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004430.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.446e-14
Identity = 43/135 (31.85%), Postives = 76/135 (56.30%), Query Frame = 3
Query: 2673 LQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNE---------QNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTD-APLWYSMQ 3047
            +Q+++ + + + NL++ ++QA+ L P   +  N     FVK+YLLP R +         +N RR++ +  + NP+WNQ  V+    + +++   LE  V+DYD+ +   D  GEV IEL+ V+  D A  WY ++
Sbjct:  160 IQLQMSFDRHSGNLIIHVLQARGLAP---RDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSN-DFLGEVRIELSDVSHLDGAQRWYPLR 290          

HSP 2 Score: 56.6102 bits (135), Expect = 4.397e-8
Identity = 46/138 (33.33%), Postives = 66/138 (47.83%), Query Frame = 3
Query: 4332 PCLGEIQL--SFIDRKGHLEVEVIRARNLVPK-NSGKLLPQPYVKVHLLE--------EKMSIEKQRTPVSSRKTLDPLYQHQIFFSS----SYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKL 4700
            P  GEIQL  SF    G+L + V++AR L P+ N+G     P+VKV+LL         +  S E +R      KTL+P +   + + +      K K L+ SVW D+ R     F+G   I L D++       WY L
Sbjct:  155 PITGEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNG--FSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVW-DYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPL 289          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO42812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C7])

HSP 1 Score: 154.066 bits (388), Expect = 6.987e-43
Identity = 83/153 (54.25%), Postives = 112/153 (73.20%), Query Frame = 3
Query: 4257 NEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTA 4715
            NE H+  F+EGLGP Q+VGRQVL  P +G+IQL    RKG LEVEVIRA+ L+PK   K+LP PYVKV+++E K  I K++T  ++R+TL+PLYQ  + F      K LQ+ VWGD+GRM++K FMG+  I+LDDL+LS++  GWYKLF  ++
Sbjct:    7 NEGHLGDFIEGLGPSQMVGRQVLASPSMGDIQLGLCYRKGALEVEVIRAKGLLPKPGTKILPAPYVKVYVMEGKKCIAKKKT-RTTRRTLEPLYQQMLDFRVDINGKTLQIIVWGDYGRMDRKVFMGVVQILLDDLDLSNLCMGWYKLFSTSS 158          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO42811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C6])

HSP 1 Score: 86.2705 bits (212), Expect = 5.945e-20
Identity = 47/108 (43.52%), Postives = 65/108 (60.19%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSM 839
            DLSHLTEEER II  V+ RQK  E +  E+ K++ KEV  F+ +L+ +T       M+ + P    +N      CE+C KTKF +G G  C YCK + CARCG +V++
Sbjct:   14 DLSHLTEEERHIILEVMNRQKSLEAQTQEMQKSMLKEVASFQNQLEKKTD------MEVVNPQVKQEN-----VCEICNKTKFTEGTGKECKYCKLKCCARCGMEVTI 110          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO45977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA6])

HSP 1 Score: 67.0106 bits (162), Expect = 6.715e-11
Identity = 45/128 (35.16%), Postives = 72/128 (56.25%), Query Frame = 3
Query: 4332 PCL-GEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFS----SSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKL 4700
            PC+ G+I+LS    +G L V V+ A++L  +NS      PYVK++LL +     K +T ++ +K+ +P Y   + +S    +  K + LQV+VW DH R+ +  FMG   I L D++ S  +  WY L
Sbjct: 1181 PCVSGQIKLSIRHERGALRVMVMHAKDLSSRNSSTA-GDPYVKLYLLPDPSKTTKLKTKIA-KKSQNPTYNETLVYSNLSAADLKTRHLQVTVW-DHDRVGENDFMGGVVINLADMDSSINITNWYPL 1305          

HSP 2 Score: 57.7658 bits (138), Expect = 4.812e-8
Identity = 34/110 (30.91%), Postives = 61/110 (55.45%), Query Frame = 3
Query: 2676 QIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELA 3005
            QIKL    +   L V ++ A++L     ++ +     +VK+YLLPD ++    ++++   S NP +N+  V+S    +D++   L++ V+D+D+  E  D  G VVI LA
Sbjct: 1186 QIKLSIRHERGALRVMVMHAKDLSS---RNSSTAGDPYVKLYLLPDPSKTTKLKTKIAKKSQNPTYNETLVYSNLSAADLKTRHLQVTVWDHDRVGEN-DFMGGVVINLA 1291          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 59.6918 bits (143), Expect = 2.489e-9
Identity = 46/155 (29.68%), Postives = 73/155 (47.10%), Query Frame = 3
Query: 2658 DRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRN 3122
            ++L ++   L Y   +  L + +++AQ L   P K  +     FVK+ LLPD+  +    +R+   + NP WN+VF F  F  + +    L + V DYD+ +   D  GEV I L  + L    L ++  L     +   +GDL    MY P  N
Sbjct:    1 EQLGKIFFSLTYYSSDSVLTLKVLKAQGL---PAKDFSGTSDPFVKIMLLPDKKHK--LETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRN-DPIGEVEIPLENIDLGPVTLTFTKDLLPCKKDRVPLGDLLVSLMYQPTNN 149          

HSP 2 Score: 53.9138 bits (128), Expect = 1.893e-7
Identity = 51/202 (25.25%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 2415 TKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILD----SKFDP--EVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPR--LQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVI 2996
            T+VKR ++  V+      +EV  +       L  + +   +LD    S+ DP  EVE I   NI+L PV      + ++K +     DR+P   L + L Y   N  ++V +++A  L+   +         +VKMY++      + +++ +   + +P WN+ F+F    +  IR++     V DYD+ T+  ++ G+V++
Sbjct:   56 TRVKRKNLNPVW------NEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVE-IPLENIDLGPVT-----LTFTKDLLPCKKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDL---TGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFD-VPLDKIRDLTFVFNVMDYDRITQN-ELIGQVIL 240          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO33081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST78])

HSP 1 Score: 56.9954 bits (136), Expect = 1.670e-8
Identity = 45/139 (32.37%), Postives = 72/139 (51.80%), Query Frame = 3
Query: 2670 RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNE--QNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDV 3080
            RL   L YS  N+ L V L++A  L P   K  N   + +VKM LLPDR    Q+ RR R    ++NP +N+ FVFS     ++R   L+  V D+D+ + Q  + G V +E  ++  +   L  + +L   +++  D+
Sbjct:    5 RLCFSLNYSHYNEKLQVKLIRATRLTP---KGNNVVATPYVKMCLLPDRKRKLQSTRRHR----NSNPAFNEDFVFS-VPAEELRMRTLKFTVCDFDRFSRQ-QVIGHVQLEKGQLLFSLQYLPTACRLTVAILKGKDL 134          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: ENSORLT00000039743.1 (pep primary_assembly:ASM223467v1:11:4760816:4784632:1 gene:ENSORLG00000001636.2 transcript:ENSORLT00000039743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 1.685e-59
Identity = 136/343 (39.65%), Postives = 198/343 (57.73%), Query Frame = 3
Query: 2079 SSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINY--------SKKMSNSCDDRLP--------RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
             SFSSSEE++ T  D TSCD+ D D+ES   + +  ++ + +P    P  +    QPV W+ SKD   +IG ++L K   D     D G A+LGLKV+GGK+T SGRL AFITKVKRGS+AD  G+L  GD+VLEWN R  +  T+ +V  II++SK +P+VEL+V R I  +       +++         S+K+  S     P        ++ IKL+Y K    L+VT++ A+ L   PV+      + +VK+Y LPDR++++ RR++ V  S  P+WNQ F++SP    + R   LE+ V+D  +   E+    GEV+IEL    L D P WY +QL D
Sbjct:  332 GSFSSSEEELVTP-DYTSCDEHDRDMES---QWWDHSSWHGEP----PPMSL---QPVTWQPSKDGERLIGRIVLNKRMKDGTVPADTG-ALLGLKVVGGKMTESGRLCAFITKVKRGSLADTVGHLRPGDQVLEWNGRVLQGATFNEVYNIIMESKPEPQVELVVCRPIGNTSRPADGSHVHMDSSSSSFESQKVGPSISVTSPMSPSVLSGQVSIKLWYDKVGHQLIVTILGAKEL---PVRDDGRPRNPYVKIYFLPDRSDKSKRRTKTVKKSLEPRWNQTFMYSPVHRREFRERMLELTVWDQARVREEESQFLGEVMIELESALLDDQPHWYKLQLHD 659          

HSP 2 Score: 92.0485 bits (227), Expect = 3.848e-18
Identity = 40/99 (40.40%), Postives = 57/99 (57.58%), Query Frame = 3
Query:  699 PTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWY---------HGTHANP 968
            P  H    ++ PTC +C KTKFADG G  C YC+ R CARCGG+VS++  K           +W C +C+K+QE+L ++G++Y         HG+H  P
Sbjct:   14 PVAHTARAES-PTCGICHKTKFADGCGRACCYCQSRFCARCGGRVSLRANK----------VMWVCNVCRKQQEILTRSGEFYSNTSLLSVDHGSHGAP 101          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: ENSORLT00000002036.2 (pep primary_assembly:ASM223467v1:11:4760816:4784632:1 gene:ENSORLG00000001636.2 transcript:ENSORLT00000002036.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 1.803e-59
Identity = 136/343 (39.65%), Postives = 198/343 (57.73%), Query Frame = 3
Query: 2079 SSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINY--------SKKMSNSCDDRLP--------RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
             SFSSSEE++ T  D TSCD+ D D+ES   + +  ++ + +P    P  +    QPV W+ SKD   +IG ++L K   D     D G A+LGLKV+GGK+T SGRL AFITKVKRGS+AD  G+L  GD+VLEWN R  +  T+ +V  II++SK +P+VEL+V R I  +       +++         S+K+  S     P        ++ IKL+Y K    L+VT++ A+ L   PV+      + +VK+Y LPDR++++ RR++ V  S  P+WNQ F++SP    + R   LE+ V+D  +   E+    GEV+IEL    L D P WY +QL D
Sbjct:  332 GSFSSSEEELVTP-DYTSCDEHDRDMES---QWWDHSSWHGEP----PPMSL---QPVTWQPSKDGERLIGRIVLNKRMKDGTVPADTG-ALLGLKVVGGKMTESGRLCAFITKVKRGSLADTVGHLRPGDQVLEWNGRVLQGATFNEVYNIIMESKPEPQVELVVCRPIGNTSRPADGSHVHMDSSSSSFESQKVGPSISVTSPMSPSVLSGQVSIKLWYDKVGHQLIVTILGAKEL---PVRDDGRPRNPYVKIYFLPDRSDKSKRRTKTVKKSLEPRWNQTFMYSPVHRREFRERMLELTVWDQARVREEESQFLGEVMIELESALLDDQPHWYKLQLHD 659          

HSP 2 Score: 91.6633 bits (226), Expect = 4.026e-18
Identity = 40/99 (40.40%), Postives = 57/99 (57.58%), Query Frame = 3
Query:  699 PTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWY---------HGTHANP 968
            P  H    ++ PTC +C KTKFADG G  C YC+ R CARCGG+VS++  K           +W C +C+K+QE+L ++G++Y         HG+H  P
Sbjct:   14 PVAHTARAES-PTCGICHKTKFADGCGRACCYCQSRFCARCGGRVSLRANK----------VMWVCNVCRKQQEILTRSGEFYSNTSLLSVDHGSHGAP 101          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:101161919])

HSP 1 Score: 221.861 bits (564), Expect = 6.578e-58
Identity = 132/353 (37.39%), Postives = 204/353 (57.79%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRR---NIELSPVATIEE----------------NINYSKKMSNSCDDRLP-----RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDK-ETEQVDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q S SSSEE++ T+ + TSC+D + + ESVSE+     + ++        ++ ++  PV W+ SKD   +IG ++L K   D +   D G A+LGLKV+GGK+T SGRL AFITKV++GS+AD  G+L  GD+VLEW+ R  +  T+++V  IIL+SK +P+VEL+V R   +I   P +T  +                +I+ +  MS       P     +L +KL+Y K    L+VT++ A++L P     P    + +VK+Y LPDR++++ RR++ V  S  PKWNQ F++SP    + R   LEI ++D  +   E+ +  GE++IEL    L D P WY +Q  D
Sbjct:  507 RQVSLSSSEEELATTPEYTSCEDVEIESESVSEKGDLDGHWWDHASWHSNEASPLSLHPVTWQPSKDGDRLIGRILLNKRMKDGSVPRDSG-ALLGLKVVGGKMTESGRLCAFITKVRKGSLADTVGHLRPGDQVLEWSGRLLQGATFKEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPRTLRDAPQYLSGQLSVKLWYDKVGHQLIVTILGAKDLPPREDGRPR---NPYVKIYFLPDRSDKSKRRTKTVKKSLEPKWNQTFMYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHD 855          

HSP 2 Score: 188.734 bits (478), Expect = 1.206e-47
Identity = 87/149 (58.39%), Postives = 112/149 (75.17%), Query Frame = 3
Query: 4257 NEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            ++A    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR+LV K   K LP PYVKV+LLE  + I K++T V +RKTLDPLYQ Q+ F  S   K+LQV VWGD+GRM+ KSFMG   I+LD+L+LS++V GWYKLF
Sbjct: 1108 SDAQFSDFLDGLGPAQLVGRQTLATPSMGDIQIGMVDKKGALEVEIIRARSLVGKPGSKALPAPYVKVYLLENGVCIAKKKTKV-ARKTLDPLYQQQLPFEESPGGKVLQVIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWYKLF 1255          

HSP 3 Score: 131.724 bits (330), Expect = 3.224e-30
Identity = 67/152 (44.08%), Postives = 94/152 (61.84%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPV 971
            DLSHLTEEER+II GV+ RQK+EE K   ++K L +   QFE   D Q +K+     +   PT   D +   PTC +C KTKFADG G+ C YC+ + CARCGG+VS++          S + +W C LC+K+QE+L K+G+W++ +    V
Sbjct:   28 DLSHLTEEERRIILGVMDRQKKEEAKEQSMLKKLHQ---QFESYKD-QVKKMG----EETKPT--QDQKSEAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLR----------SNKVMWVCNLCRKQQEILTKSGEWFYSSGPGQV 159          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: rims1a (regulating synaptic membrane exocytosis 1a [Source:ZFIN;Acc:ZDB-GENE-090312-135])

HSP 1 Score: 216.853 bits (551), Expect = 2.161e-57
Identity = 138/353 (39.09%), Postives = 194/353 (54.96%), Query Frame = 3
Query: 2073 QQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNI--------ELSPVATIEENINYSKKMSNSCDDRLP----------------RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQ-VDITGEVVIELARVALTDAPLWYSMQLGD 3056
            +Q+S SSSEE+  T+ + +S DD +  IESVSER     +  + P  P      V   PV W+ SK+  H+IG + L K    +A+      A+LGLKV+GG+VT SGRLGAFITKVK+GS+ADV G+L AGDEVL+WN +     T ++V  IIL+S+ +P+VEL+V R I           P      +   S+KM     + L                 RL +KL+Y K    L+V ++QA  L   P   P    S +VKMY LPDR++++ RR++ V  +  P+WNQ FV++     D RN  LE+ V+D  +  E+     GE++IEL    L D P WY +Q  D
Sbjct:  402 RQTSVSSSEEEGVTTPEYSSGDDAE--IESVSER----GDWESYPHDPT-----VWHHPVTWQPSKEGDHLIGRITLSKR---SATMPKEAGALLGLKVVGGRVTESGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKMLPGATMKEVYNIILESQAEPQVELVVSRPIGDIPRIPDTSHPPLESSSSSFESQKMERPSLNVLSPSSPGMLQDAPQFMPGRLSVKLWYDKAGHQLIVNVLQAVELPLRPDGRPR---SPYVKMYFLPDRSDKSKRRTKAVKKTCEPRWNQTFVYTHVHRRDFRNHMLELTVWDQPRSPEEDSTFMGEILIELETALLDDKPHWYPLQTHD 737          

HSP 2 Score: 113.235 bits (282), Expect = 1.147e-24
Identity = 66/169 (39.05%), Postives = 94/169 (55.62%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSIL----PTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQ 1010
            DLSHLTE+ER+II  VL RQKEEE K   ++K     VK F   L    Q+  S   ++++        + ++D  PTC +C KTKFADG GN C YC+ + CARCGG+VS++   N++        +W C  C+K+QE+L K G W+      P  +    ++ S  Q
Sbjct:   23 DLSHLTEDERKIIMAVLARQKEEEAKEEAMLK-----VKVFTLFLSRGIQQQLSSYRETVIRQATAAAGSVHRDDAPTCGVCHKTKFADGCGNLCSYCQTKFCARCGGRVSLR--SNTV--------IWVCNNCRKQQEILTKPGDWFSSLPGKPAGLGSAVSEPSVCQ 176          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:101161919])

HSP 1 Score: 189.889 bits (481), Expect = 1.710e-53
Identity = 87/149 (58.39%), Postives = 112/149 (75.17%), Query Frame = 3
Query: 4257 NEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLF 4703
            ++A    F++GLGP QLVGRQ L  P +G+IQ+  +D+KG LEVE+IRAR+LV K   K LP PYVKV+LLE  + I K++T V +RKTLDPLYQ Q+ F  S   K+LQV VWGD+GRM+ KSFMG   I+LD+L+LS++V GWYKLF
Sbjct:  103 SDAQFSDFLDGLGPAQLVGRQTLATPSMGDIQIGMVDKKGALEVEIIRARSLVGKPGSKALPAPYVKVYLLENGVCIAKKKTKV-ARKTLDPLYQQQLPFEESPGGKVLQVIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWYKLF 250          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000023007.1 (SMESG000023007.1)

HSP 1 Score: 2746.46 bits (7118), Expect = 0.000e+0
Identity = 1394/1417 (98.38%), Postives = 1398/1417 (98.66%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIGXXXXXXXXXXXXFQRSTDHPELQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYXXXXXXVSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHYPKISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIXXXXXXXXXXXXHSGSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWDNTPVNFTDNVDYGIXXXXXXXXXXXXXXXQQDVKEIKGYDPNLEVLMNKAPNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLSTYSEEGPRRVNQRSSGNPNFNESYTPSKDPRKKDSNFQNHKPDLDESRLIDDGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQEAKFENLEIQKDVDXXXXXXXXXXXEQNQIRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQKQNSNSPEN 4766
            DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIGSMSTVLSSSNLSFQRSTDHPELQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYSNNSSNVSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHY KISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIPPKVPPRPVRSSHSGSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRD DIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWD+TPVNFTDNVDYGISSPRRKNKNDNKRSRQQDVKEIKGYDPNLEVLMNKAPNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLSTYSEEGPRRVNQRSSGNPNFNESYT SKDPRKKDSNFQNHKPDLDESRLIDDGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQE KFENLEIQKDVDSKSQSSRKASSEQNQIRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASI               +ITASNSGHIQEERISRKDLTDSAKISTSERNEAHVE+FVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQKQ+SNSPEN
Sbjct:   13 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIGSMSTVLSSSNLSFQRSTDHPELQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYSNNSSNVSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHYTKISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIPPKVPPRPVRSSHSGSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDHDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWDSTPVNFTDNVDYGISSPRRKNKNDNKRSRQQDVKEIKGYDPNLEVLMNKAPNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLSTYSEEGPRRVNQRSSGNPNFNESYTTSKDPRKKDSNFQNHKPDLDESRLIDDGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQETKFENLEIQKDVDSKSQSSRKASSEQNQIRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASI---------------NITASNSGHIQEERISRKDLTDSAKISTSERNEAHVETFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQKQSSNSPEN 1414          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000023007.1 (SMESG000023007.1)

HSP 1 Score: 1673.29 bits (4332), Expect = 0.000e+0
Identity = 845/876 (96.46%), Postives = 852/876 (97.26%), Query Frame = 3
Query: 2139 DRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWDNTPVNFTDNVDYGIXXXXXXXXXXXXXXXQQDVKEIKGYDPNLEVLMNKAPNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLSTYSEEGPRRVNQRSSGNPNFNESYTPSKDPRKKDSNFQNHKPDLDESRLIDDGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQEAKFENLEIQKDVDXXXXXXXXXXXEQNQIRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTDSAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQKQNSNSPEN 4766
            +R   I   +E +YGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWD+TPVNFTDNVDYGISSPRRKNKNDNKRSRQQDVKEIKGYDPNLEVLMNKAPNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLSTYSEEGPRRVNQRSSGNPNFNESYT SKDPRKKDSNFQNHKPDLDESRLIDDGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQE KFENLEIQKDVDSKSQSSRKASSEQNQIRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASI               +ITASNSGHIQEERISRKDLTDSAKISTSERNEAHVE+FVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQKQ+SNSPEN
Sbjct:    2 ERFSQISGPNEPNYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWDSTPVNFTDNVDYGISSPRRKNKNDNKRSRQQDVKEIKGYDPNLEVLMNKAPNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLSTYSEEGPRRVNQRSSGNPNFNESYTTSKDPRKKDSNFQNHKPDLDESRLIDDGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQETKFENLEIQKDVDSKSQSSRKASSEQNQIRSDGCVSDSGLKENRSAENPSTSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIRGDNRNTASI---------------NITASNSGHIQEERISRKDLTDSAKISTSERNEAHVETFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHHHTQKQSSNSPEN 862          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000023007.1 (SMESG000023007.1)

HSP 1 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 551/553 (99.64%), Postives = 551/553 (99.64%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIGXXXXXXXXXXXXFQRSTDHPELQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYXXXXXXVSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHYPKISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIXXXXXXXXXXXXHSGSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSER 2174
            DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIGSMSTVLSSSNLSFQRSTDHPELQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYSNNSSNVSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHY KISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIPPKVPPRPVRSSHSGSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRD DIESVSER
Sbjct:   13 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLAKTGQWYHGTHANPVDIDIDFNDTSPNQIGSMSTVLSSSNLSFQRSTDHPELQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYSNNSSNVSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKYNSSYPIESYDNIHYTKISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVSDANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIPPKVPPRPVRSSHSGSQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRGMHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDHDIESVSER 565          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037628.1 (SMESG000037628.1)

HSP 1 Score: 192.586 bits (488), Expect = 2.821e-56
Identity = 86/134 (64.18%), Postives = 108/134 (80.60%), Query Frame = 3
Query: 4329 MPCLGEIQLSFIDRKGHLEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLDPLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSIVFGWYKLFGMTASNAHH 4730
            MP LGE+QLSFID+KG L++EVIRAR L PK + K+LPQPYVK++L++ K  IEKQ+T VS R+TLDPLYQ Q+ FSS Y  K+LQ +VWG++ RM+KKSFMG C+I+LDDL+ SSIVFGWYKL+   AS   H
Sbjct:    1 MPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLVSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPH 134          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 211.46 bits (537), Expect = 5.744e-55
Identity = 159/440 (36.14%), Postives = 228/440 (51.82%), Query Frame = 3
Query: 1899 QRRMHQGYRNDSMSSDPASEPNMIKRVTSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCTSCDDRDPDIESVSERDYGMNNRYNQP-----------------------RHPVPTSNFVNK---------------QPVIWKMSKDKRHMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKRGSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVRRNIE---------LSPVATIEENINYSKKMSNSCDDRLP--------RLQIKLFYSKQNQNLVVTLVQAQNLRPSPVKSPN-AHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQVFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAPLWYSMQL 3050
            +R++   YRNDS+SSDP+          SR        I SP T +  Y   Y NR  +Q+SFSSSE+D+ TSI+CTS DD++ +I+S+SERD    N++  P                        H   +S  V++                PV WK SKD + +IGHMIL+K   D  S+ + GSAILGLKV GGK+T +G+  A+ITKVK  SIAD  G+L++GDEV+EWN +SF+ LT ++VNEII +SK +  +ELIV+RNI+          S    I+ N  Y +K         P         +QI+LFY+      VV LV A NL P     PN    S FV+  +  ++     R S ++ ++ +P W+Q FVF       +++ DL   V+ YD    +   T EV+I+L+R   ++    Y + L
Sbjct:  379 RRKLETLYRNDSLSSDPS-------EAASR-------KIVSP-TKLHSY---YPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQD-LSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSAESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIP-----PNFTRYSCFVQFIVGSEK-----RESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTL 789          

HSP 2 Score: 86.6557 bits (213), Expect = 1.235e-16
Identity = 54/160 (33.75%), Postives = 81/160 (50.62%), Query Frame = 3
Query:  516 DLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEVKQFEKELDTQTQKVSSVGM-DSILPTTHNDNQDAGPTCELCLKTKFADGLGNPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKK---KQELLAKTGQWYHGTHANPVDIDI 983
            DLSHL+E ER+II  VL RQK ++ +N +I++N ++E  Q      T  ++   +   +SI   +   N   G  C +C  TKFAD  G  C  C  + C+RCG  V        I ++      W C+ CKK   K E+L KT +    ++ +  D+DI
Sbjct:   12 DLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGN--YGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSV-------EILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDI 162          

HSP 3 Score: 78.9518 bits (193), Expect = 3.280e-14
Identity = 38/47 (80.85%), Postives = 44/47 (93.62%), Query Frame = 3
Query: 3951 RKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLPAHIR 4091
            RKRRPSIGQKFS+VL  SRKS+STSNL+KK R+SFQRSEEV+PAHI+
Sbjct: 1075 RKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIK 1121          
The following BLAST results are available for this feature:
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIMS27.669e-6238.53regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS24.774e-6038.53regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS21.122e-5938.53regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS21.639e-5938.53regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS24.544e-5938.53regulating synaptic membrane exocytosis 2 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-107.325e-3851.37Rab-3-interacting molecule unc-10 [Source:UniProt... [more]
unc-101.456e-2740.97Rab-3-interacting molecule unc-10 [Source:UniProt... [more]
cla-11.038e-2225.80CLArinet, functional homolog of cytomatrix at the ... [more]
cla-11.038e-2225.80CLArinet, functional homolog of cytomatrix at the ... [more]
cla-16.997e-2225.80CLArinet, functional homolog of cytomatrix at the ... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rim6.310e-5646.90gene:FBgn0053547 transcript:FBtr0336723[more]
Rim7.918e-5646.90gene:FBgn0053547 transcript:FBtr0336715[more]
Rim2.005e-5546.90gene:FBgn0053547 transcript:FBtr0336722[more]
Rim2.492e-5546.90gene:FBgn0053547 transcript:FBtr0336714[more]
Rim2.534e-5546.90gene:FBgn0053547 transcript:FBtr0336716[more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rims1a1.997e-6138.92regulating synaptic membrane exocytosis 1a [Source... [more]
rims1a2.935e-6038.92regulating synaptic membrane exocytosis 1a [Source... [more]
rims1a3.145e-6038.92regulating synaptic membrane exocytosis 1a [Source... [more]
rims2a2.422e-5946.51regulating synaptic membrane exocytosis 2a [Source... [more]
rims1b1.648e-5740.06regulating synaptic membrane exocytosis 1b [Source... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amotl13.185e-5837.10angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl13.485e-5838.76angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl13.935e-5838.76angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl14.371e-5838.76angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl14.426e-5838.76angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rims21.101e-6035.48regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims24.808e-5533.19regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims24.958e-5533.19regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims25.206e-5533.19regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims11.319e-4955.41regulating synaptic membrane exocytosis 1 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JIS1|RIMS2_RAT6.275e-5834.40Regulating synaptic membrane exocytosis protein 2 ... [more]
sp|Q9JIR4|RIMS1_RAT9.401e-5538.38Regulating synaptic membrane exocytosis protein 1 ... [more]
sp|Q86UR5|RIMS1_HUMAN1.193e-5438.38Regulating synaptic membrane exocytosis protein 1 ... [more]
sp|Q9EQZ7|RIMS2_MOUSE3.363e-5433.19Regulating synaptic membrane exocytosis protein 2 ... [more]
sp|Q99NE5|RIMS1_MOUSE7.917e-5437.03Regulating synaptic membrane exocytosis protein 1 ... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SIE41.839e-8656.25Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3EKP24.860e-8657.35Uncharacterized protein OS=Mesocestoides corti OX=... [more]
K7F2H94.821e-8430.18Regulating synaptic membrane exocytosis 1 OS=Pelod... [more]
A0A4S2M6M04.521e-8360.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YRN26.227e-8359.78HMG-CoA synthase OS=Fasciola gigantica OX=46835 GN... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rims1a1.663e-6139.85regulating synaptic membrane exocytosis 1 [Source:... [more]
rims1a2.310e-6139.85regulating synaptic membrane exocytosis 1 [Source:... [more]
rims1a2.310e-6139.85regulating synaptic membrane exocytosis 1 [Source:... [more]
rims1a2.501e-6139.85regulating synaptic membrane exocytosis 1 [Source:... [more]
rims1a2.548e-6139.85regulating synaptic membrane exocytosis 1 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001274.11.684e-5558.90pep scaffold:Pmarinus_7.0:GL477827:23271:30299:-1 ... [more]
ENSPMAT00000001439.19.995e-5040.14pep scaffold:Pmarinus_7.0:GL476337:947677:1015027:... [more]
ENSPMAT00000002750.11.091e-4649.32pep scaffold:Pmarinus_7.0:GL476598:410398:413378:1... [more]
ENSPMAT00000005024.16.274e-3052.14pep scaffold:Pmarinus_7.0:GL478469:55581:62474:-1 ... [more]
ENSPMAT00000004430.11.446e-1431.85pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428126.987e-4354.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428115.945e-2043.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459776.715e-1135.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.489e-929.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330811.670e-832.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039743.11.685e-5939.65pep primary_assembly:ASM223467v1:11:4760816:478463... [more]
ENSORLT00000002036.21.803e-5939.65pep primary_assembly:ASM223467v1:11:4760816:478463... [more]
RIMS26.578e-5837.39regulating synaptic membrane exocytosis 2 [Source:... [more]
rims1a2.161e-5739.09regulating synaptic membrane exocytosis 1a [Source... [more]
RIMS21.710e-5358.39regulating synaptic membrane exocytosis 2 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023007.10.000e+098.38SMESG000023007.1[more]
SMESG000023007.10.000e+096.46SMESG000023007.1[more]
SMESG000023007.10.000e+099.64SMESG000023007.1[more]
SMESG000037628.12.821e-5664.18SMESG000037628.1[more]
SMESG000037636.15.744e-5536.14SMESG000037636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002255 ID=SMED30002255|Name=Regulating synaptic membrane exocytosis protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=5146bp
TAATCAGCATTTGAATGACTTGTGTCATTGTGTATGATCAAGGCCTAGTT
TCTAATGATGTAAATGTATTAATTTTGATGATCATTGGAGTTATTCAATC
AAATTTAACCAGGATCTTAAAAGAATTCATCGACACTCGCCCTACAATAA
TCGAATCTCCGAGCGTGTGTGTGCACACAACGACACAATAAACACACAAC
AGGCAATGAAATCAGCATCCTACTACTACTATTAATTACATTCTTCAAAA
TTACTCATATTTTAGTAATACATAATTAATAATTTCCAAAGTATTTTCTC
CGCAATCGATTGCCATGCTAATAATAATGTGGAATAATTGCAAAATTGAT
AATCTACTTCCTGTGATACAAGTGATTGGAATAATACATATGTGAATATC
TCTCTATTGTTAGATTTTCGTTTATTTCTATTTTGAAAAATTGTAACATT
TCAATATTTCTTTTTTTACTTCAATCATCATGACATCTCGACGGCCTTCT
CTGCCACCGTTACCCGATTTATCCCATCTCACAGAAGAAGAAAGACAAAT
CATCGAAGGAGTACTTTTGAGACAAAAAGAAGAGGAAGAGAAAAATTCAG
AAATTGTAAAGAACTTGGAGAAAGAAGTCAAACAATTCGAAAAGGAATTG
GATACTCAAACTCAGAAAGTATCATCAGTGGGAATGGATTCCATTTTACC
AACAACGCATAACGATAATCAGGATGCTGGACCAACTTGTGAACTGTGCT
TGAAAACAAAATTTGCTGACGGCTTAGGCAATCCCTGCCATTACTGCAAA
CGAAGAACTTGTGCTAGATGTGGCGGCAAAGTATCAATGAAACCTCCTAA
AAATTCTATTGCAAAGGACTACTCGGTGAGATTTGTGTGGACCTGTAAGC
TTTGCAAAAAGAAACAAGAATTACTGGCAAAGACCGGACAATGGTACCAT
GGAACACACGCCAATCCTGTGGATATTGACATAGACTTTAATGATACGTC
ACCCAACCAAATTGGTTCAATGAGCACAGTATTAAGTAGTTCCAATCTCA
GCTTTCAACGATCAACTGACCATCCAGAACTGCAAAGAGGAAATAGTAAA
GAACTCAAAAGACAATACTCACTTTCTGAAGGACAAGCTGCTCAAAGATC
AATGTCTAACATGAATAATTCTCAGATTAAAATAGACTTTCACAAGCCGG
ATTCGGATTACTCGAATAATAGCTCCAACGTGTCGCGTCATGGTCACAAA
AGACTGCCTTCAATTCCACCAAGATCAAATTATCAACAATCTGCTTCACC
AATGAGTCTTCCTGGATCTGACATTCATCAAACACATAAGCCTCGAGACC
GATCAGATGATGTCGACCAATCGAAATACAATTCATCTTATCCTATTGAG
TCTTACGATAATATTCATTATCCGAAGATTTCCGAAACCAATTCCAGCTA
TTCAGACGGAATGAGAGAACCGCGTCGTGATTCTTTTCATCGATCCTATG
ATCCATTATATGATCAAGACTTTGTGTCGGATGCTAACCTTTTTAATACT
CGCAGAAAACAAACAAATATATCTATGAGCCCACAATTAGAAAGCTATTC
ATATTTCAATCATTCGATGTCCCATGAAAATATTCCACCAAAAGTGCCTC
CTAGGCCTGTAAGAAGTTCTCACTCAGGATCTCAACGACAGTTGCCTCGT
ATAACTACAGATATGATAAAAGGGGCGCAACAGTCCGGCAATCCAAAATC
AAAGCAACATTATCCATTTATGCAATACCCTCCACATTCATGCAGTCCAC
CCACCAGAGTACAAAGCTCTCCTAGGGGAATGCATTTTTCTCCCCAAGAA
ATGTATAATACCAGTCCTCGACCAGCTCATAATAGTCATCAAATTCGTCA
AAGGCGAATGCACCAGGGATATAGAAATGATTCAATGAGTAGTGATCCAG
CTTCGGAGCCAAATATGATTAAACGGGTCACATCCAGAACTCCACCAAAT
GAAGACAGTTCAATTTACAGTCCTTACACTGACGTACCAGACTATAATAA
CAAATACAACAACAGATATCCACAGCAAAGCTCTTTCAGCAGTAGTGAAG
AAGATGTTCAAACCTCAATTGATTGTACGAGCTGTGATGATAGAGATCCT
GACATTGAAAGTGTGTCGGAAAGAGATTATGGAATGAACAACCGTTACAA
TCAGCCGCGCCATCCAGTGCCGACATCAAATTTCGTGAATAAACAGCCAG
TCATTTGGAAAATGAGCAAAGACAAAAGACACATGATTGGGCATATGATC
TTGCAGAAATCTCAGATAGATAACGCGTCTTCCAATGATTTAGGTTCAGC
CATTCTAGGTCTGAAGGTTATTGGTGGTAAAGTAACTCCATCTGGTCGTC
TGGGAGCTTTTATAACGAAAGTAAAACGTGGAAGCATAGCAGATGTTTAT
GGAAATCTAGTGGCAGGAGATGAAGTACTTGAATGGAATGCTCGATCATT
TAAAAATCTAACATATGAAGATGTTAACGAAATAATCTTGGATTCCAAAT
TTGATCCTGAAGTTGAATTGATTGTCAGAAGAAACATCGAATTATCACCT
GTAGCAACTATTGAGGAAAATATAAACTACTCCAAGAAAATGTCTAATTC
ATGTGATGATAGATTGCCAAGACTTCAGATAAAACTATTTTATTCAAAAC
AAAACCAAAATTTGGTGGTTACCCTTGTTCAAGCGCAGAACTTGAGGCCA
TCACCAGTTAAGTCACCGAATGCTCATTGTTCGACTTTTGTCAAAATGTA
CCTTCTACCGGATAGAAATGAACAAAATTATCGTCGGTCGAGATTAGTGC
CTAACAGCAACAATCCAAAATGGAATCAAGTATTTGTGTTTTCGCCATTC
AAAATATCGGACATCCGAAATATCGACTTGGAAATAATAGTATATGATTA
CGATAAGGAAACGGAACAAGTTGACATAACCGGTGAAGTTGTTATTGAAC
TTGCTAGAGTAGCCTTAACTGATGCCCCTCTGTGGTATTCAATGCAACTT
GGAGATAACATGGTCGAGGAATCTGATGTTGGAGATCTCTCATCAGAAGC
AATGTATGATCCAATGAGAAATCCGGCGAGCAAAGAATATTGGGATCCAA
CTATCAGAGACGATCGCGATTACTGGGACAACACTCCAGTGAACTTCACA
GATAACGTCGATTATGGGATTTCTTCACCGAGAAGAAAAAACAAAAATGA
CAACAAAAGATCAAGGCAACAAGACGTGAAAGAAATTAAAGGATATGATC
CTAATTTAGAAGTTCTTATGAACAAAGCTCCAAACCATTCTGGACCATAC
CCAGACCTCAGATATGACAAAAGGTTCCAAATTCCAGACGAGAACATAAA
CTATGAGCTTGAGAATAAAATGAGACGAAGTACTGTAAAATCCCCTCCAA
GAGCAGTTGAAAACGATTTATTGTCAACTTACAGTGAAGAGGGTCCAAGA
CGTGTAAATCAACGATCCAGTGGCAATCCAAATTTCAACGAAAGTTACAC
ACCGAGTAAAGATCCCCGAAAAAAAGACTCAAATTTTCAAAATCACAAGC
CTGATTTAGATGAAAGCCGGCTCATTGATGACGGCGTATCAGAAACATCG
GAAATTTCAGAAAACTCTAAAAACAGTTTAAGATCAATTCAATCTGAGCA
GGTCGTGAAAACATCGACATTGAATACGAGAAACAACGAAGTAACTCCAA
TACAGGAAAACGTCCCAATACTACAAGAAGCGAAATTTGAAAATTTGGAA
ATTCAAAAGGATGTTGATTCAAAATCGCAGTCGTCTCGTAAAGCAAGTTC
TGAGCAAAATCAAATAAGATCTGACGGATGCGTTTCGGATTCTGGGTTAA
AAGAAAACAGATCAGCTGAAAACCCTTCAACCAGCCAAGAACCTACTCGC
AGAAAAAGACGACCCAGTATTGGCCAAAAGTTTAGTACAGTATTAGGATT
TTCGAGAAAGAGCAGCAGCACATCAAATTTAGACAAAAAGCCTCGGTCGT
CGTTCCAGCGGAGCGAGGAAGTGCTACCAGCTCACATCAGAGGAGACAAT
CGAAATACAGCATCTATAAGTCTTAATAAATTTACAATAAATGATGCTAG
TAGAAATAATTTAGATATTACCGCCAGCAATTCCGGACATATTCAGGAGG
AAAGAATCAGTCGAAAAGATTTAACTGACAGTGCCAAAATTTCTACTTCT
GAACGAAATGAAGCTCATGTTGAATCGTTTGTTGAAGGTTTAGGTCCAGG
CCAATTGGTAGGACGTCAAGTTCTTGGAATGCCATGTCTTGGAGAAATTC
AATTAAGTTTCATTGATAGGAAAGGTCATTTGGAAGTTGAAGTCATTAGA
GCTCGAAATTTAGTGCCGAAAAATAGTGGCAAACTACTGCCACAGCCTTA
TGTGAAAGTCCATTTATTGGAAGAAAAAATGTCAATAGAAAAACAAAGAA
CGCCTGTCTCGTCCCGAAAGACGCTCGATCCTCTATATCAACATCAAATA
TTTTTCAGTAGCTCATACAAGCATAAAATACTCCAGGTAAGTGTATGGGG
TGACCATGGTAGAATGGAAAAGAAGAGCTTTATGGGAATGTGTGATATCA
TGCTGGATGATCTTAATCTGTCATCAATTGTTTTCGGATGGTATAAGCTT
TTTGGAATGACAGCATCAAATGCCCATCACCATACACAGAAACAAAATTC
AAATTCTCCAGAAAATTAACAACCTCAGCAGATCATTATCAGATTTCCTT
ATTTGAATGCACTACAAGCCATATAGATTTGGCTTACTCCACCCGTCTTT
CGATGTAGTTTTTTATTTTCAAGACCTTATCGTAATAAACTTTTTTAGAG
ATGGGATTTTCCATTTCCTGATGTAGATTTATTAAATATTTATGTAATAA
ATTATTCATCTTGCTGACATTCTGCAAAATTACTATTATTTTATGATTTT
TCGACTCCTTAATACCATTTTTAAATTCTACCGAAAGTTCAGTCAAACAA
CACATCCCAGTTTCATTTTATTATCAATTTTATTATGGCAATTTGTGAAC
TTATTGTCGACTGAACTTGGATATTTTCAATATATTCACAAGATTA
back to top

protein sequence of SMED30002255-orf-1

>SMED30002255-orf-1 ID=SMED30002255-orf-1|Name=SMED30002255-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1430bp
MTSRRPSLPPLPDLSHLTEEERQIIEGVLLRQKEEEEKNSEIVKNLEKEV
KQFEKELDTQTQKVSSVGMDSILPTTHNDNQDAGPTCELCLKTKFADGLG
NPCHYCKRRTCARCGGKVSMKPPKNSIAKDYSVRFVWTCKLCKKKQELLA
KTGQWYHGTHANPVDIDIDFNDTSPNQIGSMSTVLSSSNLSFQRSTDHPE
LQRGNSKELKRQYSLSEGQAAQRSMSNMNNSQIKIDFHKPDSDYSNNSSN
VSRHGHKRLPSIPPRSNYQQSASPMSLPGSDIHQTHKPRDRSDDVDQSKY
NSSYPIESYDNIHYPKISETNSSYSDGMREPRRDSFHRSYDPLYDQDFVS
DANLFNTRRKQTNISMSPQLESYSYFNHSMSHENIPPKVPPRPVRSSHSG
SQRQLPRITTDMIKGAQQSGNPKSKQHYPFMQYPPHSCSPPTRVQSSPRG
MHFSPQEMYNTSPRPAHNSHQIRQRRMHQGYRNDSMSSDPASEPNMIKRV
TSRTPPNEDSSIYSPYTDVPDYNNKYNNRYPQQSSFSSSEEDVQTSIDCT
SCDDRDPDIESVSERDYGMNNRYNQPRHPVPTSNFVNKQPVIWKMSKDKR
HMIGHMILQKSQIDNASSNDLGSAILGLKVIGGKVTPSGRLGAFITKVKR
GSIADVYGNLVAGDEVLEWNARSFKNLTYEDVNEIILDSKFDPEVELIVR
RNIELSPVATIEENINYSKKMSNSCDDRLPRLQIKLFYSKQNQNLVVTLV
QAQNLRPSPVKSPNAHCSTFVKMYLLPDRNEQNYRRSRLVPNSNNPKWNQ
VFVFSPFKISDIRNIDLEIIVYDYDKETEQVDITGEVVIELARVALTDAP
LWYSMQLGDNMVEESDVGDLSSEAMYDPMRNPASKEYWDPTIRDDRDYWD
NTPVNFTDNVDYGISSPRRKNKNDNKRSRQQDVKEIKGYDPNLEVLMNKA
PNHSGPYPDLRYDKRFQIPDENINYELENKMRRSTVKSPPRAVENDLLST
YSEEGPRRVNQRSSGNPNFNESYTPSKDPRKKDSNFQNHKPDLDESRLID
DGVSETSEISENSKNSLRSIQSEQVVKTSTLNTRNNEVTPIQENVPILQE
AKFENLEIQKDVDSKSQSSRKASSEQNQIRSDGCVSDSGLKENRSAENPS
TSQEPTRRKRRPSIGQKFSTVLGFSRKSSSTSNLDKKPRSSFQRSEEVLP
AHIRGDNRNTASISLNKFTINDASRNNLDITASNSGHIQEERISRKDLTD
SAKISTSERNEAHVESFVEGLGPGQLVGRQVLGMPCLGEIQLSFIDRKGH
LEVEVIRARNLVPKNSGKLLPQPYVKVHLLEEKMSIEKQRTPVSSRKTLD
PLYQHQIFFSSSYKHKILQVSVWGDHGRMEKKSFMGMCDIMLDDLNLSSI
VFGWYKLFGMTASNAHHHTQKQNSNSPEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006355regulation of transcription, DNA-templated
GO:0006886intracellular protein transport
GO:0017157regulation of exocytosis
GO:0048791calcium ion-regulated exocytosis of neurotransmitter
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
GO:0048786presynaptic active zone
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR036034PDZ_sf
IPR039032Rim-like
IPR000551MerR-type_HTH_dom
IPR001478PDZ
IPR000008C2_dom
IPR013083Znf_RING/FYVE/PHD
IPR010911Rab_BD
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005515protein binding
GO:0017137Rab GTPase binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 29..63
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 915..939
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 263..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 459..515
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..303
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1055..1071
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 189..226
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1168..1188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1119..1134
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 910..940
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1189..1203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 243..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1004..1024
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 483..515
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1109..1204
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 999..1071
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1025..1054
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 208..226
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 626..700
e-value: 4.20407E-12
score: 61.0434
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1285..1410
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 727..856
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 624..703
e-value: 5.2E-9
score: 45.9
IPR001478PDZ domainPFAMPF00595PDZcoord: 625..699
e-value: 1.1E-5
score: 25.6
IPR001478PDZ domainPROSITEPS50106PDZcoord: 605..686
score: 13.33
IPR000008C2 domainSMARTSM00239C2_3ccoord: 744..853
e-value: 6.8E-14
score: 62.2
coord: 1300..1404
e-value: 1.2E-8
score: 44.8
IPR000008C2 domainPFAMPF00168C2coord: 744..849
e-value: 1.2E-12
score: 48.0
coord: 1299..1407
e-value: 8.3E-15
score: 54.9
IPR000008C2 domainPROSITEPS50004C2coord: 744..838
score: 14.275
IPR000008C2 domainPROSITEPS50004C2coord: 1301..1389
score: 12.795
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1270..1414
e-value: 2.9E-32
score: 113.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 729..856
e-value: 2.0E-26
score: 94.3
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 582..703
e-value: 5.9E-26
score: 93.1
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 625..704
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 6..168
e-value: 3.8E-33
score: 116.0
IPR039032Rim-likePANTHERPTHR12157RAB3 INTERACTING MOLECULE RIM -RELATEDcoord: 11..1425
IPR010911Rab-binding domainPROSITEPS50916RABBDcoord: 11..159
score: 11.256
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 15..162