Nucleobindin 2

Overview
NameNucleobindin 2
Smed IDSMED30002242
Length (bp)1242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleobindin 2 (SMED30002242) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleobindin 2 (SMED30002242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleobindin 2 (SMED30002242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleobindin 2 (SMED30002242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30002242h1SMcG0021085 SmedASXL_019713SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30002242h1SMcG0021085 SmedASXL_019713SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002242h1SMcG0021085 SmedASXL_019713SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30002242h1SMcG0021085 Contig38455newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002242h1SMcG0021085 Contig38455uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30002242h1SMcG0021085 dd_Smed_v4_6912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002242h1SMcG0021085 dd_Smed_v4_6912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002242h1SMcG0021085 dd_Smed_v4_6912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002242h1SMcG0021085 SMED30002242smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30002242h1SMcG0021085 SMED30002242smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30002242h1SMcG0021085 dd_Smed_v6_6912_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30002242h1SMcG0021085 dd_Smed_v4_6912_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleobindin 2 vs. Ensembl Human
Match: NUCB1 (nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043])

HSP 1 Score: 123.25 bits (308), Expect = 2.309e-30
Identity = 86/247 (34.82%), Postives = 139/247 (56.28%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKS--KRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSE 1065
            E+K +E++RL        RML  +   ++ + +   D+L   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  +K   ++LEE    ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E W+T E
Sbjct:  102 ELKRQEVSRL--------RMLLKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEE---QQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVE 337          
BLAST of Nucleobindin 2 vs. Ensembl Human
Match: NUCB1 (nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043])

HSP 1 Score: 123.25 bits (308), Expect = 2.309e-30
Identity = 86/247 (34.82%), Postives = 139/247 (56.28%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKS--KRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSE 1065
            E+K +E++RL        RML  +   ++ + +   D+L   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  +K   ++LEE    ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E W+T E
Sbjct:  102 ELKRQEVSRL--------RMLLKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEE---QQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVE 337          
BLAST of Nucleobindin 2 vs. Ensembl Human
Match: NUCB1 (nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043])

HSP 1 Score: 114.775 bits (286), Expect = 2.035e-28
Identity = 71/189 (37.57%), Postives = 111/189 (58.73%), Query Frame = 1
Query:  472 HLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKS--KRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKD 1032
            HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  +K   ++LEE    ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+
Sbjct:  110 HLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEE---QQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKE 295          
BLAST of Nucleobindin 2 vs. Ensembl Human
Match: NUCB2 (nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044])

HSP 1 Score: 112.079 bits (279), Expect = 1.168e-26
Identity = 106/345 (30.72%), Postives = 173/345 (50.14%), Query Frame = 1
Query:   82 MCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKE-----------------YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            M + T +L +  L   C  ++ E +   ID+   +                  Y EY++ V+  L  DK+ + K+   +    K       LDL S   R+KLDE+K +E+ RL        RML  + KL   +   M       +  HL+     KF   D++ L+     DL   D  R E++++YE  K+   R+E  K  +  ++ +   + ++ +K +  H ++N PGS+DQ KE+W+  D LD + F+ KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M +VD +KD L+TL+E +  T +K+F     W+T
Sbjct:    1 MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRL--------RMLIKA-KLDSLQDIGMDHQALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHE-RREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWET 335          
BLAST of Nucleobindin 2 vs. Ensembl Human
Match: NUCB2 (nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044])

HSP 1 Score: 112.079 bits (279), Expect = 1.448e-26
Identity = 106/345 (30.72%), Postives = 173/345 (50.14%), Query Frame = 1
Query:   82 MCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKE-----------------YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            M + T +L +  L   C  ++ E +   ID+   +                  Y EY++ V+  L  DK+ + K+   +    K       LDL S   R+KLDE+K +E+ RL        RML  + KL   +   M       +  HL+     KF   D++ L+     DL   D  R E++++YE  K+   R+E  K  +  ++ +   + ++ +K +  H ++N PGS+DQ KE+W+  D LD + F+ KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M +VD +KD L+TL+E +  T +K+F     W+T
Sbjct:    1 MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRL--------RMLIKA-KLDSLQDIGMDHQALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHE-RREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWET 335          
BLAST of Nucleobindin 2 vs. Ensembl Celegans
Match: nucb-1 (NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ51])

HSP 1 Score: 105.916 bits (263), Expect = 9.605e-25
Identity = 62/180 (34.44%), Postives = 116/180 (64.44%), Query Frame = 1
Query:  472 HLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELI 1011
            HL   E  KF K+D+ KL+ +   D+ ++D  R++ +++YE +K      +L +   P ++ K   E ++S K +  H+++  PGS+DQ +E+W+  D+L+   ++ KTFF LHDLN DG W+  E+E++ Q ++EK+Y + N   D +E+  E+ +MR+H+M+++D ++D +I++QE +
Sbjct:  153 HLDVQELEKFHKEDLRKLIQKTVADMNVMDEQRKDDFKQYEMKKQAEEDHKLAQMT-PEEREKAKSEHEESLKRHNDHEKLKHPGSKDQLQEVWEESDHLEKDQYDPKTFFALHDLNGDGFWNDFELESLFQLELEKMYNETNPDDDMKERAEEMYRMREHVMKQIDVNQDRMISMQEFL 331          
BLAST of Nucleobindin 2 vs. Ensembl Celegans
Match: nucb-1 (NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ51])

HSP 1 Score: 105.531 bits (262), Expect = 1.454e-24
Identity = 62/180 (34.44%), Postives = 116/180 (64.44%), Query Frame = 1
Query:  472 HLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELI 1011
            HL   E  KF K+D+ KL+ +   D+ ++D  R++ +++YE +K      +L +   P ++ K   E ++S K +  H+++  PGS+DQ +E+W+  D+L+   ++ KTFF LHDLN DG W+  E+E++ Q ++EK+Y + N   D +E+  E+ +MR+H+M+++D ++D +I++QE +
Sbjct:  153 HLDVQELEKFHKEDLRKLIQKTVADMNVMDEQRKDDFKQYEMKKQAEEDHKLAQMT-PEEREKAKSEHEESLKRHNDHEKLKHPGSKDQLQEVWEESDHLEKDQYDPKTFFALHDLNGDGFWNDFELESLFQLELEKMYNETNPDDDMKERAEEMYRMREHVMKQIDVNQDRMISMQEFL 331          
BLAST of Nucleobindin 2 vs. Ensembl Celegans
Match: nucb-1 (NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ51])

HSP 1 Score: 105.531 bits (262), Expect = 1.454e-24
Identity = 62/180 (34.44%), Postives = 116/180 (64.44%), Query Frame = 1
Query:  472 HLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELI 1011
            HL   E  KF K+D+ KL+ +   D+ ++D  R++ +++YE +K      +L +   P ++ K   E ++S K +  H+++  PGS+DQ +E+W+  D+L+   ++ KTFF LHDLN DG W+  E+E++ Q ++EK+Y + N   D +E+  E+ +MR+H+M+++D ++D +I++QE +
Sbjct:  153 HLDVQELEKFHKEDLRKLIQKTVADMNVMDEQRKDDFKQYEMKKQAEEDHKLAQMT-PEEREKAKSEHEESLKRHNDHEKLKHPGSKDQLQEVWEESDHLEKDQYDPKTFFALHDLNGDGFWNDFELESLFQLELEKMYNETNPDDDMKERAEEMYRMREHVMKQIDVNQDRMISMQEFL 331          
BLAST of Nucleobindin 2 vs. Ensembl Fly
Match: NUCB1 (gene:FBgn0052190 transcript:FBtr0075171)

HSP 1 Score: 94.7449 bits (234), Expect = 1.010e-20
Identity = 85/293 (29.01%), Postives = 161/293 (54.95%), Query Frame = 1
Query:  187 EYSEYMRNVMQELLKDKNIQGKI--FNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            EY  Y+R V++ L  D   + K+    +    +      LD  +   R+KLDEIK RE+ RL  L  Q       + +LS N+ D     ++     HL    +  F  +D+ KL+ +   DL   D  R  +++ YE QK++  R+  +K  D   + K   E+K+  + ++ H++++ PG++ Q +++W+  D++D + F+ KTFF++HD++ +G WD  E++A+   +++K+Y+      D  E+  E+ +MR+H  ++ D + D LI++ E +V T +++F+ + EW+T
Sbjct:   50 EYERYLREVVEALEADPEFRKKLDKAPEADIRSGKIAQELDYVNHHVRTKLDEIKRREVERLRELANQ-------AYELS-NDIDRKHLKVSQ----HLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKEYEMQKEFE-REAQKKEMDEESRKKFETELKEKEEKHKDHEKLHHPGNKAQLEDVWEKQDHMDKNDFDPKTFFSIHDVDSNGYWDEAEVKALFVKELDKVYQSDLPEDDMRERAEEMERMREHYFQETDMNHDGLISIDEFMVQTNKEEFQKDPEWET 329          
BLAST of Nucleobindin 2 vs. Ensembl Zebrafish
Match: nucb2b (nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4775])

HSP 1 Score: 127.102 bits (318), Expect = 3.511e-32
Identity = 109/335 (32.54%), Postives = 177/335 (52.84%), Query Frame = 1
Query:   88 YCTFILYF-AVLSTFCTSSSSEQIEKFIDELNQKE-------YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            +C  IL   A L     +    ++    +     E       Y  Y+R V+  L KD + + K+ N +    K       LD  S + R+KLDE+K +E+NRL +L       +K+   L+  E+    D+    ++  HL+      F  +D+++L+    +DL   D  R E+++RYE  K+   R+ L K  +  ++ K  E  ++ +K +  H ++N PGS+DQ KE+W+  D LD + F+ KTFFNLHD N DG +D  E+EA+   ++EKIY+ A    D  E   E ++MR+H+M +VD +KD L++L+E I  T +K+F    EW+T
Sbjct:    6 HCCLILALWACLDALPVAVDKTKVSPPAEAQEPPENADTGLHYDRYLREVIDFLEKDPHFREKLHNTDMEDIKQGKLAKELDFVSHNVRTKLDELKRQEVNRLRTL-------IKAKQDLN-GEKGMTVDHQALLKQFEHLNHMNPHTFEVEDLDRLIKSATNDLENFDKERHEEFKRYEMMKEHERREHL-KTMNEEERKKEEEHYEEMKKKHADHPKLNHPGSQDQLKEVWEEADGLDPNDFDPKTFFNLHDTNGDGYFDEQELEALFTKELEKIYDPAQEEDDMVEMEEERLRMREHVMNEVDTNKDRLVSLEEFITATNKKEFLEPDEWET 331          
BLAST of Nucleobindin 2 vs. Ensembl Zebrafish
Match: nucb2b (nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4775])

HSP 1 Score: 127.102 bits (318), Expect = 3.511e-32
Identity = 109/335 (32.54%), Postives = 177/335 (52.84%), Query Frame = 1
Query:   88 YCTFILYF-AVLSTFCTSSSSEQIEKFIDELNQKE-------YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            +C  IL   A L     +    ++    +     E       Y  Y+R V+  L KD + + K+ N +    K       LD  S + R+KLDE+K +E+NRL +L       +K+   L+  E+    D+    ++  HL+      F  +D+++L+    +DL   D  R E+++RYE  K+   R+ L K  +  ++ K  E  ++ +K +  H ++N PGS+DQ KE+W+  D LD + F+ KTFFNLHD N DG +D  E+EA+   ++EKIY+ A    D  E   E ++MR+H+M +VD +KD L++L+E I  T +K+F    EW+T
Sbjct:    6 HCCLILALWACLDALPVAVDKTKVSPPAEAQEPPENADTGLHYDRYLREVIDFLEKDPHFREKLHNTDMEDIKQGKLAKELDFVSHNVRTKLDELKRQEVNRLRTL-------IKAKQDLN-GEKGMTVDHQALLKQFEHLNHMNPHTFEVEDLDRLIKSATNDLENFDKERHEEFKRYEMMKEHERREHL-KTMNEEERKKEEEHYEEMKKKHADHPKLNHPGSQDQLKEVWEEADGLDPNDFDPKTFFNLHDTNGDGYFDEQELEALFTKELEKIYDPAQEEDDMVEMEEERLRMREHVMNEVDTNKDRLVSLEEFITATNKKEFLEPDEWET 331          
BLAST of Nucleobindin 2 vs. Ensembl Zebrafish
Match: nucb1 (nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-222])

HSP 1 Score: 121.324 bits (303), Expect = 5.919e-30
Identity = 96/293 (32.76%), Postives = 160/293 (54.61%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNS--TSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            Y  Y+R V++ L  D + + K+   N+    N      LDL     R++LDE+K +E++RL        RML  +   S N +    D+ +  ++  HL     + F   D+E L++    DL   D  R E+++RYE  K+   R+E  K  D  ++ K  + + + ++ +R+H ++N PGS DQ +E+W+  D LD   FN KTFF LHD N DG  D+ E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L++L+E +  T +++  +  EW+T
Sbjct:   44 YDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRL--------RMLLKAKLDSTNAQSVQMDHASLLKQFEHLDPHNQNTFEAKDLELLIATATKDLENYDAERHEEFKRYEMLKEHE-RREYLKSLDQEKREKEEKRMDELKEKHRQHPKVNSPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNSDGVLDVQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMQNVDVNHDRLVSLEEFLKSTEKRELNNQKEWET 327          
BLAST of Nucleobindin 2 vs. Ensembl Zebrafish
Match: nucb1 (nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-222])

HSP 1 Score: 121.324 bits (303), Expect = 5.919e-30
Identity = 96/293 (32.76%), Postives = 160/293 (54.61%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNS--TSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            Y  Y+R V++ L  D + + K+   N+    N      LDL     R++LDE+K +E++RL        RML  +   S N +    D+ +  ++  HL     + F   D+E L++    DL   D  R E+++RYE  K+   R+E  K  D  ++ K  + + + ++ +R+H ++N PGS DQ +E+W+  D LD   FN KTFF LHD N DG  D+ E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L++L+E +  T +++  +  EW+T
Sbjct:   44 YDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRL--------RMLLKAKLDSTNAQSVQMDHASLLKQFEHLDPHNQNTFEAKDLELLIATATKDLENYDAERHEEFKRYEMLKEHE-RREYLKSLDQEKREKEEKRMDELKEKHRQHPKVNSPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNSDGVLDVQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMQNVDVNHDRLVSLEEFLKSTEKRELNNQKEWET 327          
BLAST of Nucleobindin 2 vs. Ensembl Zebrafish
Match: nucb2a (nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-14])

HSP 1 Score: 118.627 bits (296), Expect = 7.568e-29
Identity = 98/297 (33.00%), Postives = 167/297 (56.23%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            Y  Y+R V+  L KD++ + K+ N +    K       LD  S   RSKLDE+K +E++RL +L ++ K+ ++    ++        D+    ++  +L+      F  +D+++L+     DL   D  R E++++YE  K+   R+ L+   D   + K  E  ++ +K +  H ++N PGS+DQ KE+W+  D LD   F+ KTFFNLHD N DG +D  E+E++   ++EKIY+  N   D  E   E ++MR+H+M +VD++KD L++L E +V T +K+F     W+T E++
Sbjct:   53 YDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRSKLDELKRQEVSRLRTL-IKAKQDIEGGNDIA-------VDHQALLKQFEYLNHMNPHTFEVEDLDRLIKSATKDLENYDKERHEEFKKYEMMKEHERREHLKTL-DEDGRKKEEEHYEEMKKKHADHPKVNHPGSKDQLKEVWEEADGLDPEDFDPKTFFNLHDTNGDGFFDEQELESLFTKELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDSNKDRLVSLDEFLVATKKKEFLEPDSWETLEQN 340          
BLAST of Nucleobindin 2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 119.013 bits (297), Expect = 5.778e-29
Identity = 84/248 (33.87%), Postives = 138/248 (55.65%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEE--IXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            E+K +E++RL        RML  +   +  E +   D+++  ++  HL       F   D+E L+     DL   D  R E+++RYE  K+   R+ L+   +   + +++EE   ++ +K +++H ++N PGS DQ KE+W+  D LD + FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L+TL E +  T RK+F     W+T +E+
Sbjct:   77 ELKRQEVSRL--------RMLIKAKMDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSLDE---EKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDET 313          
BLAST of Nucleobindin 2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 118.242 bits (295), Expect = 6.245e-29
Identity = 100/299 (33.44%), Postives = 160/299 (53.51%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKI--FNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEE--IXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            Y  Y+R V+  L  D + + K+   N +   +      LD  S   R+KLDE+K +E++RL        RML  +   +  E +   D+++  ++  HL       F   D+E L+     DL   D  R E+++RYE  K+   R   E  K   ++ +++EE   ++ +K +++H ++N PGS DQ KE+W+  D LD + FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L+TL E +  T RK+F     W+T +E+
Sbjct:   44 YDRYLREVIDVLETDGHFREKLQAANADDIKSGKLSKELDFVSHHVRTKLDELKRQEVSRL--------RMLIKAKMDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERR---EYLKSLDEEKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDET 331          
BLAST of Nucleobindin 2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 118.627 bits (296), Expect = 9.418e-29
Identity = 84/248 (33.87%), Postives = 138/248 (55.65%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEE--IXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            E+K +E++RL        RML  +   +  E +   D+++  ++  HL       F   D+E L+     DL   D  R E+++RYE  K+   R+ L+   +   + +++EE   ++ +K +++H ++N PGS DQ KE+W+  D LD + FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L+TL E +  T RK+F     W+T +E+
Sbjct:   95 ELKRQEVSRL--------RMLIKAKMDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSLDE---EKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDET 331          
BLAST of Nucleobindin 2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 118.627 bits (296), Expect = 9.418e-29
Identity = 84/248 (33.87%), Postives = 138/248 (55.65%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEE--IXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            E+K +E++RL        RML  +   +  E +   D+++  ++  HL       F   D+E L+     DL   D  R E+++RYE  K+   R+ L+   +   + +++EE   ++ +K +++H ++N PGS DQ KE+W+  D LD + FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L+TL E +  T RK+F     W+T +E+
Sbjct:   95 ELKRQEVSRL--------RMLIKAKMDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSLDE---EKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDET 331          
BLAST of Nucleobindin 2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 118.627 bits (296), Expect = 9.418e-29
Identity = 84/248 (33.87%), Postives = 138/248 (55.65%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEE--IXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            E+K +E++RL        RML  +   +  E +   D+++  ++  HL       F   D+E L+     DL   D  R E+++RYE  K+   R+ L+   +   + +++EE   ++ +K +++H ++N PGS DQ KE+W+  D LD + FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD + D L+TL E +  T RK+F     W+T +E+
Sbjct:   95 ELKRQEVSRL--------RMLIKAKMDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSLDE---EKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDET 331          
BLAST of Nucleobindin 2 vs. Ensembl Mouse
Match: Nucb1 (nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388])

HSP 1 Score: 127.102 bits (318), Expect = 6.850e-32
Identity = 86/247 (34.82%), Postives = 140/247 (56.68%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSEES 1071
            E+K +E++RL        RML  +   +K E +   D++   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  Q+ +   ++++ ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E WKT E S
Sbjct:  101 ELKRQEVSRL--------RMLLKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWKTVEMS 338          
BLAST of Nucleobindin 2 vs. Ensembl Mouse
Match: Nucb1 (nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388])

HSP 1 Score: 127.102 bits (318), Expect = 7.195e-32
Identity = 86/247 (34.82%), Postives = 140/247 (56.68%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSEES 1071
            E+K +E++RL        RML  +   +K E +   D++   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  Q+ +   ++++ ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E WKT E S
Sbjct:  101 ELKRQEVSRL--------RMLLKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWKTVEMS 338          
BLAST of Nucleobindin 2 vs. Ensembl Mouse
Match: Nucb1 (nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388])

HSP 1 Score: 115.931 bits (289), Expect = 2.884e-29
Identity = 69/177 (38.98%), Postives = 110/177 (62.15%), Query Frame = 1
Query:  544 DLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSEES 1071
            DL   D    E+++RYE  K+   R+ LE   +  Q+ +   ++++ ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E WKT E S
Sbjct:   30 DLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEE-QRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWKTVEMS 205          
BLAST of Nucleobindin 2 vs. Ensembl Mouse
Match: Nucb2 (nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179])

HSP 1 Score: 114.39 bits (285), Expect = 1.265e-27
Identity = 80/241 (33.20%), Postives = 133/241 (55.19%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            E+K +E+ RL        RML  + KL   +   M  +L   +  HL+    + F   D++ L+     DL   D  R E++++YE  K+   R+E  K     ++ +   + ++ ++ +  H ++N PGS+DQ KE+W+  D LD + F+ KTFF LHD+N DG  D  E+EA+   ++EK+Y   N   D  E   E ++MR+H+M ++DN+KD L+TL+E +  T +K+F     W+T
Sbjct:  105 ELKRQEVGRL--------RMLIKA-KLDALQDTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHE-RREYLKTLSEEKRKEEESKFEEMKRKHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTRELEKVYNPQNAEDDMIEMEEERLRMREHVMSEIDNNKDRLVTLEEFLRATEKKEFLEPDSWET 335          
BLAST of Nucleobindin 2 vs. Ensembl Mouse
Match: Nucb2 (nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179])

HSP 1 Score: 114.39 bits (285), Expect = 1.368e-27
Identity = 80/241 (33.20%), Postives = 133/241 (55.19%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            E+K +E+ RL        RML  + KL   +   M  +L   +  HL+    + F   D++ L+     DL   D  R E++++YE  K+   R+E  K     ++ +   + ++ ++ +  H ++N PGS+DQ KE+W+  D LD + F+ KTFF LHD+N DG  D  E+EA+   ++EK+Y   N   D  E   E ++MR+H+M ++DN+KD L+TL+E +  T +K+F     W+T
Sbjct:  105 ELKRQEVGRL--------RMLIKA-KLDALQDTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHE-RREYLKTLSEEKRKEEESKFEEMKRKHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTRELEKVYNPQNAEDDMIEMEEERLRMREHVMSEIDNNKDRLVTLEEFLRATEKKEFLEPDSWET 335          
BLAST of Nucleobindin 2 vs. UniProt/SwissProt
Match: sp|Q63083|NUCB1_RAT (Nucleobindin-1 OS=Rattus norvegicus OX=10116 GN=Nucb1 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.778e-31
Identity = 85/245 (34.69%), Postives = 139/245 (56.73%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSE 1065
            E+K +E++RL        RML  +   +K E +   D++   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  Q+ +   ++++ ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E WKT E
Sbjct:  101 ELKRQEVSRL--------RMLLKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGETAEGWKTVE 336          
BLAST of Nucleobindin 2 vs. UniProt/SwissProt
Match: sp|Q02819|NUCB1_MOUSE (Nucleobindin-1 OS=Mus musculus OX=10090 GN=Nucb1 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 4.791e-31
Identity = 86/247 (34.82%), Postives = 140/247 (56.68%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSEES 1071
            E+K +E++RL        RML  +   +K E +   D++   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  Q+ +   ++++ ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E WKT E S
Sbjct:  101 ELKRQEVSRL--------RMLLKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWKTVEMS 338          
BLAST of Nucleobindin 2 vs. UniProt/SwissProt
Match: sp|Q5R4U1|NUCB1_PONAB (Nucleobindin-1 OS=Pongo abelii OX=9601 GN=NUCB1 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.287e-30
Identity = 87/247 (35.22%), Postives = 138/247 (55.87%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKS--KRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSE 1065
            E+K +E++RL        RML  +   ++ + +   D+L   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  +K   +RLEE    ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL E +  T RK+F    E W+T E
Sbjct:  102 ELKRQEVSRL--------RMLLKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERRLEE---QQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLGEFLASTQRKEFGDTGEGWETVE 337          
BLAST of Nucleobindin 2 vs. UniProt/SwissProt
Match: sp|Q02818|NUCB1_HUMAN (Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4)

HSP 1 Score: 123.25 bits (308), Expect = 1.109e-29
Identity = 86/247 (34.82%), Postives = 139/247 (56.28%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKS--KRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIE-WKTSE 1065
            E+K +E++RL        RML  +   ++ + +   D+L   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  +K   ++LEE    ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E W+T E
Sbjct:  102 ELKRQEVSRL--------RMLLKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEE---QQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVE 337          
BLAST of Nucleobindin 2 vs. UniProt/SwissProt
Match: sp|Q0P569|NUCB1_BOVIN (Nucleobindin-1 OS=Bos taurus OX=9913 GN=NUCB1 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.470e-29
Identity = 84/242 (34.71%), Postives = 135/242 (55.79%), Query Frame = 1
Query:  337 EIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKS--KRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEW 1053
            E+K +E++RL        RML  +   ++ E +   D+L   ++  HL       F   D+E L+     DL   D    E+++RYE  K+   R+ LE   +  +K   ++LEE    ++ +R+H ++N PGS+ Q KE+W+ +D LD + FN KTFF LHD+N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F    E 
Sbjct:   99 ELKRQEVSRL--------RMLLKAKMDAQQEPNIQLDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEE---QQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEDDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEG 329          
BLAST of Nucleobindin 2 vs. TrEMBL
Match: A0A267H5F8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004318g1 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.507e-37
Identity = 117/346 (33.82%), Postives = 189/346 (54.62%), Query Frame = 1
Query:   76 AFMCYCTFILYFA--VLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLT---------SYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKD-WRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDAN-GTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESD 1074
            A + +C     FA  V+     +  +++     D L+   Y+ Y+R V Q L  +K    ++  QN +   D    L+    S R++LDEIK  E++RLN+L+    +ML++    + N   E    +          + ++ HL       F   D+EKL+ Q+  D+  VD  ++EQY++YE  K+  RLRK L K  D   +    +E ++ +K +++H++I+ PGS +Q ++ W   D++D   FN KTFF LHD+N DG+ D+NEIEA+   ++EK Y   N  T +  EK HE+ +MRQ +++KVD +KD +I+  E   +T   DFK + +WKTSEE D
Sbjct:   13 AAILFCCLTGCFAPPVVKKPAPTVVAKKPGPADDLLSHLPYANYVREVSQILESNKEFAKRV--QNLSEAGDLASQLEFVDHSVRTRLDEIKRNEVDRLNALE----KMLEAKKAAAGNPMREAGVPIHPDVFNMDQETIKKAHLDHENPHSFEASDLEKLIHQVVSDMHRVDEAKQEQYKQYEMMKEHLRLRK-LHKINDTKAREAAEKEYQEEKKKHKQHEKIHHPGSSEQLRDAWADEDHMDKDSFNPKTFFLLHDVNGDGHLDVNEIEALFLKELEKAYNRTNDTTVNALEKQHEMERMRQEVLDKVDTNKDMMISWDEFERWTKNPDFKKDDDWKTSEEDD 351          
BLAST of Nucleobindin 2 vs. TrEMBL
Match: B7Q350 (Niemann-Pick type C1 domain-containing protein, putative OS=Ixodes scapularis OX=6945 GN=8035180 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.628e-37
Identity = 95/296 (32.09%), Postives = 167/296 (56.42%), Query Frame = 1
Query:  187 EYSEYMRNVMQELLKDKNIQGKIFNQ--NSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEE 1068
            EY  Y++ V++ L  D     K+ N   +   + D    L+    S R++LDE+K  E++RL   +L +K M +    L   +RD++   L      H+       F  DD++KL+     DL  +D  R+E+++ YE QK+   R +LE   +  +K K  +  ++ ++ ++ H  ++EPGS+ Q +E W+  D+++   F+  TFF +HDLN DG  D +EIEA++ P+++K+Y+  N   DP E+  EI +MR+H++ +V ++KD +I+ +E +  T RKDF+ +  WK  +E
Sbjct: 1211 EYDRYLQEVVRALEDDAEFAAKLRNVSIDDIKSGDVAHQLEFVKHSVRNRLDELKRIEVDRLR--RLTVKAMERKEFGL---DRDQVKMPL------HVDYQNPHSFEIDDLKKLIVTATKDLEKLDEKRKEEFKEYEMQKELEYRHKLENMTEE-EKKKEQQHHEELKRKHKDHPAVHEPGSKPQLEETWEKQDHMNKEDFDPNTFFAMHDLNGDGQLDQDEIEAILTPEVKKVYDPNNEEDDPRERQEEIQRMREHVVHEVSSNKDGMISHEEFMDMTQRKDFERDDGWKGLDE 1494          
BLAST of Nucleobindin 2 vs. TrEMBL
Match: A0A267FYX5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009833g1 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 3.737e-37
Identity = 117/346 (33.82%), Postives = 190/346 (54.91%), Query Frame = 1
Query:   76 AFMCYCTFILYFA--VLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLT---------SYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKD-WRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDAN-GTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESD 1074
            A + +C     FA  V+     +  +++     D L+   Y+ Y+R V Q L  +K    ++  QN +   D    L+    S R++LDEIK +E++RLN+L+    +ML++    + N   E    +          + ++ HL       F   D+EKL+ Q+  D+  VD  ++EQY++YE  K+  RLRK L K  D   +    +E ++ +K +++H++I+ PGS +Q ++ W   D++D   FN KTFF LHD+N DG+ D+NEIEA+   ++EK Y   N  T +  EK HE+ +MRQ +++KVD +KD +I+  E   +T   DFK + +WKTSEE D
Sbjct:   12 AAILFCCLTGCFAPPVVKKPAPTVVAKKPGPADDLLSHLPYANYVREVSQILESNKEFAKRV--QNLSEAGDLASQLEFVDHSVRTRLDEIKRKEVDRLNALE----KMLEAKKAAAGNPMREAEVPIHPDVFNMDQETIKKAHLDHENPHSFESSDLEKLIRQVVSDMHRVDEAKQEQYKQYEMMKEHLRLRK-LHKINDTKAREVAEKEYQEEKKKHKQHEKIHHPGSSEQLRDAWADEDHMDKDSFNPKTFFLLHDVNGDGHLDVNEIEALFLKELEKAYNRTNDTTVNALEKQHEMERMRQEVLDKVDTNKDMMISWDEFERWTKNPDFKKDDDWKTSEEDD 350          
BLAST of Nucleobindin 2 vs. TrEMBL
Match: A0A1I8HPU3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.999e-35
Identity = 113/351 (32.19%), Postives = 186/351 (52.99%), Query Frame = 1
Query:   76 AFMCYCTFILYFAVL-----STFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKI--FNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLT---------SYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKD-WRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDAN-GTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESD 1074
            A + +C     FA       +    +      +  +   +  +Y +Y+  VM  L  DK+ + +   F  ++    D    L+    S R++LDEIK  E++RLN+L+    +ML++    + N   E    +          + ++ HL       F   D+EKL+ Q+  D+  VD  ++EQY++YE  K+  RLRK L K  D   +    +E ++ +K +++H++I+ PGS +Q ++ W   D++D   FN KTFF LHD+N DG+ D+NEIEA+   ++EK Y   N  T +  EK HE+ +MRQ +++KVD +KD +I+  E   +T   DFK + +WKTSEE D
Sbjct:   10 AAILFCCLTGCFAPPVVKKPAPTVVAKKPGPADDLLKAYSPDDYKKYVEEVMAHLHMDKHFKSEWEKFKNSTHKAGDLASQLEFVDHSVRTRLDEIKRNEVDRLNALE----KMLEAKKAAAGNPMREAGVPIHPDVFNMDQETIKKAHLDHENPHSFEASDLEKLIHQVVSDMHRVDEAKQEQYKQYEMMKEHLRLRK-LHKINDTKAREAAEKEYQEEKKKHKQHEKIHHPGSSEQLRDAWADEDHMDKDSFNPKTFFLLHDVNGDGHLDVNEIEALFLKELEKAYNRTNDTTVNALEKQHEMERMRQEVLDKVDTNKDMMISWDEFERWTKNPDFKKDDDWKTSEEDD 355          
BLAST of Nucleobindin 2 vs. TrEMBL
Match: A0A267DJS5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034413g1 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 5.560e-35
Identity = 111/352 (31.53%), Postives = 194/352 (55.11%), Query Frame = 1
Query:   43 LTATQNFFFI*AFMCY-CTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSY-----RRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDAN-GTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESDQ 1077
            +T +   F I AF+   CT   +   +S     + SE++   +  L    Y +Y+  V+  +  DK    ++ + N +   +  + L+ AS S R++LDEIK +E+ RLN L+  L+  L       K  R +    L S      +R HL  +    F   D++KL++Q+  D+  VD  RE +Y+RYE  K+   R  L + KD   +    ++++  R+ +R+H+R+++PGS +Q KE W+  D +D   F+ K FF LHD+N DG+ D+NEIEA+   +++K+Y   N  T D  E+ HE+ +MR+ ++ ++D +KD +++ +E   + + ++   + EWKT+EESD+
Sbjct:    3 MTPSIKLFLISAFLLISCT---HSVPVSKEEKKAESERLPDNV--LPDVSYRQYLSEVISAMESDKEFANRLRSMNDSD--EMANQLEFASHSVRNRLDEIKRQEVERLNELEKALEDKLALKANPGKASRAKFRFGLQSLDEATIKRAHLDHSNPHTFEIADLQKLINQVTQDIDQVDQAREAEYKRYEMGKEHSRRARLRRIKDKKAREAAEQQMRAERERHRRHERVHQPGSREQLKEAWEKGDRMDRDSFDPKAFFMLHDINGDGHMDVNEIEALFWKELDKVYSKENDTTVDRVERQHEMERMRRAVLMRLDKNKDRMVSWEEFNAWISSQEANKDEEWKTAEESDE 347          
BLAST of Nucleobindin 2 vs. Ensembl Cavefish
Match: nucb1 (nucleobindin-2-like [Source:NCBI gene;Acc:103046537])

HSP 1 Score: 115.931 bits (289), Expect = 4.832e-28
Identity = 100/293 (34.13%), Postives = 162/293 (55.29%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNS--TSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            Y  Y+R V++ L  D + + K+   N+    N      LDL     R++LDE+K +E++RL        RML  +   S N +    D+++  ++  HL     + F   D+E L++    DL   D  R E+++RYE  K+   R+E  K  D  ++ +  + I+  R+ +R+H ++N PGS DQ +E+W+  D LD   FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+ VD ++D L++L+E I  T +K+F +  EW+T
Sbjct:   49 YDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRL--------RMLLKAKLDSTNTQSVQMDHVSLLKQFEHLDPHNQNTFEAKDLELLIAAATKDLENYDAERHEEFKRYEMLKEHE-RREYLKSLDQEKREREEKRIEDLREKHRQHPKVNAPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNGDGLLDEQELEALFTKELEKVYDPKNEEDDMMEMEEERLRMREHVMKNVDLNRDRLVSLEEFIKSTEKKEFNNAKEWET 332          
BLAST of Nucleobindin 2 vs. Ensembl Cavefish
Match: nucb1 (nucleobindin-2-like [Source:NCBI gene;Acc:103046537])

HSP 1 Score: 96.6709 bits (239), Expect = 1.413e-21
Identity = 93/281 (33.10%), Postives = 149/281 (53.02%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNS--TSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTA 1023
            Y  Y+R V++ L  D + + K+   N+    N      LDL     R++LDE+K +E++RL        RML  +   S N +    D+++  ++  HL     + F   D+E L++    DL   D  R E+++RYE  K+   R+E  K  D  ++ +  + I+  R+ +R+H ++N PGS DQ +E+W+  D LD   FN KTFF LHD N DG  D  E+EA+   ++EK+Y+  N   D  E   E ++MR+H+M+   +DK  + T  EL  + A
Sbjct:   49 YDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRL--------RMLLKAKLDSTNTQSVQMDHVSLLKQFEHLDPHNQNTFEAKDLELLIAAATKDLENYDAERHEEFKRYEMLKEHE-RREYLKSLDQEKREREEKRIEDLREKHRQHPKVNAPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNGDGLLDEQELEALFTKELEKVYDPKNEEDDMMEMEEERLRMREHVMKNTLDDKQPVYTEAELQRFEA 320          
BLAST of Nucleobindin 2 vs. Ensembl Cavefish
Match: nucb2a (nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-14])

HSP 1 Score: 48.521 bits (114), Expect = 8.976e-6
Identity = 85/348 (24.43%), Postives = 150/348 (43.10%), Query Frame = 1
Query:   97 FILYFAVLSTFCTSSSSEQI----------EKFIDELNQK-----EYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRT--HLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEI-WKSVDNLDISY---FNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            FI    VL++   SS +  I          E+ + E  Q       Y  Y+R V+  L KD++ + K+ N +    K       LD  S   R+KLDE+K +E++RL +L            K    E + MA +  +  +   +L+      F  +D+++L+     DL   D  R E++++YE  K+   R+ L+   +  +K +                       E+ ++E+  K  D+  +++   F +K  + L +L                   EKIY+  N   D  E   E ++MR+H+M +VD +KD L++L E +  T +K+F     W+T E++
Sbjct:    7 FITSCLVLASLLFSSEAVPISVDKTKVKLPEETVQEPPQSVDTGLHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRTKLDELKRQEVSRLRTL---------IKAKQDVEEGNGMAVDHQALLKQFEYLNHMNPHTFEVEDLDRLIKSATSDLENFDKERHEEFKKYEMMKEHERREHLKTLDEEGRKKE-----------------------EEHYEEMKKKHADHPKVNHPVRFILKLIYTLTEL-------------------EKIYDPTNEEDDMVEMEEERLRMREHVMNEVDANKDRLVSLDEFLTATKKKEFLEPDSWETLEQN 303          
BLAST of Nucleobindin 2 vs. Ensembl Sea Lamprey
Match: nucb2b (nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4775])

HSP 1 Score: 65.4698 bits (158), Expect = 2.641e-12
Identity = 61/217 (28.11%), Postives = 99/217 (45.62%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGK--------IFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLH 813
            Y  Y+R V+  L KD + + K        I N   +   DF+     +         E+K +E+ RL        RML  +   +   +D   D+ +  ++  HL       F   D+EKL+     DL   D  R E+++RYE  K+   R+E  K  D  ++ +  +     ++ ++ H ++N PGS+DQ +E+W+  D LD   F  KTFF LH
Sbjct:   60 YDRYLREVIDVLEKDTHFKQKLETADIEDIKNGRLSKELDFVSHHVRSKLD------ELKRQEVARL--------RMLIKAKMDAAQGKDLRMDHQSLLKQFEHLDHNNPHSFEPQDLEKLIKTATKDLENYDAARHEEFKRYEMLKEHE-RREFLKTLDEERRQEEEKRFLDMKQKHKDHPKVNHPGSKDQLQEVWEESDGLDPEQFEPKTFFKLH 261          
BLAST of Nucleobindin 2 vs. Ensembl Nematostella
Match: EDO43098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZI2])

HSP 1 Score: 100.138 bits (248), Expect = 2.736e-23
Identity = 79/299 (26.42%), Postives = 157/299 (52.51%), Query Frame = 1
Query:  187 EYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYR-RTHLHSTEDSK----FTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEE 1068
            EY+ Y+R V++ L KD++   K+ N    S+ D        +        +++S+ ++ L   +++ +RM+          R +M D+L   + R + +   D +    F  DD +KL+ +   ++   D  R E+++++E QK+   + +++   +  +K       +   K + + K+++ PGS+ Q +++W+  D LD   F+ KTFF LHD+N DG  D  E+EA+   ++ K+Y   +   DP+E+  EI +MR+H+M ++D DKD  ++  E +  +  ++F  +  WK+ E+
Sbjct:   43 EYARYLRQVIEILEKDEDYVRKLMN---ASDDDL--RSGRIAEDIDLVKHDVRSK-LDELKRQEVERQRMI----------RRQMNDHLNGIKEREYWNPLFDDENPDFFGADDFKKLLWKHHEEMDKQDRERREEFKKHEMQKEHERKIKMKDMDEKHRKEAEEHFRELQEKHHNQSKQLHHPGSKAQLEQVWEESDGLDAKDFDPKTFFKLHDVNGDGFLDTGELEALFVKEVTKLYNPKDEDYDPKERDEEISRMREHVMNEIDKDKDGFVSQDEFLQSSKGEEFDKDDGWKSVED 325          
BLAST of Nucleobindin 2 vs. Ensembl Medaka
Match: nucb2a (nucleobindin-2 [Source:NCBI gene;Acc:101163155])

HSP 1 Score: 125.176 bits (313), Expect = 3.432e-31
Identity = 100/297 (33.67%), Postives = 167/297 (56.23%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEES 1071
            Y  Y+R V+  L KD++ + K+ N +    K       LD  S   R+KLDE+K +E+NRL +L ++ K+ ++    ++        D+    ++  +L+      F  +D+++L+     DL   D  R E+++RYE  K+   R+ L+   D  ++ K  E  ++ RK +  H ++N PGSE+Q KE+W+  D LD   F+ KTFFNLHD N DG +D  E+EA+   ++EKIY+  N   D  E   E ++MR+H+M +VD +KD L+++ E +V T +K+F     W+T E++
Sbjct:   63 YDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRTKLDELKRQEVNRLRTL-IKAKQDIEGGNDIA-------VDHQALLKQFEYLNHMNPHTFEVEDLDRLIKSATKDLENYDKERHEEFKRYEMMKEHDRREHLKTLNDE-ERKKEEEHYEEMRKKHADHPKVNHPGSENQLKEVWEEADGLDPEDFDPKTFFNLHDTNGDGFFDEQELEALFTKELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVSMDEFLVATKKKEFLEPDSWETLEQN 350          
BLAST of Nucleobindin 2 vs. Ensembl Medaka
Match: nucb1 (nucleobindin-2 [Source:NCBI gene;Acc:101169036])

HSP 1 Score: 119.013 bits (297), Expect = 3.157e-29
Identity = 101/293 (34.47%), Postives = 161/293 (54.95%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNS--TSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRR-THLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            Y  Y+R V++ L  D + + K+   N+    N      LDL     R++LDE+K +E++RL        RML  +   S N +    D+ +  ++  HL     + F   D+E L+S    DL   D  R E+++RYE  K+   R+E  K  D  ++ K  + I++ ++ +R+H ++N PGS DQ +E+W+  D LD   FN KTFF LHD N+DG  D  E+EA+   ++EK+Y   N   D  E   E ++MR+H+M+ VD ++D L+TL+E +  T RK+F +   W+T
Sbjct:   47 YDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRL--------RMLLKAKLDSTNTQSLQMDHASLLKQFEHLDPHNQNTFEAKDLELLISAATKDLENYDAERHEEFKRYEMLKEHE-RREYLKSLDQEKREKEEKRIQELKEKHRQHPKVNAPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNEDGVLDEQELEALFTKELEKVYNPKNEEDDMMEMEEERLRMREHVMKNVDTNRDRLVTLEEFLKSTERKEFNNAKGWET 330          
BLAST of Nucleobindin 2 vs. Ensembl Medaka
Match: NUCB2 (nucleobindin 2 [Source:NCBI gene;Acc:101162363])

HSP 1 Score: 118.242 bits (295), Expect = 3.719e-29
Identity = 97/292 (33.22%), Postives = 156/292 (53.42%), Query Frame = 1
Query:  190 YSEYMRNVMQELLKDKNIQGKIFNQNSTSNKD--FMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKT 1059
            Y  Y+R V++ L KD + + K+ N +    K       L+    + RSKLDE+K  EINRL        RML  + K    E + M       +  HL+      F  DD+++L+     DL   D  R +++++YE  K+   R+ L+   +  +K K  +  ++ +K +  H ++N PGSEDQ KE+W+  D LD   F+ KTFF +HD N DG +D +E+EA+   ++EK+Y   N   D  E   E ++M++H+M +VD +KD L++  E +  T ++DF    EW+T
Sbjct:   52 YDRYLREVIEYLEKDPHFREKLKNADMDDIKQGKLSKELNFVQHNFRSKLDELKREEINRL--------RMLIKA-KHDTEEHNAMDHQTLLKQFEHLNHMNPHTFEVDDLDRLIQSATKDLENFDKERHDEFKKYELLKEHERRERLKGMSEEDRK-KAEQHYEEMKKKHANHPKVNHPGSEDQLKEVWQETDGLDPQDFDPKTFFKMHDSNGDGFFDESELEALFTKELEKVYNPDNEEDDMVEMEEERLRMKEHVMNEVDTNKDRLVSFSEFMAATKKEDFAEKDEWET 333          
BLAST of Nucleobindin 2 vs. Planmine SMEST
Match: SMESG000016720.1 (SMESG000016720.1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 360/363 (99.17%), Postives = 363/363 (100.00%), Query Frame = 1
Query:   82 MCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESDQXXXXXXXXXXXXXXXXXXXQSSVVNVDESLN 1170
            MCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMDALDLASSSSR+KLDEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEW+KDWRLRKELEKFKDPVQKSKRLEEIKKSRKSYRKHKRINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEK+DNDKDDLITLQELIVYTARKDFKSNIEWKTSEESDQSIYSEEEKIKFEKELEEISQSSVVNVDESLN
Sbjct:    1 MCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMDALDLASSSSRNKLDEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWKKDWRLRKELEKFKDPVQKSKRLEEIKKSRKSYRKHKRINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKIDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESDQSIYSEEEKIKFEKELEEISQSSVVNVDESLN 363          
BLAST of Nucleobindin 2 vs. Planmine SMEST
Match: SMESG000017142.1 (SMESG000017142.1)

HSP 1 Score: 298.13 bits (762), Expect = 5.583e-99
Identity = 168/292 (57.53%), Postives = 229/292 (78.42%), Query Frame = 1
Query:  202 MRNVMQELLKDKNIQGKIFNQ-NSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESD 1074
            M++VM EL  D   Q K+ ++  S SN+D++ AL+ ASSS+R+KLDEIK REI RLN  KL+LKR LK +  ++K ERD++  +LT     H+HST++ KFTK+D EKL+SQI+HDLRLVD  RE++YRR+EW+KD  ++K+LE  KDP  KSKRLEE+KK+RK+ R HK +NEPGSE+Q KE+W++ D LD SYFN+KTFFNLHD+NQDG+WDI E+E+++ P++ KIYE  N T DPEEK+HEIMKMR+H MEK+D DKD+++T +E + ++ +K+FK N EWK +EE D
Sbjct:    1 MQSVMTELGTDIEFQNKVLDKKGSMSNEDYVGALNFASSSARNKLDEIKRREIERLNLAKLELKRTLKRNLNINKYERDKLIRSLTVDDNNHIHSTDNEKFTKEDFEKLISQIQHDLRLVDQAREKEYRRHEWKKDLEIKKKLENEKDPDVKSKRLEELKKARKTPRNHKPLNEPGSEEQLKELWRTDDKLDESYFNLKTFFNLHDINQDGHWDIEEVESMLIPEVLKIYEAGNQTGDPEEKYHEIMKMRKHFMEKMDTDKDEIVTYEEYLEFSKKKEFKINKEWKVTEEQD 292          
BLAST of Nucleobindin 2 vs. Planmine SMEST
Match: SMESG000013792.1 (SMESG000013792.1)

HSP 1 Score: 146.747 bits (369), Expect = 4.685e-40
Identity = 111/336 (33.04%), Postives = 188/336 (55.95%), Query Frame = 1
Query:   85 CYCTFILY-FAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXX---XXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSST-KLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESDQ 1077
            CY    L+ F+++S       SE+ E     L + EY  Y++ V+  L  D   + KI  ++  ++ D M  ++     S   R+KLDEIK  E+NRLN ++ +L+++ KSS   LS+ ++D            H++   D KF ++D+ +L+S+       +D   EE+YRRY+ +K+ + +  L K K    + K+      S K ++ H  I+ PG+E+Q KE+W+  D LD + FN  TFF LHD N+DG+ DI EIEA++Q ++ K+YE  N   D  E ++E+++MR+ + ++ D + D +I+  E I +T    FK++ +WK  +E +Q
Sbjct:    5 CYIFISLFVFSIMSAPVIKKPSEEDEIKEGTLPRVEYGNYLKQVIDVLETDPEFKKKI--ESLGNDSDIMSVVNHFDLVSHHVRTKLDEIKRIELNRLNKMEARLEKLQKSSNFSLSRIDKD------------HINIHNDLKFEEEDLRRLISKTVEIANKLDAKAEEEYRRYQMEKEIKRKLRLSKIKSKEMRDKQRLLDAASEKRHKSHPAIHYPGTEEQLKEVWEKEDKLDPNSFNPVTFFRLHDTNEDGHLDIAEIEAIMQIELNKVYEVNNSDDDIVEMYNEMLRMRKEVFKEADTNNDRMISFPEFIRWTKSDKFKTDEDWKIQDELNQ 326          
BLAST of Nucleobindin 2 vs. Planmine SMEST
Match: SMESG000000846.1 (SMESG000000846.1)

HSP 1 Score: 145.591 bits (366), Expect = 3.279e-39
Identity = 113/340 (33.24%), Postives = 190/340 (55.88%), Query Frame = 1
Query:   61 FFFI*AFMCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXX-XXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEESDQ 1077
            F  I   + +  + +Y A +      S    +       N   Y EY+  +++EL  DKN   +I +  + +  + +           RS+LDEIK REI RLN L+ +++R    +        D    ++ S+ + HL       F   D+EKL+ ++  DL  +D  +E+Q++ +E +K+   +K+LE  KDP ++ K  E++K+S   ++ H +++ PGSE+Q KE+W   D+LD   FN K FF+LHD+N DG+ DINEIE+++Q ++ K+YE  N   D +EK+HE+M+MR  +M+ +D +KD+L++  E + Y+   +FK + E KT EE  Q
Sbjct:    2 FSIIKILLLFFIYNIYAAPVRKGEVKSEESNL------FNDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSHEMKKEHLKKKKLETIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQ 335          
BLAST of Nucleobindin 2 vs. Planmine SMEST
Match: SMESG000022270.1 (SMESG000022270.1)

HSP 1 Score: 143.665 bits (361), Expect = 1.049e-38
Identity = 114/337 (33.83%), Postives = 184/337 (54.60%), Query Frame = 1
Query:   79 FMCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLKDKNIQGKIFNQNSTSNKDFMXXXXXXXXXXXXXXXEIKSREINRLNSLKLQLKRMLKSSTKLSKNERDEMA-DNLTSYRRTHLHSTEDSKFTKDDMEKLMSQIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEK-FKDPVQKSKRLEE-----IXXXXXXXXXXXXINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDGNWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDKDDLITLQELIVYTARKDFKSNIEWKTSEE 1068
            F+  C +I +F            E  E+F   LN  +Y+ Y+  VM EL KD+     I    + S+    +AL++ S + R+KLDE+K  EI RLN L+ +      S  K +K    EM    + S   +HL       F+ +D+++L+ +       +D   +E Y+ YE +K+ + R ELE+ + D    +K LE+     +++ +  + KHK INEPGS +Q K +W++ D +    FN KTFF LHD+N DGN D+ E+E ++Q +++K Y+  +   D  E++HE+ +MR+  +E VD DK+ LI+L+E + +T   +   N EWKT EE
Sbjct:    7 FLLVCLYIDFFQCPPVQPAKKLEESDEEFNKLLNSVDYASYLSEVMSELHKDEKFSKTI--NTAKSSDSVSEALNIVSPNIRTKLDELKRLEIIRLNKLEKE-----ASKRKSNKYHPHEMPIPPIKSVDISHLDDINPESFSPEDLKRLIDRTTEIFNQIDKRNDENYKMYEMEKEAKKRAELERTYSD----TKILEDAQNKWLEEQKSKHSKHKMINEPGSIEQLKSVWQNEDQMSEDSFNPKTFFYLHDVNGDGNLDVAELETLMQKELDKAYDPNDNATDVIERYHEMSRMRKKFLEHVDLDKNHLISLEEFMQWTKSGEAVKNNEWKTQEE 332          
The following BLAST results are available for this feature:
BLAST of Nucleobindin 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUCB12.309e-3034.82nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043][more]
NUCB12.309e-3034.82nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043][more]
NUCB12.035e-2837.57nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043][more]
NUCB21.168e-2630.72nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044][more]
NUCB21.448e-2630.72nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044][more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nucb-19.605e-2534.44NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc... [more]
nucb-11.454e-2434.44NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc... [more]
nucb-11.454e-2434.44NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NUCB11.010e-2029.01gene:FBgn0052190 transcript:FBtr0075171[more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nucb2b3.511e-3232.54nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
nucb2b3.511e-3232.54nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
nucb15.919e-3032.76nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-22... [more]
nucb15.919e-3032.76nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-22... [more]
nucb2a7.568e-2933.00nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nucb15.778e-2933.87nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb16.245e-2933.44nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb19.418e-2933.87nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb19.418e-2933.87nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb19.418e-2933.87nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nucb16.850e-3234.82nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388][more]
Nucb17.195e-3234.82nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388][more]
Nucb12.884e-2938.98nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388][more]
Nucb21.265e-2733.20nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179][more]
Nucb21.368e-2733.20nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179][more]
back to top
BLAST of Nucleobindin 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63083|NUCB1_RAT3.778e-3134.69Nucleobindin-1 OS=Rattus norvegicus OX=10116 GN=Nu... [more]
sp|Q02819|NUCB1_MOUSE4.791e-3134.82Nucleobindin-1 OS=Mus musculus OX=10090 GN=Nucb1 P... [more]
sp|Q5R4U1|NUCB1_PONAB6.287e-3035.22Nucleobindin-1 OS=Pongo abelii OX=9601 GN=NUCB1 PE... [more]
sp|Q02818|NUCB1_HUMAN1.109e-2934.82Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE... [more]
sp|Q0P569|NUCB1_BOVIN1.470e-2934.71Nucleobindin-1 OS=Bos taurus OX=9913 GN=NUCB1 PE=1... [more]
back to top
BLAST of Nucleobindin 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H5F81.507e-3733.82Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
B7Q3502.628e-3732.09Niemann-Pick type C1 domain-containing protein, pu... [more]
A0A267FYX53.737e-3733.82Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8HPU31.999e-3532.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DJS55.560e-3531.53Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nucb14.832e-2834.13nucleobindin-2-like [Source:NCBI gene;Acc:10304653... [more]
nucb11.413e-2133.10nucleobindin-2-like [Source:NCBI gene;Acc:10304653... [more]
nucb2a8.976e-624.43nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nucb2b2.641e-1228.11nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleobindin 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430982.736e-2326.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleobindin 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nucb2a3.432e-3133.67nucleobindin-2 [Source:NCBI gene;Acc:101163155][more]
nucb13.157e-2934.47nucleobindin-2 [Source:NCBI gene;Acc:101169036][more]
NUCB23.719e-2933.22nucleobindin 2 [Source:NCBI gene;Acc:101162363][more]
back to top
BLAST of Nucleobindin 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016720.10.000e+099.17SMESG000016720.1[more]
SMESG000017142.15.583e-9957.53SMESG000017142.1[more]
SMESG000013792.14.685e-4033.04SMESG000013792.1[more]
SMESG000000846.13.279e-3933.24SMESG000000846.1[more]
SMESG000022270.11.049e-3833.83SMESG000022270.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002242 ID=SMED30002242|Name=Nucleobindin 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1242bp
ATTTCTTAGTCGAAGATTACGATTTAAATTTAATCCTACACATTAACTGC
AACACAGAATTTTTTTTTTATCTGAGCATTTATGTGTTACTGTACTTTTA
TACTCTACTTTGCGGTGCTCTCTACATTTTGCACTTCATCTTCATCTGAA
CAAATTGAAAAATTTATTGATGAGTTAAACCAAAAAGAGTATTCGGAATA
TATGCGTAATGTTATGCAAGAACTTTTAAAAGACAAAAATATTCAAGGGA
AAATTTTCAACCAAAATTCTACGTCAAACAAAGATTTTATGGATGCTTTG
GATTTGGCTAGCAGTTCTTCTCGAAGTAAACTCGACGAAATCAAAAGTAG
AGAAATAAATAGATTAAATTCCCTTAAATTACAACTAAAAAGAATGCTTA
AATCAAGCACTAAACTTAGTAAAAACGAAAGAGATGAGATGGCTGACAAT
TTGACTTCTTATAGAAGAACCCATCTGCATTCAACTGAGGATTCCAAATT
CACAAAGGACGACATGGAAAAATTAATGTCTCAGATACGGCATGATTTAC
GATTAGTTGACACTGTTAGAGAGGAACAGTATCGTAGATATGAGTGGCAA
AAAGATTGGAGATTGAGGAAGGAGCTAGAAAAATTCAAAGATCCTGTTCA
GAAGAGTAAACGATTAGAAGAAATTAAAAAGTCAAGAAAATCGTATCGAA
AACATAAACGCATAAATGAACCGGGAAGTGAGGATCAATTTAAAGAGATA
TGGAAATCTGTGGACAATCTCGACATCTCTTATTTTAATATCAAAACCTT
CTTCAATTTGCATGATTTAAATCAAGATGGAAATTGGGATATCAATGAAA
TTGAGGCAGTGGTTCAACCAGACATTGAGAAAATATACGAAGATGCTAAT
GGAACCGCCGATCCAGAAGAAAAGTTTCACGAAATAATGAAAATGAGGCA
GCATTTGATGGAAAAAGTTGACAATGATAAAGATGATTTGATAACGCTGC
AAGAACTGATTGTCTATACGGCAAGGAAAGATTTTAAGAGCAACATCGAA
TGGAAAACCAGTGAAGAAAGTGATCAGTCAATTTATTCAGAGGAAGAAAA
GATAAAATTTGAAAAAGAATTAGAGGAAATTTCTCAATCCAGTGTGGTTA
ATGTGGATGAGTCGCTAAATTGAAATGGTGAGTCGCATTCATTTGAGAGG
CGCAGTATTTTATGTATGATACATGTTTTGGTTAACATCTGC
back to top

protein sequence of SMED30002242-orf-1

>SMED30002242-orf-1 ID=SMED30002242-orf-1|Name=SMED30002242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MCYCTFILYFAVLSTFCTSSSSEQIEKFIDELNQKEYSEYMRNVMQELLK
DKNIQGKIFNQNSTSNKDFMDALDLASSSSRSKLDEIKSREINRLNSLKL
QLKRMLKSSTKLSKNERDEMADNLTSYRRTHLHSTEDSKFTKDDMEKLMS
QIRHDLRLVDTVREEQYRRYEWQKDWRLRKELEKFKDPVQKSKRLEEIKK
SRKSYRKHKRINEPGSEDQFKEIWKSVDNLDISYFNIKTFFNLHDLNQDG
NWDINEIEAVVQPDIEKIYEDANGTADPEEKFHEIMKMRQHLMEKVDNDK
DDLITLQELIVYTARKDFKSNIEWKTSEESDQSIYSEEEKIKFEKELEEI
SQSSVVNVDESLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032099negative regulation of appetite
GO:0032094response to food
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR040250Nucleobindin
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 216..318
e-value: 1.4E-22
score: 81.8
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.752
IPR040250NucleobindinPANTHERPTHR19237NUCLEOBINDINcoord: 32..349
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 297..309
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 220..314