Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30002228
Length (bp)1932
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30002228) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30002228) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30002228) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30002228) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002228

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002228SMESG000024613.1 dd_Smed_v4_7050_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002228SMESG000024613.1 dd_Smed_v4_7050_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002228SMESG000024613.1 dd_Smed_v4_7050_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002228SMESG000024613.1 dd_Smed_v4_7050_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: CG1504 (gene:FBgn0031100 transcript:FBtr0335041)

HSP 1 Score: 53.1434 bits (126), Expect = 5.278e-7
Identity = 36/130 (27.69%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  310 RSCPDQCASCLHDDMLCEKVGLLEIP--KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLS 690
            +SCP +C       +LC   GL +IP  +L   ++N+ +    F  P++   +F+  R L  LS+  +N+ RI+Q+A   L  L+ +        ++   AF  L NL  + L +    +++  AF G S
Sbjct:   28 KSCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENLALTKNNF--PIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTS 155          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: CG1504 (gene:FBgn0031100 transcript:FBtr0306678)

HSP 1 Score: 53.1434 bits (126), Expect = 5.278e-7
Identity = 36/130 (27.69%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  310 RSCPDQCASCLHDDMLCEKVGLLEIP--KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLS 690
            +SCP +C       +LC   GL +IP  +L   ++N+ +    F  P++   +F+  R L  LS+  +N+ RI+Q+A   L  L+ +        ++   AF  L NL  + L +    +++  AF G S
Sbjct:   28 KSCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENLALTKNNF--PIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTS 155          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: CG1504 (gene:FBgn0031100 transcript:FBtr0335042)

HSP 1 Score: 53.1434 bits (126), Expect = 5.278e-7
Identity = 36/130 (27.69%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  310 RSCPDQCASCLHDDMLCEKVGLLEIP--KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLS 690
            +SCP +C       +LC   GL +IP  +L   ++N+ +    F  P++   +F+  R L  LS+  +N+ RI+Q+A   L  L+ +        ++   AF  L NL  + L +    +++  AF G S
Sbjct:   28 KSCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENLALTKNNF--PIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTS 155          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: CG1504 (gene:FBgn0031100 transcript:FBtr0335040)

HSP 1 Score: 53.1434 bits (126), Expect = 5.278e-7
Identity = 36/130 (27.69%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  310 RSCPDQCASCLHDDMLCEKVGLLEIP--KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLS 690
            +SCP +C       +LC   GL +IP  +L   ++N+ +    F  P++   +F+  R L  LS+  +N+ RI+Q+A   L  L+ +        ++   AF  L NL  + L +    +++  AF G S
Sbjct:   28 KSCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENLALTKNNF--PIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTS 155          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: slit3 (slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-4])

HSP 1 Score: 58.9214 bits (141), Expect = 2.139e-8
Identity = 62/203 (30.54%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  307 VRSCPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLS-IQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEIL 909
            V  CP  C +C ++ + C + GL EIP  L E I  V I  +Q M   + +G FS Y+KL  + +  + ++ I + A S L  L ++    N    I    F  L  + L L N   I       N L V+T   +QN +LLSL    +Q I+  +                    L  +K+L L  NPF+C+C L WL++ L
Sbjct:  269 VTICPAAC-TCNNNIVDCRRKGLTEIPANLPEGI--VEIRLEQNMIKNIPAGAFSTYKKLKRIDLSKNQISEIAEDAFSGLRSLTSLVLYGNKIAEIPKGLFDGLVSLQLLLLNANKI-------NCLRVNTFKDLQNLNLLSLYDNKLQTISKGLFAP-----------------LRAIKTLHLAQNPFMCDCHLKWLADYL 444          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4cb (leucine rich repeat containing 4C, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-080327-5])

HSP 1 Score: 56.225 bits (134), Expect = 8.797e-8
Identity = 67/294 (22.79%), Postives = 114/294 (38.78%), Query Frame = 1
Query:  448 LTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGL-SVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEVPISTS----------PIKYKCKAQNELGNSEIDLIL 1287
            ++SG F     L  L++ + NL  +    +  L  L  ++ S N   +I+ S+F  L +L  L + +     ++  +F+ L S+  L++ +++L  LP +L  P+ H                         L+ + L  NP+ CNC +LWLS  L   +                +C SPP L+ +Y+  L +    C  P I++  +D+         L C        N +T + W     S +   + K  I V    +             Y C   N LGN+    IL
Sbjct:  189 ISSGAFQGLSNLRYLNLGMCNLKEVPN--IQPLIRLDELEMSGNQLTVIQPSSFKGLVHLQKLWMMHAQVQTIERNSFDDLHSLRELNLAHNNLTFLPHDLYTPLHH-------------------------LQRVHLHHNPWNCNCDILWLSWWLRETVP--------TNTSCCARCNSPPSLKGRYIGELDQSYFQCYAPVIIEPPVDLNLTEGMAAELKC------RTNSVTSVSWLTPNGSIITHGTLKMRINVQNDGTLNFTNVTLQDTGTYTCYVSNMLGNTSASAIL 441          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4cb (leucine rich repeat containing 4C, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-080327-5])

HSP 1 Score: 56.225 bits (134), Expect = 8.797e-8
Identity = 67/294 (22.79%), Postives = 114/294 (38.78%), Query Frame = 1
Query:  448 LTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGL-SVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEVPISTS----------PIKYKCKAQNELGNSEIDLIL 1287
            ++SG F     L  L++ + NL  +    +  L  L  ++ S N   +I+ S+F  L +L  L + +     ++  +F+ L S+  L++ +++L  LP +L  P+ H                         L+ + L  NP+ CNC +LWLS  L   +                +C SPP L+ +Y+  L +    C  P I++  +D+         L C        N +T + W     S +   + K  I V    +             Y C   N LGN+    IL
Sbjct:  189 ISSGAFQGLSNLRYLNLGMCNLKEVPN--IQPLIRLDELEMSGNQLTVIQPSSFKGLVHLQKLWMMHAQVQTIERNSFDDLHSLRELNLAHNNLTFLPHDLYTPLHH-------------------------LQRVHLHHNPWNCNCDILWLSWWLRETVP--------TNTSCCARCNSPPSLKGRYIGELDQSYFQCYAPVIIEPPVDLNLTEGMAAELKC------RTNSVTSVSWLTPNGSIITHGTLKMRINVQNDGTLNFTNVTLQDTGTYTCYVSNMLGNTSASAIL 441          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 53.5286 bits (127), Expect = 6.078e-7
Identity = 76/346 (21.97%), Postives = 125/346 (36.13%), Query Frame = 1
Query:  460 NFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEP-ENVNELTKIGWFPSKNS-----SLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAWNEGE---------KPAIVLENSTFK-FEETFIK------QSFLWEKVFSLFEMICAIFGT 1425
            N +   +L +L +  + L  IR  +   L  LR +    +   +IE +AF              D+K         +++ L++ ++ L SLP +L  P                         L  L+ + L  NP++CNC +LWLS  L   +       +        +C +PP L+ +Y+  L +    C  P IV+   D+         L C       +VN +T  G   +  S     S+L      F  V +  +  +Y C   N  GN+    +L     +            +  E+S  + F ETFI          LW +V        +IF T
Sbjct:  214 NLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAF-------------DDLK---------NLEELNLSHNSLHSLPHDLFTP-------------------------LQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCA--------RCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLRDTG-QYTCMVTNSAGNTTATAVLNVTAADVSVNYTYFTTVTVETEDSALRTFNETFIHIPGPTPSGHLWHEVVPTTASSLSIFAT 503          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 53.5286 bits (127), Expect = 6.078e-7
Identity = 76/346 (21.97%), Postives = 125/346 (36.13%), Query Frame = 1
Query:  460 NFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEP-ENVNELTKIGWFPSKNS-----SLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAWNEGE---------KPAIVLENSTFK-FEETFIK------QSFLWEKVFSLFEMICAIFGT 1425
            N +   +L +L +  + L  IR  +   L  LR +    +   +IE +AF              D+K         +++ L++ ++ L SLP +L  P                         L  L+ + L  NP++CNC +LWLS  L   +       +        +C +PP L+ +Y+  L +    C  P IV+   D+         L C       +VN +T  G   +  S     S+L      F  V +  +  +Y C   N  GN+    +L     +            +  E+S  + F ETFI          LW +V        +IF T
Sbjct:  214 NLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAF-------------DDLK---------NLEELNLSHNSLHSLPHDLFTP-------------------------LQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCA--------RCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLRDTG-QYTCMVTNSAGNTTATAVLNVTAADVSVNYTYFTTVTVETEDSALRTFNETFIHIPGPTPSGHLWHEVVPTTASSLSIFAT 503          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lrrc4b (leucine rich repeat containing 4B [Source:NCBI gene;Acc:100124949])

HSP 1 Score: 58.9214 bits (141), Expect = 2.051e-8
Identity = 69/293 (23.55%), Postives = 109/293 (37.20%), Query Frame = 1
Query:  460 NFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEP-ENVNELTKIGWFPSKNS-----SLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAWNEGEKPA 1314
            N +   +L +L +  + L  IR  +   L+ LR +        IIE +AF              D+K         S++ L++ +++L+SLP +L  P+                           L+ + L  NP+ CNC +LWLS  L   +         N      +C SPP L+ +Y+  L +    C  P IV+   D+         L C       +VN LT  G   +  S     S+L      F  V +  +  +Y C   N  GN+     L  +    PA
Sbjct:  209 NLTALVRLEELELSGNRLEMIRPGSFQGLTSLRKLWLMHAHVTIIERNAF-------------DDLK---------SLEELNLSHNNLMSLPHDLFTPLHR-------------------------LERVHLNHNPWHCNCDVLWLSWWLKETVP--------NNTTCCARCHSPPNLKMRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQDTG-QYTCMVTNSAGNTTATATLNVSAAADPA 445          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 53.1434 bits (126), Expect = 1.565e-6
Identity = 71/249 (28.51%), Postives = 103/249 (41.37%), Query Frame = 1
Query:  301 IAVRSCPDQCASCLHDDMLCEKVGLLEIPK-LNENIKNVTI-LNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTL-SIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNC 1038
            +++ SCP  C +C +  + C   GL  IP  L E +  + + LN     P    G FS Y+KL    I LSN N+I + A  A   LR+++  E    I   SA + L            I L+    N +  DT   +QN  LLSL    IQ +A                       L  +++L L  NPFIC+C L WL++ L      T  I++        +C SP  L  + +  +  K   C
Sbjct:  276 LSIGSCPAMC-TCSNGIVDCRGKGLTAIPANLPETMTEIRLELNGIKSVP---PGAFSPYKKLR--RIDLSN-NQISEIAPDAFQGLRSLNSLEGAAQI---SAMYGL------------ILLNANKINCIRADTFQDLQNLSLLSLYDNKIQSLAKGTFA-----------------ALRAIQTLHLAQNPFICDCNLKWLADFLR-----TNPIETSGA-----RCASPRRLANKRIGQIKSKKFRC 475          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 50.8322 bits (120), Expect = 8.405e-6
Identity = 69/248 (27.82%), Postives = 108/248 (43.55%), Query Frame = 1
Query:  304 AVRSCPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDN-QAFNGLSVDTL-SIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNC 1038
            +V  CP  C +C ++ + C   GL EIP  L E I  + +  +Q    V+  G FS Y+KL    I LSN N+I + A  A   LR+++      L++  +    L   + +   +  + L N    N L VD+   + N +LLSL    +Q IA                       L  +++L L  NPFIC+C L WL++ L+     T  I++        +C SP  L  + +  +  K   C
Sbjct:  278 SVLHCPAAC-TCSNNIVDCRGKGLTEIPTNLPETITEMRL--EQNSIKVIPPGAFSPYKKLR--RIDLSN-NQISEIAADAFQGLRSLN-----SLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHNLNLLSLYDNKLQTIAKGTFAP-----------------LRAIQTLHLAQNPFICDCHLKWLADYLH-----TNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 50.8322 bits (120), Expect = 8.542e-6
Identity = 69/248 (27.82%), Postives = 108/248 (43.55%), Query Frame = 1
Query:  304 AVRSCPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDN-QAFNGLSVDTL-SIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNC 1038
            +V  CP  C +C ++ + C   GL EIP  L E I  + +  +Q    V+  G FS Y+KL    I LSN N+I + A  A   LR+++      L++  +    L   + +   +  + L N    N L VD+   + N +LLSL    +Q IA                       L  +++L L  NPFIC+C L WL++ L+     T  I++        +C SP  L  + +  +  K   C
Sbjct:  278 SVLHCPAAC-TCSNNIVDCRGKGLTEIPTNLPETITEMRL--EQNSIKVIPPGAFSPYKKLR--RIDLSN-NQISEIAADAFQGLRSLN-----SLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHNLNLLSLYDNKLQTIAKGTFAP-----------------LRAIQTLHLAQNPFICDCHLKWLADYLH-----TNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 50.8322 bits (120), Expect = 8.687e-6
Identity = 69/248 (27.82%), Postives = 108/248 (43.55%), Query Frame = 1
Query:  304 AVRSCPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDN-QAFNGLSVDTL-SIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNC 1038
            +V  CP  C +C ++ + C   GL EIP  L E I  + +  +Q    V+  G FS Y+KL    I LSN N+I + A  A   LR+++      L++  +    L   + +   +  + L N    N L VD+   + N +LLSL    +Q IA                       L  +++L L  NPFIC+C L WL++ L+     T  I++        +C SP  L  + +  +  K   C
Sbjct:  278 SVLHCPAAC-TCSNNIVDCRGKGLTEIPTNLPETITEMRL--EQNSIKVIPPGAFSPYKKLR--RIDLSN-NQISEIAADAFQGLRSLN-----SLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHNLNLLSLYDNKLQTIAKGTFAP-----------------LRAIQTLHLAQNPFICDCHLKWLADYLH-----TNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:MGI Symbol;Acc:MGI:2444277])

HSP 1 Score: 60.4622 bits (145), Expect = 5.709e-9
Identity = 74/278 (26.62%), Postives = 116/278 (41.73%), Query Frame = 1
Query:  253 MTLFHFKISVIIPLLIIAVRSCPDQCASCL----HDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLSV----DTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSE-ILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI 1053
            +T+  F    +   L+  VR+CP+ CA C+    H    C    L E+P+ L  N+  +++   +    VL  G F    ++T L +  S +  +   AL+ LS+L+N+D S N   +I +  +  L NL  L+L  M   +L +   + L       +L I N+ L +L                                L  L  L+L  NPF C+C L+WL     + R+S     DS         C SPPEL+   V+ L      C PP++
Sbjct:   43 VTMGPFGALCLAWALLGVVRACPEPCA-CVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKIT--VLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHN---LISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFD-------------------------ALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVS-LPEPDSI-------ACASPPELQGVPVHRL--PALPCAPPSV 279          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:MGI Symbol;Acc:MGI:2444277])

HSP 1 Score: 60.077 bits (144), Expect = 7.204e-9
Identity = 72/264 (27.27%), Postives = 111/264 (42.05%), Query Frame = 1
Query:  295 LIIAVRSCPDQCASCL----HDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLSV----DTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSE-ILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI 1053
            L+  VR+CP+ CA C+    H    C    L E+P+ L  N+  +++   +    VL  G F    ++T L +  S +  +   AL+ LS+L+N+D S N   +I +  +  L NL  L+L  M   +L +   + L       +L I N+ L +L                                L  L  L+L  NPF C+C L+WL     + R+S     DS         C SPPEL+   V+ L      C PP++
Sbjct:   13 LLGVVRACPEPCA-CVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKIT--VLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHN---LISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFD-------------------------ALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVS-LPEPDSI-------ACASPPELQGVPVHRL--PALPCAPPSV 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:MGI Symbol;Acc:MGI:2444277])

HSP 1 Score: 60.077 bits (144), Expect = 7.204e-9
Identity = 72/264 (27.27%), Postives = 111/264 (42.05%), Query Frame = 1
Query:  295 LIIAVRSCPDQCASCL----HDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLSV----DTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSE-ILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI 1053
            L+  VR+CP+ CA C+    H    C    L E+P+ L  N+  +++   +    VL  G F    ++T L +  S +  +   AL+ LS+L+N+D S N   +I +  +  L NL  L+L  M   +L +   + L       +L I N+ L +L                                L  L  L+L  NPF C+C L+WL     + R+S     DS         C SPPEL+   V+ L      C PP++
Sbjct:   13 LLGVVRACPEPCA-CVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKIT--VLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHN---LISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFD-------------------------ALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVS-LPEPDSI-------ACASPPELQGVPVHRL--PALPCAPPSV 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:MGI Symbol;Acc:MGI:2444277])

HSP 1 Score: 60.077 bits (144), Expect = 7.204e-9
Identity = 72/264 (27.27%), Postives = 111/264 (42.05%), Query Frame = 1
Query:  295 LIIAVRSCPDQCASCL----HDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLSV----DTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSE-ILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI 1053
            L+  VR+CP+ CA C+    H    C    L E+P+ L  N+  +++   +    VL  G F    ++T L +  S +  +   AL+ LS+L+N+D S N   +I +  +  L NL  L+L  M   +L +   + L       +L I N+ L +L                                L  L  L+L  NPF C+C L+WL     + R+S     DS         C SPPEL+   V+ L      C PP++
Sbjct:   13 LLGVVRACPEPCA-CVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKIT--VLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHN---LISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFD-------------------------ALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVS-LPEPDSI-------ACASPPELQGVPVHRL--PALPCAPPSV 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:MGI Symbol;Acc:MGI:2444277])

HSP 1 Score: 60.077 bits (144), Expect = 7.204e-9
Identity = 72/264 (27.27%), Postives = 111/264 (42.05%), Query Frame = 1
Query:  295 LIIAVRSCPDQCASCL----HDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLSV----DTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSE-ILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI 1053
            L+  VR+CP+ CA C+    H    C    L E+P+ L  N+  +++   +    VL  G F    ++T L +  S +  +   AL+ LS+L+N+D S N   +I +  +  L NL  L+L  M   +L +   + L       +L I N+ L +L                                L  L  L+L  NPF C+C L+WL     + R+S     DS         C SPPEL+   V+ L      C PP++
Sbjct:   13 LLGVVRACPEPCA-CVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKIT--VLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHN---LISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFD-------------------------ALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVS-LPEPDSI-------ACASPPELQGVPVHRL--PALPCAPPSV 235          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RKR3|ISLR2_MOUSE (Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 5.039e-8
Identity = 72/264 (27.27%), Postives = 111/264 (42.05%), Query Frame = 1
Query:  295 LIIAVRSCPDQCASCL----HDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL-NLVILKLDNMGDIKLDNQAFNGLSV----DTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSE-ILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI 1053
            L+  VR+CP+ CA C+    H    C    L E+P+ L  N+  +++   +    VL  G F    ++T L +  S +  +   AL+ LS+L+N+D S N   +I +  +  L NL  L+L  M   +L +   + L       +L I N+ L +L                                L  L  L+L  NPF C+C L+WL     + R+S     DS         C SPPEL+   V+ L      C PP++
Sbjct:   13 LLGVVRACPEPCA-CVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKIT--VLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHN---LISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFD-------------------------ALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVS-LPEPDSI-------ACASPPELQGVPVHRL--PALPCAPPSV 235          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.490e-27
Identity = 135/477 (28.30%), Postives = 216/477 (45.28%), Query Frame = 1
Query:  271 KISVIIPLLIIAV---------RSCPDQCA--SCLHDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYR----KLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNR-----ISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSW---KRFIEVPISTSPIKYKCKAQNELGNSEIDLILAW-----NEGEK-------------PAIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIY 1575
            KI  ++P+L+  +           CP  C   +C    + C   GLL+IP  L++    + + NQ+F +P LT  NFS Y     K+  ++++   L  I     S L++LR +D S N    I    F  L+L  L+LD+   I+    +F GL+V  LS+ + +L  L  E+   I+  ++KL+L +N L  +D + + +   L  L++ +NPF C C L WL+ +L +R     +S +K I +  Q      C  P  ++ + +  L  K  +C  P +  IDV   S +   L C I EP+  +    + W     ++ +P+     K  + V   +   KYKC  +N      + + + W     N   +             P +   NST      F      +EK F+L EMI  + GT  IT+ILFL   C Y    HL +  K+  K   K Y SYE  + SD++ Y
Sbjct:    2 KIPFLLPMLLFILFLAKTSAHFNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQ------CNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTC-ISEPK-AHSSPDVIWMTEHKNTYVPEIQSIEKASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVF------YEKQFTLLEMIGGVVGTFTITMILFL---CIY---RHLAMTMKRNDK--KKWYLSYETAIGSDSQTY 456          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3SAT8 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1502 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.487e-27
Identity = 130/463 (28.08%), Postives = 214/463 (46.22%), Query Frame = 1
Query:  280 VIIPLLIIAVRSC-PDQ----CASCLHDDMLCEKVGLLEI--PKLNENIKNVTILNQQFMNPVLTSGNFSVYR----KLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPI--AHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNR-----------ISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVG-------LNCMIKEPENVNELTKIGWFPSK--NSSLLPKSWKR-----FIEVPISTSPIK-------------YKCKAQNELGNSEIDLILAW-----NEGEKP---------------AIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLL 1455
            +I+PLL +  R    D+    C  C++  + C++ G L +    L   I+ V I++Q+F +  L+  N S Y     ++ +L+I    L  I     S L+ L  +D S+N+   I+ + F  L L +L+LD+   + LD +AF  L+V +LS+QN  L SL  E+ +P+  + ++  L L SN L +LD++ +P    L  L L  NPF+C+CKL+WLS IL  +           I+  +L+     DD +P C SP  LR + + +L      C PP +  ++V + S  + G          +IK     +   ++ WF      + L+P S  R      +EV +S S +              + C   +  GN+  DL L W     N   KP                  LE    +F+   + + F + K F++ E+I A+ GT   T++LFL+
Sbjct:   14 LILPLLTVRGREVRADEVCQICDGCIYGSISCQEAGRLHMLPNDLPSGIRKVIIVSQRFDSQFLSRPNISSYSLPGSEIQELTIMDCGLRAIESRTFSGLNSLTKLDLSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDARFEPFFRNLSFLSLAKNPFVCDCKLMWLSRILQRKRRADNDDAFPMINDDRLL--IEPDDDHPICESPGRLRGKQIVSLASSDFYCGPPQMRALEVDFTSLRVGGSEAVNTTAGILIKCAAQGSPEMQLTWFRRDRWGAGLIPLSGLRQISPGVVEVSVSRSLLAKNSTSDSEDSGELFTCMGIDTYGNTSADLFLKWPTLPTNSAVKPQSPDKRSSLESSSSDTFYLEGEQQRFQTDRLDE-FFFMKKFTILELIGAVVGTFTATIMLFLM 473          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3TNY6 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9134 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.135e-23
Identity = 126/464 (27.16%), Postives = 207/464 (44.61%), Query Frame = 1
Query:  280 VIIPLLIIAVRSCPDQ-----CASCLHDDMLCEKVGLLEI--PKLNENIKNVTILNQQFMNPVLTSGNFSVYR----KLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPI--AHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSY----------NQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVG-------LNCMIKEPENVNELTKIGWFPSK--NSSLLPKSWKRF-----IEVPISTSPIK-------------YKCKAQNELGNSEIDLILAWNEGEKPAIV----------------------LENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLL 1455
            +++PLL +  R          C  C++  + C++ G L +    L   I+ V I++Q+F +  L+  N S Y      + +L+I    L  I     S L+ L  +D S+N+   I+ + F  L L +L+LD+   + LD +AF  L+V +LS+QN  L SL  E+ +P+  + ++  L L SN L +LD + +P    L  L L  NPF C+CKL+WLS  L  R       D++            DD +P C SP  LR + + TL      C PP +  ++V + S+ + G          +IK     +   ++ WF      + L+P S  +      +EV IS S +              + C   +  GN+  DL L W   +  +IV                      ++  +FK +       F + K F++ E+I A+ GT   T++LFL+
Sbjct:   14 LVLPLLAVRGREIKADEVCQICDGCIYGSISCQEAGRLHMLPNDLPPGIRKVIIVSQRFDSQFLSRQNISSYSLPGTVIQELTIMDCGLRAIESRTFSGLNSLTKLDVSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDIRFEPFFRNLSFLSLAKNPFTCDCKLMWLSRTL-QRKRREDNDDAFPMINDDILLIEPDDDHPICESPSRLRGKQIVTLASTDFYCGPPQMKALEVDFSSFRVGGGETVNTTAGIVIKCAAQGSPEMQLAWFQRDRWGNGLVPLSGSKHVSPGVVEVSISRSLLAKNSTGGSEELGELFTCMGIDTYGNTSADLSLRWPAFQPTSIVPSQPSDKRNSPVPPAGDADYLEVDQKSFKTDRL---DEFFFMKKFTVLELIGAVVGTFTATIMLFLM 473          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.869e-23
Identity = 136/464 (29.31%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  316 CPDQC--ASCLHDDMLCEKVGLLEIPKLN--ENIKNVTILNQQFMNPVLTSGNFSVYRK----LTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLY----PKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGW------------FPSKNSSLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAW-----NEGEKPAIVLENST--FKFEETFIKQS------------FLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKS-YPSYERGVYSDTRIY 1575
            CP+ C   +C    +LCE  GLL+IP +N    I+ V + NQ F+ P LT  N S Y      L  L+I   +L  I   A S L  L+ +D S N  L I  + F  L+L  L LD+  +++L   +F GL V +LS+++ HL  L  E I+ I+  +  L L  N L  L +    +  GL +L L++N F C+C+L WL+  L  R   TK  D+  +  L     P C  P  L+   +  L      C  P + +ID+   S     ++C+  +  N    +++ W            +P +NS +   S    I V   +    Y C   NE GN+ +D+ + W        E P     N+   F       K S            +LW K ++  EM+ AI GT +IT++ F+L    YV      +I  +++  ++K+    YE GVYS+++ Y
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIP-MNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCSCQLKWLALTLQTR---TKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSN----SQVKWRYRYNLSPLFYRYPDQNSGVNQAS----IIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILL---YV------VINYRRKNSRSKNILKGYEVGVYSESQTY 477          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A068YC11 (Variable lymphocyte receptor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000739800 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 4.308e-23
Identity = 116/443 (26.19%), Postives = 187/443 (42.21%), Query Frame = 1
Query:  328 CASCLHDDMLCEKVGLLEI--PKLNENIKNVTILNQQFMNPVLTSGNFSVYR----KLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXX--PVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQ----------DDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYL--------SYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLP-------KSWKRFIEVPISTSPIKYKCKAQNE-------------LGNSEIDLILAW---------------------NEGEKPAIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLL 1455
            C  C +  + C++  LL +    L   I+ V I++Q+F +  L+  N S Y      + +L+I    L  I     S LS L  +D S+N+   I+   F  L L +L+LD+   + LD++AF  L+V +LS+QN  L SL  E+ QP+  S     L+           +  P    L  L L  NPF+C+CKL+WLS  L  R       D++ +          DD +P C SP  LR +++ +L  +   C PP +  ++V +         ++ M G+  +IK     +   ++ WF        P       +     +EV IS S      K++ E              GN+  DL L W                           +  L N    F+   + + F  +K F++ E+I A+ GT   T++LFL+
Sbjct:   35 CEGCTYGSISCQEADLLHMLPNNLPNGIEKVIIVSQRFDSQFLSRQNISSYTLPGVNIHELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLDLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEVFQPLVQSRSLTTLRLTSNSLTTLDARFEPFFRNLSFLSLARNPFVCDCKLVWLSRTL-QRKRRADSDDAFRRLNDDRLLIVPDDDHPVCESPNHLRGKHIVSLSTRDFFCGPPQMRALEVDFSDLRVGQSETFNMTGV-VLIKCAAQGSPEMQLAWFRRDRRGGEPIRLPGLRQVASGVVEVSISHSLFAKNSKSETEDAGQLFTCLGVDTYGNTSADLSLRWPALPLLSPLPSSPTSNNRNPMEPSSGDSKYLNNDKGYFQSDRLDEYFFMKK-FTILELIGAVVGTFTATILLFLM 474          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: islr2 (immunoglobulin superfamily containing leucine rich repeat 2 [Source:NCBI gene;Acc:103022455])

HSP 1 Score: 60.077 bits (144), Expect = 6.092e-9
Identity = 90/381 (23.62%), Postives = 160/381 (41.99%), Query Frame = 1
Query:  295 LIIAVRSCPDQCASC---LHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLN-LVILKLDNMGDIKLDNQAFNGL-SVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKL-IDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTI-------VQIDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFI---EVPISTSPI-----------------------KYKCKAQNELGNSEIDLILAWNEGEKPAI 1317
            +I +V+SCP+QC       H  + C    LL +P  L  N+  +++   +    VL S NF    ++T L +  + +  I +  L+ +S+L+N+D S N  +         L+ L +LK+++   + L   AF  L  + ++ I N+   ++      P                         LI +  L++  NPF C+C+L W+ +     I+G+ L I   +Q+++   C +P +L+   V T + KL +C  PT+       ++   +Y  Y MV LNC  K     N    + W     + LL  +    +   EVPI+ +P                         Y C A N++G ++  + L     +K A+
Sbjct:   15 VIASVQSCPEQCTCSDKNPHHFVDCAYKDLLLVPLGLPSNVTTLSLSANKIQ--VLKSKNFVSVTQVTSLWLSHNEIVTIERNTLAPMSQLKNLDLSHNKIVNFPWEDLANLSTLQLLKMNHNEMVSLPKDAFTNLKELRSVRINNNKFTTIMEGTFNP-------------------------LIAMVHLQIFSNPFSCSCQLEWMRDW----ITGSHLKISIPDQNNIL--CDAPSDLKGIEV-TKIPKL-DCQAPTVTITYQPNIESTEIYEGY-MVILNCESKG----NPQPTVEWEILAGNQLLTFTLPSIVEKSEVPINGAPTNTRFLIFQNGTLIIPRMSKKEDGNYSCSATNDMGKAQSTVKLTMAGTKKHAV 355          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4cb (leucine-rich repeat-containing protein 4C-like [Source:NCBI gene;Acc:103034014])

HSP 1 Score: 58.5362 bits (140), Expect = 1.400e-8
Identity = 92/378 (24.34%), Postives = 140/378 (37.04%), Query Frame = 1
Query:  376 LEIPKLNEN-IKNVTI--------LN--QQFMNPVLT--SGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFR-------LNLVILKLDNMGDI----KLD------NQ-------AFNGL-------------------------SVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEV---------PISTSPIK-YKCKAQNELGNSEIDLIL 1287
            LEI +L++N I+N+ I        LN  + F N + T  +G F    KL +L +R + +  I  YA + L  LR +D  E   L       F        LNL +  L  + +I    +LD      NQ       +F GL                         S+  L++ +++L  +P +L  P+ H                         L+ + L  NP+ CNC +LWLS  L   +                +C SPP L+ +Y+  L +    C  P IV+   D+     T V L C        N LT + W     S L   + K  + V          ++   +  Y CK  N LGN    ++L
Sbjct:  103 LEILQLSKNHIRNIEIGAFNGLTNLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRLPSLRRLDLGELKRLSYVSDGAFEGLGNLRYLNLGMCNLKEVPNIQPLVRLDELEMSGNQLTVIRPGSFKGLVHLHKLWMMHAQVQIIERNSFDDLQSLGELNLAHNNLTFVPHDLFTPLRH-------------------------LQRVHLHHNPWNCNCDILWLSWWLRETVP--------TNTSCCARCYSPPSLKGRYIGELDQSYFQCYAPVIVESPADLNVTEGTAVELKC------RTNSLTSVSWLTPNGSVLTHGASKGRVTVQNDGTLNFTSVTMQDMGTYTCKVSNMLGNVSASVLL 441          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 55.0694 bits (131), Expect = 2.511e-7
Identity = 60/200 (30.00%), Postives = 90/200 (45.00%), Query Frame = 1
Query:  316 CPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLS-IQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEIL 909
            CP  C SC ++ + C + GL EIP  L E I  V I  +Q +   +  G FS Y+KL  + +  ++++ I   A S L  L ++    N    I    F  L  + L L N   I       N L V+T   +Q+ +LLSL    +Q I+  +                    L  +K+L L  NPF+C+C L WL++ L
Sbjct:  280 CPASC-SCTNNIVDCRRKGLTEIPANLPEGI--VEIRLEQNLIKSIPPGAFSPYKKLKRIDLSKNHISDIADDAFSGLRSLTSLVLYGNKIAEIPKGLFDGLVSLQLLLLNANKI-------NCLRVNTFKDLQSLNLLSLYDNKLQTISKGLFTP-----------------LRAIKTLHLAQNPFMCDCHLKWLADYL 452          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4bb (leucine rich repeat containing 4Bb [Source:ZFIN;Acc:ZDB-GENE-091116-44])

HSP 1 Score: 51.6026 bits (122), Expect = 2.125e-6
Identity = 73/326 (22.39%), Postives = 121/326 (37.12%), Query Frame = 1
Query:  442 PVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMG-----DIK-----------------------------LDNQAFNGL-SVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEP-ENVNELTKIGWFPSKNS-----SLLPKSWKRFIEVPI-STSPIKYKCKAQNELGNSEIDLIL 1287
            P++ S  F    KL +L +R + +  +  YA   +  LR +D  E  +L     A F   LV L+  N+G     D+                              ++  AF+ L +++ L++ ++ L SLP +L  P+                           L+ + L  NP++CNC +LWLS  L   +         +      +C +PP  + +Y+  L ++   C  P IV+   D+         L C       +VN LT  G   +  +     S+L      F  V +  T P  Y C   N  GN+    +L
Sbjct:  129 PLVPSQAFEYLSKLRELWLRNNPIETLPAYAFHRVPSLRRLDLGELRKLSFISEAAFE-GLVNLRFLNLGMCGLKDVPNLTPLVRLEELELSGNQLGLVAQSLPLSLIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQQ-------------------------LERVHLNHNPWVCNCDVLWLSWWLKETVP--------DNSTCCARCHAPPGTKGRYIGDLDQRDFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGAYKVRISVLHDGTLNFTNVTMQDTGP--YTCMVTNSAGNTTATAVL 418          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4bb (leucine rich repeat containing 4Bb [Source:ZFIN;Acc:ZDB-GENE-091116-44])

HSP 1 Score: 50.8322 bits (120), Expect = 3.638e-6
Identity = 73/328 (22.26%), Postives = 121/328 (36.89%), Query Frame = 1
Query:  442 PVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMG-----DIK-------------------------------LDNQAFNGL-SVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEP-ENVNELTKIGWFPSKNS-----SLLPKSWKRFIEVPI-STSPIKYKCKAQNELGNSEIDLIL 1287
            P++ S  F    KL +L +R + +  +  YA   +  LR +D  E  +L     A F   LV L+  N+G     D+                                ++  AF+ L +++ L++ ++ L SLP +L  P+                           L+ + L  NP++CNC +LWLS  L   +         +      +C +PP  + +Y+  L ++   C  P IV+   D+         L C       +VN LT  G   +  +     S+L      F  V +  T P  Y C   N  GN+    +L
Sbjct:  129 PLVPSQAFEYLSKLRELWLRNNPIETLPAYAFHRVPSLRRLDLGELRKLSFISEAAFE-GLVNLRFLNLGMCGLKDVPNLTPLVRLEELELSGNQLGVELVAQSLPLSLIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQQ-------------------------LERVHLNHNPWVCNCDVLWLSWWLKETVP--------DNSTCCARCHAPPGTKGRYIGDLDQRDFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGAYKVRISVLHDGTLNFTNVTMQDTGP--YTCMVTNSAGNTTATAVL 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit3 (slit homolog 3 protein [Source:NCBI gene;Acc:101170687])

HSP 1 Score: 56.9954 bits (136), Expect = 6.494e-8
Identity = 61/203 (30.05%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  307 VRSCPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLS-IQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEIL 909
            V  CP  C SC ++ + C + GLLEIP  L E I  V I  +Q +   + +G FS Y+KL  + +  + ++ I   A + L  L ++    N    +    F  L  + L L N   I       N L V+T   +QN  LLSL    +Q I+  +                    L  +K+L L  NPF+C+C L WL++ L
Sbjct:  276 VSVCPPSC-SCNNNIVDCRRKGLLEIPANLPEGI--VEIRLEQNLIKSIPAGAFSPYKKLKRIDLSKNQISDIAADAFNGLRSLTSLVLYGNKITELPKGLFDGLVSLQLLLLNANKI-------NCLRVNTFQDLQNLSLLSLYDNKLQTISKGLFTP-----------------LRSIKTLHLAQNPFMCDCHLKWLADYL 451          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4bb (leucine-rich repeat-containing protein 4B [Source:NCBI gene;Acc:101159140])

HSP 1 Score: 51.6026 bits (122), Expect = 2.413e-6
Identity = 59/289 (20.42%), Postives = 103/289 (35.64%), Query Frame = 1
Query:  460 NFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWK-----------RFIEVPISTSPIKYKCKAQNELGNSEIDLIL 1287
            N +   KL +L +  + L  +R  +   L  LR +    +   +IE +AF  L                       S++ L++ ++ L SLP +L  P+                           L+ + L  NP++CNC +LWLS  L   +       +        +C +PP L+ +Y+  L +    C  P IV+   D+         L C          +T + WF    + +   S++            F  V +  +  +Y C   N  GN+    +L
Sbjct:  206 NLTPLVKLEELELSGNQLGIVRPGSFQGLVSLRKLWLMHSRVSVIERNAFDELK----------------------SLEELNLSHNSLHSLPHDLFTPLHQ-------------------------LERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCA--------RCHAPPGLKGKYIGELDQSHFPCYAPVIVEPPTDLNVTEGMAAELKCRTG-----TSMTSVNWFTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQDTG-QYTCMVTNSAGNTTASAVL 433          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:101172994])

HSP 1 Score: 51.2174 bits (121), Expect = 3.180e-6
Identity = 72/301 (23.92%), Postives = 119/301 (39.53%), Query Frame = 1
Query:  352 MLCEKVGLLEIPKLNENIKNVTI---LNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRL----NLVI------------------------LKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVEL---IQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKS-------LELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQ--IDVVYLSYTMVGLNC-MIKEPE 1122
            +LC K GLL +P    NI   T    L   F+   L   +F+    L  L++  + +++IR Y  + L EL  +    N   +++ S F  L    +L++                        L  +N+ DI  D  A   +SV+TLS+ ++ + S+P  +   +  +A           +         PV   +K        L    NP  CNC+L+WL  +               +DDL   C SP +L  +Y +T+ ++   C PP I +    +  +    V L C  I +PE
Sbjct:   41 VLCAKTGLLFVPP---NIDRQTAELRLMDNFIT-TLRHRDFANMSSLIHLTLSRNTISQIRPYTFADLQELHALHMDANRLTVLDDSHFQGLVNLRHLILANNQLHSISEGAFQDFLETLEDLDLSYNNLVDIPWDTIALL-VSVNTLSLDHNLIESVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWLRRVT-------------REDDLE-TCASPKDLAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCKSIGDPE 322          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit3 (slit homolog 3 protein [Source:NCBI gene;Acc:101170687])

HSP 1 Score: 49.6766 bits (117), Expect = 9.804e-6
Identity = 61/203 (30.05%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  307 VRSCPDQCASCLHDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTL-SIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEIL 909
            V  CP  C SC ++ + C + GLLEIP  L E I  V I  +Q +   + +G FS Y+KL  + +  + ++ I   A + L  L ++    N    +    F  L  + L L N   I       N L V+T   +QN  LLSL    +Q I+  +                    L  +K+L L  NPF+C+C L WL++ L
Sbjct:  274 VSVCPPSC-SCNNNIVDCRRKGLLEIPANLPEGI--VEIRLEQNLIKSIPAGAFSPYKKLKRIDLSKNQISDIAADAFNGLRSLTSLVLYGNKITELPKGLFDGLVSLQLLLLNANKI-------NCLRVNTFQDLQNLSLLSLYDNKLQTISKGLFTP-----------------LRSIKTLHLAQNPFMCDCHLKWLADYL 449          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000024613.1 (SMESG000024613.1)

HSP 1 Score: 877.47 bits (2266), Expect = 0.000e+0
Identity = 471/471 (100.00%), Postives = 471/471 (100.00%), Query Frame = 1
Query:  253 MTLFHFKISVIIPLLIIAVRSCPDQCASCLHDDMLCEKVGLLEIPKLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAWNEGEKPAIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIYCETDMDVCXXXXXXXXXXXXXXDTRLIPKS 1665
            MTLFHFKISVIIPLLIIAVRSCPDQCASCLHDDMLCEKVGLLEIPKLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHSIRKLLLKSNLLRSLDSKLKPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAWNEGEKPAIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIYCETDMDVCPFPPPPPPTPPPVPDTRLIPKS
Sbjct:    1 MTLFHFKISVIIPLLIIAVRSCPDQCASCLHDDMLCEKVGLLEIPKLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHSIRKLLLKSNLLRSLDSKLKPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEVPISTSPIKYKCKAQNELGNSEIDLILAWNEGEKPAIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIYCETDMDVCPFPPPPPPTPPPVPDTRLIPKS 471          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000021154.1 (SMESG000021154.1)

HSP 1 Score: 178.718 bits (452), Expect = 8.389e-49
Identity = 146/465 (31.40%), Postives = 240/465 (51.61%), Query Frame = 1
Query:  253 MTLFHFKISVIIPLLI------IAVRSCPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFSVYRK----LTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGW--FPSKN--SSLLPKSWKRFIEVPISTSPI--KYKCKAQNELGNSEIDLILAW----NEGEKPAIVLEN---STFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIY 1575
            + ++  ++S I+PL +      + ++ CP+ C  CL   + CE  GL  IP +L E    V ++  +F    L+  NFS + K    +  LSIR SN+  IR      +S L  +DFSEN +L IE+ AF  L L  LKLD +G+++    AF GL V +L+I  SHL +LP  LI+P++  +R L L +N L SL SK + +   L  L+L  NPFIC+C +LWL   L  R +  +   +   +  +PKC  P  L  QY+Y + +   NC PP + +I+V + S     L C     E+     KI W    SK    +LLP S     E+ I+      +Y C   +  GN+ + +   W    N  ++P   ++    +   ++  + ++++ + + ++L E++ +I GT +IT+++F+L    Y  ++    I  KK +L+   + +YE G YSD++ Y
Sbjct:    8 LQIYFIRVSFILPLFMYDSLTAVFIKPCPNVCTPCLEHAITCENGGLDGIPTELYEETTRVILVGHKFSQTFLSRQNFSKFTKPKYSIEQLSIRRSNIQIIRSQTFYDVSGLDFLDFSENLKLYIENRAFDNLKLKHLKLDFIGNLEFSEDAFQGLLVASLTIAKSHLQALPYRLIEPLSRELRSLFLSNNKLTSLSSKFESLFRQLTILDLHGNPFICSCNMLWLGVTLKWRQNYYRSNTNSFSEPQFPKCDKPYYLLNQYLYEIPETEFNCRPPKLDRIEVQFKSQQSAVLKCAASL-ESKRAPMKISWLYLSSKEYVPNLLPSSKSNEAEIEITQKHYIDQYFCSVSSAAGNASVKVNFNWPTVTNIRQRPNNSIDEYFVTKPTWKTNYYQENYFFREQYTLLELLGSILGTFIITILIFILIYKFYFFKT----IKMKKEQLKKSGHVTYETGFYSDSQTY 467          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000079433.1 (SMESG000079433.1)

HSP 1 Score: 174.481 bits (441), Expect = 2.912e-47
Identity = 143/447 (31.99%), Postives = 228/447 (51.01%), Query Frame = 1
Query:  316 CPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTS----GNFSVYRKLTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRIS-GTKL-IDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNELTKIGW------FPSKNSSLL--PKSWKRFIEVPI--STSPIKYKCKAQNELGNSEIDLILAWNEGEKPAIVLENSTFKFEETFIKQS-------FLWEKVFSLFEMICAIFGTLVITVILFLL---FCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIY 1575
            CP  C  C +D + C   GLL IP  ++E+   +T++  +F++  L+     G F     +  LSIR SN+  I +     LS L N+D SEN  +II + AF  L L  LKLD +  + L+  AF+GL+V +LS++NS L +L  +L++PI++++R L L +N +  LD K +P++  L  L+L  NPF C CKL+WLS  L  R+  G +L   +  Q   +P C  P  ++ +Y++ + +   +C PP++  ID+ + +  +V L C  K P     + ++ W      F  K+S L   P          I  S+S   Y+C A++  GN+ I + + W         LEN+T      +  QS       F + + F+L EM+ A+ GT  +T+ +FLL   FC     +       KK   L+   Y  YE  +YSD++ Y
Sbjct:   25 CPKVCIICFNDHLSCTTGGLLSIPTNIHESTTKITLIGHEFLSSSLSKSNFSGFFKPKYSIEQLSIRQSNIKVIEKDTFYDLSGLDNLDLSENKAIIIRNKAFNNLKLKHLKLDQIQGLVLERGAFDGLAVTSLSMKNSSLKTLSFDLMRPISNNLRSLFLSNNHISELDQKFEPLITQLSHLDLTGNPFQCTCKLVWLSRALEKRMGLGLELEFSNSGQYVNFPLCAGPAHVKDKYIHNITEAEFSCEPPSLDVIDIQFENLDIVKLKCSAKLPFKAAPI-QVYWQEISDPFSLKDSQLEKNPNDETNLAVTVIRKSSSVNLYQCLAKSSSGNATIRVTINWPPVINRTKPLENNTPNSNNNWFGQSNKQTEKNFFFREQFTLLEMLGAVMGTFTVTLTIFLLLYRFCVKATSKV------KKANSLKKSGYSIYEPAIYSDSQTY 464          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000001555.1 (SMESG000001555.1)

HSP 1 Score: 167.548 bits (423), Expect = 1.844e-44
Identity = 142/454 (31.28%), Postives = 227/454 (50.00%), Query Frame = 1
Query:  316 CPDQCASCLHDDMLCEKVGLLEIP-KLNENIKNVTILNQQFMNPVLTSGNFS--VYRK--LTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEIL---------NNRISGTKLIDSYNQDDLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMIKEPENVNEL-TKIGWFPSKNSSLLPKSWKRFIE----------------VPISTSPIKY-----------KCKAQNELGNSEIDLILAW---------NEGEKPAIVLENS--TFKFE-ETFIKQSFLWEKVFSLFEMICAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRK 1515
            CP  C+ CL   + C    L  IP +L    + +T+  Q   +PVL+S NF+   Y K  +  LSIR  ++  +  +  S L  L+ +D SEN  L I  S+F  L+L +LKLD++G + L   +F+ LS ++LS++ S L SL   + QPI+HS++ L +++N ++ LD   +P+   L+S+ L+DN FIC C LLWLS+ L          NR S  K  DS +  + +PKCV P  LR + + T+ +   NC  P I QI++  LS     ++C IK  E  +++ TK+ W   K      K ++R  E                +   +S IK+            C A+N+ G S + + ++W         ++   P    E    T  ++  T  ++S+ + K ++L EM  AI GT +ITV++FL+F   Y  + +    GK   K
Sbjct:   28 CPMHCSICLPSHISCTTGSLTSIPNQLQPKTETITLSGQLQFHPVLSSANFTDLAYPKYQIHTLSIRSCSIYELSSHTFSQLVMLKILDLSENQRLTIMSSSFSGLHLKVLKLDDIGKLMLSPDSFSDLSTESLSMKASRLQSLNFNIFQPISHSLKHLNIENNQIKILDQSFEPLFYRLESVNLKDNTFICYCDLLWLSKALRSKLSFYKSQNRFSDGK-ADSNSDVNNFPKCVGPTYLRDRQLQTISESEFNCQVPQIAQIEIDLLSVFGGMMSCSIKPEEKGHKIPTKVFW--EKQHPQNGKVFQRVYEKSQNAVDGFSLLENNGIAEFSSKIKFDSDRNKNQENFNCVAENKAGRSLVSVQISWPKFNNSLDSSQPNSPTTESEKKQPTDHYQWNTPNQKSYFFTKQYTLLEMTAAIAGTFMITVVIFLVFYKFYFRKRNGYKSGKPSMK 478          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000018621.1 (SMESG000018621.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.469e-36
Identity = 133/447 (29.75%), Postives = 222/447 (49.66%), Query Frame = 1
Query:  316 CPDQCASCLHDDMLCEKVGLLEIPK-LNENIKNVTILNQQFMNPVLTSGNFSVYRK----LTDLSIRLSNLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDIKLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHXXXXXXXXXXXXXXXXXXXXPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQDDL--YPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCMI-----KEPENVNELTKI------GWFPSKNSSLLPKSWKRFIEVPI-----STSPIKYKCKAQNELGNSEIDLILAWNEGEK---PAIVLENSTFKFEETFIKQSFLWEKVFSLFEMICAIFGTLVITVIL-FLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVYSDTRIY 1575
            C   C +C+ D + C K G  E+P+ +++  K   +++QQF N  L+  N +        L  L+IR SN+  I+    S L+ LR +D + N  L I+  +F  L L +LKLDN  ++K    AF  L+V++L +  S +  LP +L++PI   ++KL + +N L SLD + +     L++L LQ N F C+C + WL+ +   R +  K       D++  +P C  P  +  ++++ +   L NC PP + Q+ + + S T   L+C       + P  VN  T I        F   NS   P +  R + V       + S   ++C A+N  GN+   + ++W   EK   P   +  ST    +   + ++ ++K F+L EM  A+FGT  IT+IL F+++   ++ RS       +K  L    Y +YE  VYSD++ Y
Sbjct:   25 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGLKLKLLKLDNNDNLKFSINAFVDLTVESLHMSQSSIFDLPYDLLKPILPFLKKLFINNNNLISLDPRFQIPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTT-DRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRS-----TDRKAILPPNGYTTYEAAVYSDSQTY 465          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG15045.278e-727.69gene:FBgn0031100 transcript:FBtr0335041[more]
CG15045.278e-727.69gene:FBgn0031100 transcript:FBtr0306678[more]
CG15045.278e-727.69gene:FBgn0031100 transcript:FBtr0335042[more]
CG15045.278e-727.69gene:FBgn0031100 transcript:FBtr0335040[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slit32.139e-830.54slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
lrrc4cb8.797e-822.79leucine rich repeat containing 4C, genome duplicat... [more]
lrrc4cb8.797e-822.79leucine rich repeat containing 4C, genome duplicat... [more]
lrrc4ba6.078e-721.97leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba6.078e-721.97leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4b2.051e-823.55leucine rich repeat containing 4B [Source:NCBI gen... [more]
slit11.565e-628.51slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
atad3a8.405e-627.82ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a8.542e-627.82ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a8.687e-627.82ATPase family, AAA domain containing 3A [Source:Xe... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Islr25.709e-926.62immunoglobulin superfamily containing leucine-rich... [more]
Islr27.204e-927.27immunoglobulin superfamily containing leucine-rich... [more]
Islr27.204e-927.27immunoglobulin superfamily containing leucine-rich... [more]
Islr27.204e-927.27immunoglobulin superfamily containing leucine-rich... [more]
Islr27.204e-927.27immunoglobulin superfamily containing leucine-rich... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5RKR3|ISLR2_MOUSE5.039e-827.27Immunoglobulin superfamily containing leucine-rich... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L04.490e-2728.30PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
A0A0R3SAT85.487e-2728.08Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A0R3TNY61.135e-2327.16Ig-like domain-containing protein OS=Rodentolepis ... [more]
I1ZIL51.869e-2329.31Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A068YC114.308e-2326.19Variable lymphocyte receptor OS=Echinococcus multi... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
islr26.092e-923.62immunoglobulin superfamily containing leucine rich... [more]
lrrc4cb1.400e-824.34leucine-rich repeat-containing protein 4C-like [So... [more]
slit32.511e-730.00slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
lrrc4bb2.125e-622.39leucine rich repeat containing 4Bb [Source:ZFIN;Ac... [more]
lrrc4bb3.638e-622.26leucine rich repeat containing 4Bb [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slit36.494e-830.05slit homolog 3 protein [Source:NCBI gene;Acc:10117... [more]
lrrc4bb2.413e-620.42leucine-rich repeat-containing protein 4B [Source:... [more]
si:cabz01090165.13.180e-623.92leucine-rich repeat and fibronectin type III domai... [more]
slit39.804e-630.05slit homolog 3 protein [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024613.10.000e+0100.00SMESG000024613.1[more]
SMESG000021154.18.389e-4931.40SMESG000021154.1[more]
SMESG000079433.12.912e-4731.99SMESG000079433.1[more]
SMESG000001555.11.844e-4431.28SMESG000001555.1[more]
SMESG000018621.11.469e-3629.75SMESG000018621.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002228 ID=SMED30002228|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1932bp
TAACGGTTACAACCGACCAATTAGATCGATCAGACAGCTGATTGGTCAAT
TGAAAATAAAATAACGATTAAAAGGCGGTGCATATTTATAAGTTATAATA
CAAATTTTCAATTTTATCAATTATCAGATTATTTTTTATTTGTAAACGTA
AATTTATTTTTATTATCCACATTTGCTGTTTTCGTTTTTAAATTCAATGC
GAATTTGATGAAGATTTTATTAACCGATAATCGGATGGATATTTTTTATC
AGATGACATTATTTCATTTCAAAATATCAGTTATTATTCCCCTTCTAATA
ATTGCTGTCCGGTCCTGTCCTGATCAGTGCGCATCTTGTTTGCATGATGA
CATGCTTTGTGAAAAGGTGGGCCTCCTAGAAATTCCAAAGTTGAATGAAA
ATATCAAAAATGTAACAATTCTCAATCAACAGTTTATGAATCCCGTTTTA
ACTAGTGGGAACTTTTCAGTCTACCGAAAACTCACTGATTTGTCAATCAG
ATTGAGCAATTTAAATCGTATTCGCCAGTACGCGTTGTCCGCTCTATCCG
AGTTGAGGAACGTGGATTTCAGTGAAAACACCGAACTGATCATTGAGCAC
AGCGCATTTTTCAGATTGAATCTAGTGATCCTCAAACTGGACAACATGGG
AGACATCAAATTGGACAACCAAGCATTTAATGGCCTTTCTGTAGATACTC
TCAGTATTCAAAATTCTCATTTACTCTCATTGCCCGTAGAGCTAATCCAA
CCAATCGCTCATAGCATTAGAAAGCTTTTACTAAAAAGCAATCTCCTTCG
TAGTTTAGATTCGAAACTCAAACCTGTCTTAATTGGCTTGAAGTCCCTTG
AGCTTCAAGATAACCCATTTATATGTAATTGTAAATTGTTGTGGCTAAGC
GAGATTTTGAATAATAGGATATCTGGTACTAAGCTTATAGATTCCTATAA
TCAAGATGATTTGTATCCTAAATGCGTTTCTCCACCAGAGTTGAGAAAAC
AATACGTATACACTTTGGTGAAGAAACTAAAAAACTGTATTCCACCGACA
ATTGTCCAAATCGACGTTGTTTACCTCTCGTATACAATGGTTGGATTGAA
TTGCATGATCAAAGAACCGGAGAACGTAAATGAGTTGACGAAAATAGGAT
GGTTTCCATCAAAAAATAGCAGCCTATTACCAAAATCCTGGAAAAGATTC
ATCGAAGTTCCAATCAGTACATCACCAATCAAGTATAAATGCAAAGCTCA
AAATGAGTTGGGCAACTCAGAAATTGACCTCATTCTCGCCTGGAATGAAG
GTGAAAAGCCGGCAATTGTTTTGGAAAATAGTACGTTTAAATTCGAAGAA
ACTTTCATTAAACAAAGTTTTCTTTGGGAGAAAGTCTTTTCGTTGTTTGA
AATGATTTGTGCGATTTTTGGAACTTTGGTAATAACGGTGATTTTGTTTC
TTCTATTTTGTTGTTGTTACGTGGAAAGGAGTCATCTGTTATTGATTGGA
AAGAAGAAAAGAAAACTTCAAACCAAGAGCTATCCTTCGTATGAACGAGG
GGTTTATAGTGACACAAGAATATATTGTGAAACGGATATGGACGTGTGTC
CATTTCCACCGCCTCCTCCTCCCACACCACCACCAGTTCCTGACACCAGA
TTGATTCCGAAAAGTTTATTATGAATTTTGTAAATAAAATAAACAGAAAT
TTATCAAAAAGAAAATCTGTAATTTTTTTTTGAATTTTTTTTAAATATCA
AAAATTGATTGTAAAATTTGTTAAGATTATTTTATAAATTTGTTATTATA
ATTTAATTAAAGTTCTTAAGATTTTAAAATGAGAAGTAAATCTTTTTCTA
TTTAATTATCCTCGCATGCCCGATTTTTAAAAGGTTTTAAGGCGCTTGTT
TAGAATTGCCCGCATTTTTTAAATAAATTTTA
back to top

protein sequence of SMED30002228-orf-1

>SMED30002228-orf-1 ID=SMED30002228-orf-1|Name=SMED30002228-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
MKILLTDNRMDIFYQMTLFHFKISVIIPLLIIAVRSCPDQCASCLHDDML
CEKVGLLEIPKLNENIKNVTILNQQFMNPVLTSGNFSVYRKLTDLSIRLS
NLNRIRQYALSALSELRNVDFSENTELIIEHSAFFRLNLVILKLDNMGDI
KLDNQAFNGLSVDTLSIQNSHLLSLPVELIQPIAHSIRKLLLKSNLLRSL
DSKLKPVLIGLKSLELQDNPFICNCKLLWLSEILNNRISGTKLIDSYNQD
DLYPKCVSPPELRKQYVYTLVKKLKNCIPPTIVQIDVVYLSYTMVGLNCM
IKEPENVNELTKIGWFPSKNSSLLPKSWKRFIEVPISTSPIKYKCKAQNE
LGNSEIDLILAWNEGEKPAIVLENSTFKFEETFIKQSFLWEKVFSLFEMI
CAIFGTLVITVILFLLFCCCYVERSHLLLIGKKKRKLQTKSYPSYERGVY
SDTRIYCETDMDVCPFPPPPPPTPPPVPDTRLIPKSLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000483Cys-rich_flank_reg_C
IPR032675LRR_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 219..278
e-value: 3.0E-6
score: 36.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 37..147
e-value: 8.3E-8
score: 33.6
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 148..278
e-value: 5.2E-14
score: 54.0
NoneNo IPR availablePANTHERPTHR45836:SF16LEUCINE-RICH REPEAT AND TRANSMEMBRANE DOMAIN-CONTAINING PROTEIN 2coord: 18..281
NoneNo IPR availablePANTHERPTHR45836FAMILY NOT NAMEDcoord: 18..281
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 52..282
NoneNo IPR availableTMHMMTMhelixcoord: 395..417
NoneNo IPR availableTMHMMTMhelixcoord: 12..34