Receptor protein serine/threonine kinase

Overview
NameReceptor protein serine/threonine kinase
Smed IDSMED30002220
Length (bp)4018
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor protein serine/threonine kinase (SMED30002220) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor protein serine/threonine kinase (SMED30002220) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor protein serine/threonine kinase (SMED30002220) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor protein serine/threonine kinase (SMED30002220) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002220

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30002220 dd_Smed_v4_29570_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: A0A034WSU1 (Uncharacterized protein OS=Bactrocera dorsalis OX=27457 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.565e-42
Identity = 57/116 (49.14%), Postives = 76/116 (65.52%), Query Frame = 3
Query: 2310 LAVAQYVGCQHHVLERILKHVMDETLGGDTRSPDIAYYFVDNIVMEYDSLKTKFVQSPTRLNLPDIT*GDEMLFLLEPGYTFCYILDNGEFQYIKFRELPNLNNSKWNSHGTYAIL 2657
            L+  QY+GCQHHVL+ ILKHVM+E LGG + SP+I+Y     ++M Y++LK  + Q+  +L L  I   D+M FL E G  F Y   N +F YIKFR LP L+N++WNS    AIL
Sbjct:  374 LSPPQYIGCQHHVLDLILKHVMNEVLGGKSTSPNISYDIFTELIMNYENLKQNYKQNEEKLILRSIKWRDDMQFLYELGQYFKYYEVNDKFPYIKFRVLPALSNARWNSRAILAIL 489          

HSP 2 Score: 60.8474 bits (146), Expect = 2.565e-42
Identity = 29/62 (46.77%), Postives = 43/62 (69.35%), Query Frame = 1
Query: 2089 ESILIKNAEKEVRLGVLTLVNSRSPTITVCIKYILDYFELWAAIKMIVTDTTAVNTGRKIEL 2274
            +++++ N  KEVR+  + L N +S +I   I+ +LD F LW +IKMIV+DTT VNTG K E+
Sbjct:  300 QAVVLTNEAKEVRIAAMVLENGKSLSIFEGIRNVLDKFNLWNSIKMIVSDTTNVNTGVKSEV 361          

HSP 3 Score: 49.2914 bits (116), Expect = 2.565e-42
Identity = 25/65 (38.46%), Postives = 40/65 (61.54%), Query Frame = 2
Query: 1874 STTAAVTLVRNVNISTRKVSSSCKQLSTDSICLPTPSHVGILKAMREQAKNMKINMKRT*KEKNW 2068
            ST AAVT+V   ++ST+  +  C +LS + I + TP+  GI KAM + A N++ N K + ++  W
Sbjct:  221 STKAAVTMVTTAHVSTKNAAKICNELSKEGINIATPTQAGIHKAMIKAALNLEKNYKNSLRDDIW 285          

HSP 4 Score: 62.7734 bits (151), Expect = 4.687e-6
Identity = 46/155 (29.68%), Postives = 76/155 (49.03%), Query Frame = 1
Query: 1237 MALKRSNTYINKNSRSWIDNLVRFESHSTTEKHPMYRSIVGELLQNTSEKC-----------YLYLANKRKCRKSRYKVIAEESKSLWIRKLNFPAMKLKSIVRRVENLISEHDIFIKRCGQKHEKVTFADIFDITCTNGERLREENKQLYERQS 1668
            M+ K+S   + KNS+ W +NL+ FE      K    R  +  +    SE C           Y  LA   K +K R ++I+ E  +LW  KLNFP++   +  R++  ++ ++  F+K    ++  + F  + DIT   G  L  E+K+LYE Q+
Sbjct:    1 MSFKKSGAEVLKNSKQWENNLITFE------KSKNKRREINNIENPLSELCKIPKQTVIIGRYNELAKTEKLKKKRCQIISNEMIALW-SKLNFPSITRIAAQRKITKVLKDYSTFLKFPDGRNVTMAFNKLCDITDLKGVWLGTEDKKLYELQT 148          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: T1FCQ4 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20206603 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.104e-39
Identity = 41/115 (35.65%), Postives = 66/115 (57.39%), Query Frame = 3
Query: 2325 YVGCQHHVLERILKHVMDETLGGDTRSPDIAYYFVDNIVMEYDSLKTKFVQSPTRL--NLPDIT*G--DEMLFLLEPGYTFCYILDNGEFQYIKFRELPNLNNSKWNSHGTYAIL 2657
            ++GCQHH+L+R+L+HV D  LG  T SP++ Y FV  I+ +Y+ LK  F     +   NL +   G  D+M FL      F +  +  +   + F+ LP ++N++WNS   +A+L
Sbjct:  265 FIGCQHHILDRVLRHVCDALLGDSTESPNMNYPFVSKILKDYEMLKKDFESKAKKCTPNLKEQEVGWRDDMKFLHHLICVFKHFKNFQKIPKVNFKALPGISNARWNSRAIFALL 379          

HSP 2 Score: 64.3142 bits (155), Expect = 1.104e-39
Identity = 32/57 (56.14%), Postives = 41/57 (71.93%), Query Frame = 1
Query: 2095 ILIKNAEKEVRLGVLTLVNSRSPTITVCIKYILDYFELWAAIKMIVTDTTAVNTGRK 2265
            +L++N  KEVRL VL L + ++ TI   I+  LD + LWAAIKMIV+DTT VNTG K
Sbjct:  188 VLLRNEVKEVRLAVLVLPDGKATTIASAIQKTLDDYNLWAAIKMIVSDTTNVNTGSK 244          

HSP 3 Score: 58.5362 bits (140), Expect = 1.104e-39
Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 2645 LCYPSLPQTRN**QQIYSFISGIWLDFWFSDHHFQENFYAKVGRKCSKLCK**KVF*YTHFSKQPSTIDSQRSNICAERAIHFMKSL 2905
            L +  LP  R   Q++  FI G W D WFSDH+++   Y  +    +   K  + F  TH+S+ PS+I +QRSN+CAER I  ++ +
Sbjct:  379 LTFILLPDERKNLQKLCEFICGQWSDAWFSDHYYRTEQYEFLLYAVNGYPKALRCF-QTHWSQSPSSIHTQRSNVCAERTIKVLQDI 464          

HSP 4 Score: 32.3426 bits (72), Expect = 1.104e-39
Identity = 18/54 (33.33%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1883 AAVTLVRNVNISTRKVSSSCKQLSTDSICLPTPSHVGILKAM-REQAKNMKINM 2041
            +AV+LV++  +S R+ +     L+   + + TPS  G+ +A+ RE +K MK  M
Sbjct:  110 SAVSLVQSGKLSVRRAAIVSTILNKSGVKITTPSQSGVYRAVYREASKVMKTLM 163          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: T1FGE5 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20207894 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.544e-25
Identity = 42/116 (36.21%), Postives = 67/116 (57.76%), Query Frame = 3
Query: 2325 YVGCQHHVLERILKHVMDETLGGDTRSPDIAYYFVDNIVMEYDSLKTKFVQSPTR--LNLPDIT*G--DEMLFLLEPGYTFCYILDNGEFQYIKFRELPNLNNSKWNSHGTYAILP 2660
            ++GCQHH+L+R+L+HV D  LG  T SP++ Y FV  I+ +Y+ LK  F     +  LNL +   G  D+M FL      F +  +  +   + F+ LP ++N++WNS   +A+L 
Sbjct:  383 FIGCQHHILDRVLRHVCDALLGDSTESPNMNYPFVSKILKDYEMLKKDFESKAKKCTLNLKEQEVGWRDDMKFLHHLICVFKHFKNFQQMPKVNFKALPGISNAQWNSRAIFALLA 498          

HSP 2 Score: 63.5438 bits (153), Expect = 3.544e-25
Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 1
Query: 2089 ESILIKNAEKEVRLGVLTLVNSRSPTITVCIKYILDYFELWAAIKMIVTDTTAVNTGRK 2265
            + +L++N  KEVRL VL L + ++ TI   I+  LD + LWAAIKMIV+DTT VNT  K
Sbjct:  304 QVVLLRNEVKEVRLAVLVLPDGKATTIASAIQKTLDDYNLWAAIKMIVSDTTNVNTESK 362          

HSP 3 Score: 64.6994 bits (156), Expect = 1.240e-6
Identity = 50/161 (31.06%), Postives = 77/161 (47.83%), Query Frame = 1
Query: 1237 MALKRSNTYINKNSRSWIDNLVRFE-----------------SHSTTEKHPMYRSIVGELLQNTSEKCYLYLANKRKCRKSRYKVIAEESKSLWIRKLNFPAMKLKSIVRRVENLISEHDIFIKRC-GQKHEKVTFADIFDITCTNGERLREENKQLYERQ 1665
            M+ K+S+  + KN   W  NL +F+                 SHS   K  M   I+G          YL LA+  K R  R   + +E + LW   LNFP + L+S+ R++E L+ ++DI +K+  G   E+  F  +FD+T   G+ L  E+K  Y+ Q
Sbjct:    1 MSYKQSSLSVTKNKDKWSSNLKKFQNTLKRRNKIRIGIKPLYSHSRMPKEWM---IIGS---------YLGLASTEKSRLKRITTLRQEIEQLW-SLLNFPILSLRSVGRKIETLLKKYDIHLKKAVGDMREQ--FDKLFDVTNKTGQWLCAEDKIFYQIQ 146          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: T1EPU1 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20198591 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.376e-25
Identity = 65/225 (28.89%), Postives = 105/225 (46.67%), Query Frame = 3
Query: 2325 YVGCQHHVLERILKHVMDETLGGDTRSPDIAYYFVDNIVMEYDSLKTKFVQSPTRL--NLPDIT*G--DEMLFLLEPGYTFCYILDNGEFQYIKFRELPNLNNSKWNSHGTYAILP--CLKREIDSSRFIHLFLEFGWTFG-FQITIFKKISMLKLAESVQNYANDKKCFDI-----PTLVNNHRQ-LTASAAIFVPSGQYIXXXXXXXXXXXXNVRFIFSNNDL 2960
            ++GCQHH+L+R+L+HV D  LG  T SP++ Y FV  I+ +Y+ LK  F     +   NL +   G  D+M FL      F +  +  +   + F+ LP ++N++WNS   +A+L    L  E  + + +  F+   W+   F    ++      L  +V  Y    +CF       P+ ++  R  + A  AI V                 LN+RFIF+N  L
Sbjct:  310 FIGCQHHILDRVLRHVCDALLGDSTESPNMNYPFVSKILKDYEMLKKDFESKAKKCTPNLKEQEVGWRDDMKFLHHLICVFKHFKNFQQMPKVNFKALPGISNARWNSRAIFALLAFILLPDERKNLQKLCEFICGQWSGAWFSDHYYRTAKYEFLLYAVNEYPKALRCFQTHWSQSPSSIHTQRSNVCAERAIKVLQD----IAPLCHSSEKLNLRFIFANKSL 530          

HSP 2 Score: 63.929 bits (154), Expect = 7.376e-25
Identity = 32/57 (56.14%), Postives = 41/57 (71.93%), Query Frame = 1
Query: 2095 ILIKNAEKEVRLGVLTLVNSRSPTITVCIKYILDYFELWAAIKMIVTDTTAVNTGRK 2265
            +L++N  KEVRL VL L + ++ TI   I+  LD + LWAAIKMIV+DTT VNTG K
Sbjct:  233 VLLRNEVKEVRLAVLVLPDGKATTIASAIQKKLDDYNLWAAIKMIVSDTTNVNTGSK 289          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: T1FR88 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20211335 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.239e-24
Identity = 27/58 (46.55%), Postives = 43/58 (74.14%), Query Frame = 1
Query: 2095 ILIKNAEKEVRLGVLTLVNSRSPTITVCIKYILDYFELWAAIKMIVTDTTAVNTGRKI 2268
            +++KN  +EV+L VL L+N +  TI   IK +LD ++LW AIK+I++DTT+ NTG+ +
Sbjct:  140 VVLKNENREVKLAVLALINGKGETIFKGIKTVLDEYKLWPAIKLIISDTTSANTGKSV 197          

HSP 2 Score: 60.4622 bits (145), Expect = 4.239e-24
Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 3
Query: 2301 LLNLAVAQYVGCQHHVLERILKHVMDETLGGDTRSPDIAYYFVDNIVMEYDSLKTKFVQSPTRL-NLPDIT*GDEMLFL 2534
            +L L    Y+GCQHHVL+ +LKHVM++     T SP++ Y+F+  I  EY  LK  F  S   L    ++   D+M FL
Sbjct:  209 MLGLDKPLYIGCQHHVLDTLLKHVMNDYFEAATTSPNLNYWFISRITEEYQQLKASFDNSGDALKEEEEVVWRDDMAFL 287          

HSP 3 Score: 38.1206 bits (87), Expect = 4.239e-24
Identity = 26/78 (33.33%), Postives = 37/78 (47.44%), Query Frame = 2
Query: 2630 EFTWNLCYPSLPQTRN**QQIYSFISGIWLDFWFSDHHFQENFYAKVGRKCSKLCK**KVF*YTHFSKQPSTIDSQRS 2863
            +F    C+P   +     Q    FISG W D WFS   + E+  A V +  SK  K  + F    +S +P+ I +QRS
Sbjct:  296 QFKKTGCFPKSAED----QSSCDFISGTWSDIWFSGQVYNEDNLAAVCKNHSKAIKTLRTF----WSVEPTPIPTQRS 365          

HSP 4 Score: 21.557 bits (44), Expect = 4.239e-24
Identity = 10/36 (27.78%), Postives = 18/36 (50.00%), Query Frame = 2
Query: 1961 SICLPTPSHVGILKAMREQAKNMKINMKRT*KEKNW 2068
             I +PT S  G+ KA  +  + +K +   T + + W
Sbjct:   88 GISIPTLSQSGVYKATMKAGEKLKEHFIETLRNEKW 123          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000067084.1 (SMESG000067084.1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.251e-10
Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 3
Query: 2262 EN*VVIIL*RQQKLLNLAVAQYVGCQHHVLERILKHVMDETLGGDTRSPDIAYYFVDNIVMEYDSLKTKF 2471
            +N +V  L + +K  ++   QY+ CQH+VL+R+L+H M+  + G T +P+I+Y FV      Y+SL  KF
Sbjct:   36 KNGIVTQLQKYRKQAHVYSPQYISCQHYVLDRVLRHAMEFDISGKTFNPNISYPFVSKTNANYESLNRKF 105          

HSP 2 Score: 29.6462 bits (65), Expect = 1.251e-10
Identity = 11/21 (52.38%), Postives = 14/21 (66.67%), Query Frame = 1
Query: 2203 ELWAAIKMIVTDTTAVNTGRK 2265
            ELW  +KMI+ DTT  N+  K
Sbjct:   16 ELWPQVKMIICDTTNTNSASK 36          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000042352.1 (SMESG000042352.1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.970e-10
Identity = 34/74 (45.95%), Postives = 44/74 (59.46%), Query Frame = 3
Query:   30 SIMIIFG-TPYLPNLGVVINKQFKDHLKNEKNFYIDHELLRNANGNEMKPKLAPALNWIKKSWKLITAEIVGKS 248
             IMI  G + YL  L + INK FKDHL+ E N Y ++ ++RN  GN +KP L   +NWIK SW  IT   V  +
Sbjct:  210 QIMIPAGISGYLQTLDIAINKPFKDHLRMEINDYFENRMVRNHRGNFVKPGLQEVVNWIKNSWDKITDSCVSNA 283          
The following BLAST results are available for this feature:
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A034WSU12.565e-4249.14Uncharacterized protein OS=Bactrocera dorsalis OX=... [more]
T1FCQ41.104e-3935.65Uncharacterized protein OS=Helobdella robusta OX=6... [more]
T1FGE53.544e-2536.21Uncharacterized protein OS=Helobdella robusta OX=6... [more]
T1EPU17.376e-2528.89Uncharacterized protein OS=Helobdella robusta OX=6... [more]
T1FR884.239e-2446.55Uncharacterized protein OS=Helobdella robusta OX=6... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000067084.11.251e-1038.57SMESG000067084.1[more]
SMESG000042352.13.970e-1045.95SMESG000042352.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002220 ID=SMED30002220|Name=Receptor protein serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4018bp
ACTCATTTGACAAATTACACTCAGCCTTTTCAATAATGATTATCTTTGGA
ACTCCATATCTTCCAAATCTCGGTGTCGTTATCAACAAACAGTTTAAAGA
TCATCTTAAAAACGAAAAGAACTTTTATATTGATCATGAACTTCTAAGAA
ATGCAAATGGTAATGAGATGAAGCCAAAATTAGCACCGGCTTTAAATTGG
ATTAAAAAATCGTGGAAACTAATCACAGCTGAAATTGTGGGAAAATCTTG
GATCAGGTAAAAAATGCCAGCCAGTTATTTTTTACCTGACACATAATTAA
TATTAAAATTTTAAAATATTAAAATTACTATTTGTAAGGTCGAATGCTCA
CCTTCGATATAAATGGTATGGTCAGAATTTATACTGGACAAAAAAAGCGA
CAACAATTTTGCCAATTATAAAATCACATGTTGTTGATAAGACCATTATT
CATACAGGTGAGCATCGAAGTTATCTGGGTCTTACAAACGAAGGTTTCGA
ACATGGAGCTGTTTAGAGGAACACTGGTGTTAAAATACAGCATGTAGAGT
GGTCACTTTTTTTAAATTTTTAAGCTCATGGTACTACAATATGAGGAATA
GTCTAAAAACATTATTTATATTGGTTTTATTTATTTTTTGATCAAAACCT
CACACACCAAATATAACTTACTTTTAATATTTTACCAATTATTCGCCATA
TAAAGAACGTGTTTATTTAATATGTATTTATAATTTATATATGCAAAGAA
TGATTTCAAATTTCATACAAATTGAATAACATTTAAGGGGTTGCACAGTT
TTGTTACTTTTGTACATAGAAACCAACATCATATTTTTAATAAGCATAGT
CAATAACCTTTTGGGACTGAGCCCTTAACCTCCCTTTATTAAAATTCCTT
AGGGTATATTTTAGAAGATTCTCGTAATGTGGCTGGATGATGGCGAAACA
GTAATATTCTAGAACGTCTTGTTGGACATTTCATATTTAGATGCAGCAAC
AATAGCGTTTGTGACTATATTTAGAATATTTATGAATATTTATTCATTCA
TTAGCTGGTTTCCCTTCTAGAAAAATCTTCAACTCCATATAAAAGCCAAT
TGTTGAAAAATTGGTTCCGTTTGATTGTGACCACTAGAGTATTTTCTAAA
GTGGTAAGTCATTGCTTAGTGAAACTAAAATATGATTGCATGTTCAGTCG
AGCTAATAAGCATATTTTTGTAATTACAGAATTTCAATGGCTCTCAAGAG
ATCAAATACCTATATTAATAAAAATTCTCGTTCGTGGATTGATAATCTGG
TAAGATTTGAAAGTCATTCAACTACGGAAAAACATCCCATGTATAGAAGC
ATCGTTGGTGAATTACTGCAAAATACCTCTGAAAAGTGCTACCTTTATCT
TGCAAACAAACGCAAGTGTCGCAAAAGCAGATATAAAGTGATTGCGGAAG
AATCAAAGTCTTTGTGGATCAGAAAATTAAATTTCCCTGCCATGAAACTG
AAGTCTATAGTGAGAAGAGTGGAAAATTTAATATCTGAACACGACATCTT
TATAAAGCGTTGTGGTCAGAAACATGAAAAAGTAACTTTTGCTGATATAT
TTGACATCACCTGTACAAATGGAGAGCGGCTCAGAGAGGAAAATAAGCAG
CTATATGAAAGGCAAAGTCTTAAGTGGCAGAAAGATGAGGTACACCACGA
CGAAATGCGTACTGGTGCATCCCTGTAAAACAATGAAGAAGTCCAGTCAG
TCCACTATGTCATTCCCTGATTCCTCGGTAAAACCTCTCAACTCTAGCGA
CTCAGAAAACAACCGAAAGACTAATGAATCCTACGAACTTCCTGAAAAAA
ATAATATAGTCTTGCCATACCATTCAACAACTGCAGCAGTTACCTTAGTC
AGGAATGTTAACATTAGCACCAGGAAGGTGTCTTCATCATGCAAGCAGTT
ATCTACTGACAGTATCTGCTTGCCTACGCCCTCCCATGTGGGAATTCTGA
AAGCAATGAGGGAACAGGCTAAAAATATGAAAATAAATATGAAGAGAACT
TAGAAGGAAAAGAATTGGGAAAGAAGATTAATGGCAAGGAATCAATATTA
ATCAAAAACGCTGAAAAAGAAGTCAGATTGGGGGTACTAACCCTGGTAAA
TTCTAGATCGCCAACAATTACAGTGTGTATAAAATATATTCTGGATTATT
TTGAATTGTGGGCAGCAATAAAAATGATTGTCACGGATACAACGGCTGTG
AATACTGGAAGGAAAATTGAGTTGTGATCATTTTATAGCGTCAGCAGAAA
TTACTGAATTTAGCTGTGGCACAATATGTTGGTTGCCAACATCATGTTTT
GGAACGCATTTTAAAACATGTGATGGATGAAACCTTAGGAGGTGATACTC
GTTCTCCAGACATTGCGTACTATTTTGTCGATAATATTGTGATGGAATAT
GATTCTCTAAAGACAAAATTTGTGCAGAGCCCAACAAGATTGAATCTCCC
TGATATTACATGAGGAGATGAAATGTTGTTTCTTTTGGAACCGGGATATA
CCTTTTGCTATATCCTCGACAATGGAGAATTCCAGTACATTAAATTTCGT
GAACTGCCAAATTTGAACAATTCAAAGTGGAATTCACATGGAACCTATGC
TATCCTTCCTTGCCTCAAACGAGAAATTGATAGCAGCAGATTTATTCATT
TATTTCTGGAATTTGGCTGGACTTTTGGTTTTCAGATCACCATTTTCAAG
AAAATTTCTATGCTAAAGTTGGCAGAAAGTGTTCAAAATTATGCAAATGA
TAAAAAGTGTTTTGATATACCCACTTTAGTAAACAACCATCGACAATTGA
CAGCCAGCGCAGCAATATTTGTGCCGAGCGGGCAATACATTTTATGAAAT
CTTTGAATAGCAAAACTCCTGAGTCTCAATGTACGCTTTATATTCAGTAA
CAATGATTTATGACAAAACATACTGCTTCACTTTCAACAACATTATTACA
CAAAGAACAAATCTTATATTTTTTGGTGGGTGATGTTTTTGAAATGAAAA
CCAAAATTAAATATATATTTCCTCATTTCAACTTTCTTCTCATAGTTTAG
GACTTTAGCCATCACATTTTCTGAAAAAAAGTCAAAAAGCTACCACTCTA
ATGTTGAGTCCTTTAATAATGCATTAAAATTTGAAATAAAGACAAAAAAG
GGTGTTTAGTTGTCTTTTTTTGTTATTTTTTTATGAATTACAATGATAAA
TTAATTATATTTTACATTCTGATTTCGTTTTATTATTTTATTTTATTTAT
TTATTTTATTTTATTTAAATTATTTTTAATTTAATCCTAGCATTTTTTTA
CCTGGTCCGAAATCTTTAACATAAATGCTTGACGGTCATTCAATGGTACT
TATAGTGTAAAACATGACAGACTTTGAAAAATAGTGTTGAACATTCCAAC
TGTAACCAATCTTTCATTTAAACTGCAATAAAATATATTCTCGAAATTTT
ATTTAATTTTTTTTTAAATAATATCAATATGTTTGTTTAATTGACTTTTT
TTAATTTGCATCATTTCTATGAATTGTCTTTGAATTGGCAACGTGCTAAA
TCTGATGCCCAACCTGACTCACAATTTTTATGTATTAAATATATGGACAG
TCAGTAACACATGATACTGAATTTTATTTCTCTTTAATTCAAAGGTTGGC
AGAATATTACTACTTTCTGTGGTTAGAATTTCTACATCTCCTTTTCCAAT
TCTCCTTCACTCAATGTAACATTGACAGGAATTTACCAAGATTTGTAGAT
TTTCTCCAGCCTTCAACACGTGAAAATACAAAAATATGAAATTGTACACA
TAAAGTAGTCAAATTCAGAATGTGTAAGTTAATTAATAATTTCACCGTTG
TCTTTGATTGATAAGGAAACAGTAAAACTAAATGACCAATTATTCAACAT
ATGTGAATAAATGAATCATTTCACCCAAAAGATGTTTTTAAATATTTTGT
TGAAAATTTTATTTAAAT
back to top

protein sequence of SMED30002220-orf-1

>SMED30002220-orf-1 ID=SMED30002220-orf-1|Name=SMED30002220-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MALKRSNTYINKNSRSWIDNLVRFESHSTTEKHPMYRSIVGELLQNTSEK
CYLYLANKRKCRKSRYKVIAEESKSLWIRKLNFPAMKLKSIVRRVENLIS
EHDIFIKRCGQKHEKVTFADIFDITCTNGERLREENKQLYERQSLKWQKD
EVHHDEMRTGASL*
back to top

protein sequence of SMED30002220-orf-2

>SMED30002220-orf-2 ID=SMED30002220-orf-2|Name=SMED30002220-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MESGSERKISSYMKGKVLSGRKMRYTTTKCVLVHPCKTMKKSSQSTMSFP
DSSVKPLNSSDSENNRKTNESYELPEKNNIVLPYHSTTAAVTLVRNVNIS
TRKVSSSCKQLSTDSICLPTPSHVGILKAMREQAKNMKINMKRT*
back to top

protein sequence of SMED30002220-orf-3

>SMED30002220-orf-3 ID=SMED30002220-orf-3|Name=SMED30002220-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MLFLLEPGYTFCYILDNGEFQYIKFRELPNLNNSKWNSHGTYAILPCLKR
EIDSSRFIHLFLEFGWTFGFQITIFKKISMLKLAESVQNYANDKKCFDIP
TLVNNHRQLTASAAIFVPSGQYIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0004675transmembrane receptor protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007178transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast