Zinc finger, C2H2 type

Overview
NameZinc finger, C2H2 type
Smed IDSMED30002213
Length (bp)1550
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger, C2H2 type (SMED30002213) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger, C2H2 type (SMED30002213) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger, C2H2 type (SMED30002213) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger, C2H2 type (SMED30002213) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002213

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30002213h1SMcG0001887 Contig1854GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30002213h1SMcG0001887 Contig1854GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30002213h1SMcG0001887 dd_Smed_v4_3443_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30002213h1SMcG0001887 dd_Smed_v4_3443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002213h1SMcG0001887 dd_Smed_v4_3443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002213h1SMcG0001887 dd_Smed_v4_3443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002213h1SMcG0001887 dd_Smed_v4_3443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF878 (zinc finger protein 878 [Source:HGNC Symbol;Acc:HGNC:37246])

HSP 1 Score: 84.3445 bits (207), Expect = 1.145e-16
Identity = 52/154 (33.77%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  749 DSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRR-------KEVWKKGDVPKELVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
             S    +G    G K   C+ECGK +R   S+R H  +         K+  K    P  +   + I      Y C  C K   ++ +   H  +HTG+R  KC+IC K FFS   ++RH  SHTG  RYKC+ CDK F C  +  +H R H+ +
Sbjct:  127 SSSLAIHGRTHTGEKPYECKECGKAFRFPSSVRRHERIHSAKKPYECKQCGKAFSFPSSVRRHERIHSAKKPYECKQCGKALSYLVSFQTHMRMHTGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGE 280          

HSP 2 Score: 68.1662 bits (165), Expect = 1.641e-11
Identity = 42/136 (30.88%), Postives = 61/136 (44.85%), Query Frame = 2
Query:  764 YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            Y+     G K   C++CGK +R+   L+ HI                   G+  Y C  C K FR    L  H   HTG++ ++C  C K F S+  +R H  +HTG + YKC+ C K F    +  +H R H  +
Sbjct:  384 YHERTHTGEKPYECKQCGKAFRSASVLQKHI---------------RTHTGEKPYGCKQCGKVFRVASQLKMHERTHTGEKPYECKQCGKAFISSNSIRYHKRTHTGEKPYKCKQCGKAFISSNSFLYHERIHTGE 504          

HSP 3 Score: 62.3882 bits (150), Expect = 1.051e-9
Identity = 43/146 (29.45%), Postives = 66/146 (45.21%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++F  S    +     G K  +C++C K +    S ++H      E    G+ P         Y C  C K FR +  L  H   HTG++ ++C +C K F S+   R H  +HTG + Y+C+ C K F+ V     H R H  +
Sbjct:  234 KAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYH------ERTHSGEKP---------YECTQCRKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFRYHEKTHTGEKPYECKKCVKAFSFVKDLRIHERTHTGE 364          

HSP 4 Score: 60.077 bits (144), Expect = 6.524e-9
Identity = 40/129 (31.01%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K   C+ CGK + +  S R+H      E    G+ P         Y C  C K F ++ +L  H   HTG++ F+C  C K F S+     H  +HTG + Y+C+ C K F        H+R H  +
Sbjct:  307 GEKPYECKLCGKGFISSTSFRYH------EKTHTGEKP---------YECKKCVKAFSFVKDLRIHERTHTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECKQCGKAFRSASVLQKHIRTHTGE 420          

HSP 5 Score: 53.1434 bits (126), Expect = 9.601e-7
Identity = 41/143 (28.67%), Postives = 61/143 (42.66%), Query Frame = 2
Query:  782 DGRKMLRCRECGKHYRNDYSLRHHICLRRK----EVWKKGDVPKELVD---------GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
              +K   C++CGK +    S+R H  +       E  + G     LV          G+  + C  C K F    +L RH   HTG++ +KC  CDK F      + H  +H+G + Y+C  C K F  V     H R+H  +
Sbjct:  166 SAKKPYECKQCGKAFSFPSSVRRHERIHSAKKPYECKQCGKALSYLVSFQTHMRMHTGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGEKPYECTQCRKAFRSVKYLRVHERKHTGE 308          

HSP 6 Score: 50.0618 bits (118), Expect = 8.574e-6
Identity = 29/100 (29.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG 1084
            G K   C++CGK + +  S+R+H               K    G+  Y C  C K F    +   H  +HTG++ ++C  C K F SA  +++H+ +H G
Sbjct:  447 GEKPYECKQCGKAFISSNSIRYH---------------KRTHTGEKPYKCKQCGKAFISSNSFLYHERIHTGEKPYECKQCGKAFRSASILQKHVRTHAG 531          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZFP37 (ZFP37 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:12863])

HSP 1 Score: 80.8777 bits (198), Expect = 2.141e-15
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            K++   S  + +     G K   C+ECGK +R + SL  H+                   G++ Y C  C K F++  +LT+H  +HTG++ F+C+ C K F     +  H  +HT  + YKC  C K F    + T+HMR H  +S
Sbjct:  399 KTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHV---------------RTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGES 530          

HSP 2 Score: 66.6254 bits (161), Expect = 6.560e-11
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 2
Query:  737 SYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            ++   S  V +     G K   C +CGK + + ++L  H+                +  G+  Y C  C K FR   NL +H   HTG++ ++C  C K F     +  H+ +HTG + Y+C  C K F    + T HMR H  +
Sbjct:  344 AFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHL---------------RIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGE 473          

HSP 3 Score: 65.4698 bits (158), Expect = 1.317e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  743 FGDSRAV-YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSN 1177
            FG S ++ Y+     G     C +CGK ++    L  H               + +  G+  Y C  C K F    +L  H   HTG++ ++C+ C+K F +  Q+  H  SHTG + Y+C  C K F    + T H++ H+ D S+
Sbjct:  513 FGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQH---------------QRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEDKSH 644          

HSP 4 Score: 64.3142 bits (155), Expect = 2.986e-10
Identity = 39/146 (26.71%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++   S  + +       K  +C ECGK + +  SL +H+                   G+  + C  C K F+ +  LT+H  VHTG++ ++C+ C K F     +  H  +HTG + Y+C  C+K F        H R H  +
Sbjct:  483 KAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHM---------------RTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGE 613          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZFP37 (ZFP37 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:12863])

HSP 1 Score: 80.4925 bits (197), Expect = 2.252e-15
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            K++   S  + +     G K   C+ECGK +R + SL  H+                   G++ Y C  C K F++  +LT+H  +HTG++ F+C+ C K F     +  H  +HT  + YKC  C K F    + T+HMR H  +S
Sbjct:  385 KTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHV---------------RTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGES 516          

HSP 2 Score: 66.6254 bits (161), Expect = 6.580e-11
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 2
Query:  737 SYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            ++   S  V +     G K   C +CGK + + ++L  H+                +  G+  Y C  C K FR   NL +H   HTG++ ++C  C K F     +  H+ +HTG + Y+C  C K F    + T HMR H  +
Sbjct:  330 AFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHL---------------RIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGE 459          

HSP 3 Score: 65.4698 bits (158), Expect = 1.243e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  743 FGDSRAV-YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSN 1177
            FG S ++ Y+     G     C +CGK ++    L  H               + +  G+  Y C  C K F    +L  H   HTG++ ++C+ C+K F +  Q+  H  SHTG + Y+C  C K F    + T H++ H+ D S+
Sbjct:  499 FGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQH---------------QRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEDKSH 630          

HSP 4 Score: 64.3142 bits (155), Expect = 2.945e-10
Identity = 39/146 (26.71%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++   S  + +       K  +C ECGK + +  SL +H+                   G+  + C  C K F+ +  LT+H  VHTG++ ++C+ C K F     +  H  +HTG + Y+C  C+K F        H R H  +
Sbjct:  469 KAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHM---------------RTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGE 599          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZFP37 (ZFP37 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:12863])

HSP 1 Score: 80.4925 bits (197), Expect = 2.499e-15
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            K++   S  + +     G K   C+ECGK +R + SL  H+                   G++ Y C  C K F++  +LT+H  +HTG++ F+C+ C K F     +  H  +HT  + YKC  C K F    + T+HMR H  +S
Sbjct:  384 KTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHV---------------RTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGES 515          

HSP 2 Score: 66.2402 bits (160), Expect = 7.110e-11
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 2
Query:  737 SYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            ++   S  V +     G K   C +CGK + + ++L  H+                +  G+  Y C  C K FR   NL +H   HTG++ ++C  C K F     +  H+ +HTG + Y+C  C K F    + T HMR H  +
Sbjct:  329 AFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHL---------------RIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGE 458          

HSP 3 Score: 65.4698 bits (158), Expect = 1.343e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  743 FGDSRAV-YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSN 1177
            FG S ++ Y+     G     C +CGK ++    L  H               + +  G+  Y C  C K F    +L  H   HTG++ ++C+ C+K F +  Q+  H  SHTG + Y+C  C K F    + T H++ H+ D S+
Sbjct:  498 FGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQH---------------QRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEDKSH 629          

HSP 4 Score: 64.3142 bits (155), Expect = 3.295e-10
Identity = 39/146 (26.71%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++   S  + +       K  +C ECGK + +  SL +H+                   G+  + C  C K F+ +  LT+H  VHTG++ ++C+ C K F     +  H  +HTG + Y+C  C+K F        H R H  +
Sbjct:  468 KAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHM---------------RTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGE 598          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF227 (zinc finger protein 227 [Source:HGNC Symbol;Acc:HGNC:13020])

HSP 1 Score: 78.5666 bits (192), Expect = 1.324e-14
Identity = 47/143 (32.87%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            K +   S+ +Y+  G  G K  +C ECGK +    +LRHH               + +  G+  + C  C K F    NL  H  VHT ++ FKC+ C K F  + ++  H   HTG + YKC ICDK F      T+H + H
Sbjct:  667 KGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHH---------------QRVHTGEKPHICEECGKAFSLPSNLRVHLGVHTREKLFKCEECGKGFSQSARLEAHQRVHTGEKPYKCDICDKDFRHRSRLTYHQKVH 794          

HSP 2 Score: 70.8626 bits (172), Expect = 3.065e-12
Identity = 45/129 (34.88%), Postives = 59/129 (45.74%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  RC  CGK +    +L+ H      +V   G+ P         Y C  C K F W  NL  H  VH+G++ +KC+ CDK F  A   R H   HTG + YKC +C K F+       H R H  +
Sbjct:  544 GEKPYRCDVCGKDFSYSSNLKLH------QVIHTGEKP---------YKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGE 657          

HSP 3 Score: 62.003 bits (149), Expect = 1.777e-9
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  +C+ECGK +    +L+               V + +  G+  + C TC K F     L  H  VHTG++ ++CD+C K+F  +  ++ H   HTG + YKC  C K F+       H R H+ +
Sbjct:  488 GEKPYKCKECGKGFSQASNLQ---------------VHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGE 601          

HSP 4 Score: 61.2326 bits (147), Expect = 3.522e-9
Identity = 38/114 (33.33%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            G K  +C  CGK +  +  L  HI  R             +  G+  Y C  C K F    NL  H  VHTG++ FKC+ C K F  + +++ H   HTG + Y+C +C K F+
Sbjct:  460 GEKPYKCEACGKGFTRNTDL--HIHFR-------------VHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFS 558          

HSP 5 Score: 58.9214 bits (141), Expect = 1.560e-8
Identity = 41/129 (31.78%), Postives = 55/129 (42.64%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  +C ECGK +    + +   C +R    +K             Y C  C K F W  NL  H  VH G++ +KC+ C K F  A     H   HTG + YKC +C K F+       H R H  +
Sbjct:  348 GEKPYKCEECGKCFSQSSNFQ---CHQRVHTEEK------------PYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGE 461          

HSP 6 Score: 58.5362 bits (140), Expect = 2.302e-8
Identity = 44/142 (30.99%), Postives = 59/142 (41.55%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGD-------------VPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  +C ECGK +    +L  H  +   E   K +             V + +  G+  Y C  C K F     L  H  VHTG++ +KCD+C K F  + Q   H   HTG + YKC  C K F        H R H  +
Sbjct:  572 GEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGE 713          

HSP 7 Score: 55.8398 bits (133), Expect = 1.365e-7
Identity = 38/112 (33.93%), Postives = 50/112 (44.64%), Query Frame = 2
Query:  791 KMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            K  +C ECGK +    +LR H  + R               G+  Y C  C K F    +   H  VHTG++ +KCD+C K F     +  H   HTG + YKC  C K FT
Sbjct:  378 KPYKCEECGKGFGWSVNLRVHQRVHR---------------GEKPYKCEECGKGFTQAAHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFT 474          

HSP 8 Score: 52.7582 bits (125), Expect = 1.391e-6
Identity = 33/114 (28.95%), Postives = 49/114 (42.98%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            G K  +C  CGK +     L+ H               + +  G+  Y C  C K FR+      H   HTG++ +KC+ C K F  +  +R H   HTG + + C  C K F+
Sbjct:  628 GEKPYKCGVCGKGFSQSSGLQSH---------------QRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGEKPHICEECGKAFS 726          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 74.3294 bits (181), Expect = 8.882e-14
Identity = 36/85 (42.35%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  911 DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            +G+  Y C  C+K F  + NL  H   HTG+R FKC+IC KEF     +++H   HTG R ++C ICDK F+       H+R HN
Sbjct:  503 NGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHN 587          

HSP 2 Score: 73.559 bits (179), Expect = 1.693e-13
Identity = 39/128 (30.47%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  779 EDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            E+G+    C++C K +    +L+ H+                   G+  + C  C+K F  + +L +H  VHTG+R  +CDICDK F S   ++ H+  H G + Y C +CD  FT       H R H
Sbjct:  502 ENGKTRYACKDCNKTFGQLSNLKVHVRTHT---------------GERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLH 614          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 74.3294 bits (181), Expect = 1.037e-13
Identity = 36/85 (42.35%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  911 DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            +G+  Y C  C+K F  + NL  H   HTG+R FKC+IC KEF     +++H   HTG R ++C ICDK F+       H+R HN
Sbjct:  503 NGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHN 587          

HSP 2 Score: 73.559 bits (179), Expect = 1.893e-13
Identity = 39/128 (30.47%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  779 EDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            E+G+    C++C K +    +L+ H+                   G+  + C  C+K F  + +L +H  VHTG+R  +CDICDK F S   ++ H+  H G + Y C +CD  FT       H R H
Sbjct:  502 ENGKTRYACKDCNKTFGQLSNLKVHVRTHT---------------GERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLH 614          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 67.0106 bits (162), Expect = 2.017e-12
Identity = 38/124 (30.65%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  791 KMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            K  RC+ CGK +    +L  H               K +  G+  + CP C++PF    +L  H   HTG+R + C  C+K F  +  + +H+ +HTG + Y C IC   FT       HM+ H
Sbjct:  105 KPFRCQTCGKAFSQAANLTAH---------------KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 67.781 bits (164), Expect = 2.024e-12
Identity = 38/124 (30.65%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  791 KMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            K  RC+ CGK +    +L  H               K +  G+  + CP C++PF    +L  H   HTG+R + C  C+K F  +  + +H+ +HTG + Y C IC   FT       HM+ H
Sbjct:  164 KPFRCQTCGKAFSQAANLTAH---------------KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 272          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 62.7734 bits (151), Expect = 4.074e-10
Identity = 44/149 (29.53%), Postives = 66/149 (44.30%), Query Frame = 2
Query:  743 FGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD--SSNP 1180
                 A+Y      G K  RC  C K     ++L++++ L  K+V ++ +           + C  C+K F + G+L  H   HTG+R + C  C K F S   ++ H  +HTG R Y C+ C + F      T H   H T   S NP
Sbjct:  198 LSSPSALYTHKKTHGDKTFRCDFCPK----TFALKNYLKLHVKQVHEQNE---------RKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNP 333          

HSP 2 Score: 51.9878 bits (123), Expect = 8.518e-7
Identity = 25/66 (37.88%), Postives = 34/66 (51.52%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            + C  C K F +   L  H   HTG++ + C  C K F     ++ H  +HTG R YKCR C+K F
Sbjct:  104 HICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTF 169          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0083585)

HSP 1 Score: 83.5741 bits (205), Expect = 9.384e-17
Identity = 57/174 (32.76%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  650 PKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P     T+     L   L+A +     ++   GD  +    GGE   K   CR CGK Y    +L+ H  LR                G+  Y CP C+K F    NLT H   HTGQ+ F+C ICD+ F  +  V  HM +H+G R Y+C  C K F+     T H+R H+ +
Sbjct:  393 PPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGS---SGGE--MKPNLCRLCGKTYARPSTLKTH--LRTHS-------------GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGE 546          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0083584)

HSP 1 Score: 83.5741 bits (205), Expect = 1.149e-16
Identity = 57/174 (32.76%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  650 PKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P     T+     L   L+A +     ++   GD  +    GGE   K   CR CGK Y    +L+ H  LR                G+  Y CP C+K F    NLT H   HTGQ+ F+C ICD+ F  +  V  HM +H+G R Y+C  C K F+     T H+R H+ +
Sbjct:  393 PPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGS---SGGE--MKPNLCRLCGKTYARPSTLKTH--LRTHS-------------GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGE 546          

HSP 2 Score: 50.8322 bits (120), Expect = 2.739e-6
Identity = 29/111 (26.13%), Postives = 45/111 (40.54%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHH-------------ICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSH 1078
            G +  RC +C K +    +L  H             IC RR               G+  Y C +C K F     LT+H  +H+G++ ++C +C   F  +  + RHM  H
Sbjct:  461 GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0330042)

HSP 1 Score: 83.1889 bits (204), Expect = 1.690e-16
Identity = 57/174 (32.76%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  650 PKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P     T+     L   L+A +     ++   GD  +    GGE   K   CR CGK Y    +L+ H  LR                G+  Y CP C+K F    NLT H   HTGQ+ F+C ICD+ F  +  V  HM +H+G R Y+C  C K F+     T H+R H+ +
Sbjct:  393 PPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGS---SGGE--MKPNLCRLCGKTYARPSTLKTH--LRTHS-------------GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGE 546          

HSP 2 Score: 50.447 bits (119), Expect = 3.446e-6
Identity = 29/111 (26.13%), Postives = 45/111 (40.54%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHH-------------ICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSH 1078
            G +  RC +C K +    +L  H             IC RR               G+  Y C +C K F     LT+H  +H+G++ ++C +C   F  +  + RHM  H
Sbjct:  461 GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: Opbp (gene:FBgn0050443 transcript:FBtr0086109)

HSP 1 Score: 75.8702 bits (185), Expect = 3.339e-14
Identity = 44/130 (33.85%), Postives = 63/130 (48.46%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            G K   C  CGK +R  YSL  H  LR     +              Y C  C+K F+     + H  +H+ +R F CD C K F ++ Q+  H N+HT   Y+C +C++PF+ +YA   HM+ H   SS
Sbjct:  323 GEKPYACEVCGKTFRVSYSLTLH--LRTHTNIRP-------------YVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT-KPYRCAVCNRPFSSMYAVKNHMQTHKEISS 436          

HSP 2 Score: 55.8398 bits (133), Expect = 6.844e-8
Identity = 33/129 (25.58%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  797 LRCRECGKHYRNDYSLRHHICLRRK----EVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            + C  C + + N+ + + H  +  K    E  +K      L   +  + C  C + F       +H  VHTG++ + C++C K F  +Y +  H+ +HT +R Y C +C+K F      + H+R H+++
Sbjct:  252 IMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSE 380          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: Aef1 (gene:FBgn0005694 transcript:FBtr0078348)

HSP 1 Score: 70.8626 bits (172), Expect = 4.323e-13
Identity = 49/178 (27.53%), Postives = 76/178 (42.70%), Query Frame = 2
Query:  644 PKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGE--DGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P P  S LT L+    TT +++    A  H  + G+  A    GG   +  K   C  C + +R   +L +H+               ++  G+  Y C  C K FR    LT H  +HTG++ + C+ C K F     +  H+  HTG + ++C IC K F        H++ H  D
Sbjct:  132 PPPPTSHLTHLTTHSPTT-IHSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLTNHV---------------KIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMD 293          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: znf408 (zinc finger protein 408 [Source:ZFIN;Acc:ZDB-GENE-130530-589])

HSP 1 Score: 85.1149 bits (209), Expect = 6.511e-17
Identity = 44/124 (35.48%), Postives = 61/124 (49.19%), Query Frame = 2
Query:  797 LRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            ++C EC K   N  SLR+H+                L  G+  + CP C+K FR  GNL  H  +HTG++ ++CD CD  F    ++RRH+ SHTG  Y C +C K     +    H R H  D
Sbjct:  440 VKCPECDKELANSGSLRNHM---------------RLHTGERPHICPHCNKCFRQRGNLQGHMRIHTGEKPYRCDHCDLRFSQVPELRRHLISHTGEVYLCPVCGKALRDPHTLRAHERLHTGD 548          

HSP 2 Score: 67.3958 bits (163), Expect = 2.522e-11
Identity = 38/134 (28.36%), Postives = 61/134 (45.52%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSNPI 1183
            G K  RC  C   +     LR H+      +   G+V          Y CP C K  R    L  H  +HTG R +KC+ C K +  A ++RRH+ SH   + + C++C   ++ + +   H++ H  DS + +
Sbjct:  492 GEKPYRCDHCDLRFSQVPELRRHL------ISHTGEV----------YLCPVCGKALRDPHTLRAHERLHTGDRPYKCEQCGKGYTMATKLRRHLKSHLEEKQHVCQVCGAKYSMMQSLQRHLQLHQPDSGHAL 609          

HSP 3 Score: 60.4622 bits (145), Expect = 3.540e-9
Identity = 37/129 (28.68%), Postives = 53/129 (41.09%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSH-------TGMRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            C ECGK Y +  S + H+ + R               GQ  + C  C K +    +L  H  +H+G++ F CDIC K F     +R H   H         ++ KC  CDK      +   HMR H  +
Sbjct:  352 CTECGKSYSSHESFQAHLLMHR---------------GQRPFKCEQCDKSYGLKRDLKEHQVLHSGEKPFVCDICGKAFARRPSLRVHREIHRTKEPDYQALKVKCPECDKELANSGSLRNHMRLHTGE 465          

HSP 4 Score: 50.8322 bits (120), Expect = 3.650e-6
Identity = 27/84 (32.14%), Postives = 38/84 (45.24%), Query Frame = 2
Query:  917 QLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNT 1165
            Q  Y C  C K +    +   H  +H GQR FKC+ CDK +     ++ H   H+G + + C IC K F    +   H   H T
Sbjct:  347 QKPYTCTECGKSYSSHESFQAHLLMHRGQRPFKCEQCDKSYGLKRDLKEHQVLHSGEKPFVCDICGKAFARRPSLRVHREIHRT 430          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: si:dkey-7i4.11 (si:dkey-7i4.11 [Source:ZFIN;Acc:ZDB-GENE-131120-102])

HSP 1 Score: 79.7221 bits (195), Expect = 2.121e-16
Identity = 45/144 (31.25%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  731 HKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            HK Y      ++      G K   C++CGK ++   +LR H+               ++ +G+ +Y C  C K F W  NLT H  +HTG++ + C  C K F  +  ++ HM  H G + Y C+ C+K FT     T+HMR H
Sbjct:   98 HKHYLTKHMRIH-----TGEKPYTCQQCGKSFKRQENLRQHM---------------KIHNGEKLYTCHQCGKSFTWKQNLTFHMRIHTGEKPYTCQQCGKSFNRSENLKEHMKIHNGEKLYTCQKCEKSFTWKQNLTFHMRIH 221          

HSP 2 Score: 56.9954 bits (136), Expect = 1.176e-8
Identity = 35/121 (28.93%), Postives = 52/121 (42.98%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            C +CGK + + + L  H+                +  G+  Y C  C K F+   NL +H  +H G++ + C  C K F     +  HM  HTG + Y C+ C K F        HM+ HN
Sbjct:   89 CHQCGKSFAHKHYLTKHM---------------RIHTGEKPYTCQQCGKSFKRQENLRQHMKIHNGEKLYTCHQCGKSFTWKQNLTFHMRIHTGEKPYTCQQCGKSFNRSENLKEHMKIHN 194          

HSP 3 Score: 56.6102 bits (135), Expect = 1.454e-8
Identity = 29/102 (28.43%), Postives = 47/102 (46.08%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEF 1039
            KS+       ++     G K   C++CGK +    +L+ H+               ++ +G+ +Y C  C K F W  NLT H  +HTG++ F C  C+K F
Sbjct:  150 KSFTWKQNLTFHMRIHTGEKPYTCQQCGKSFNRSENLKEHM---------------KIHNGEKLYTCQKCEKSFTWKQNLTFHMRIHTGEKPFNCQHCEKSF 236          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: si:dkey-77f5.13 (si:dkey-77f5.13 [Source:ZFIN;Acc:ZDB-GENE-131119-99])

HSP 1 Score: 80.4925 bits (197), Expect = 4.405e-16
Identity = 44/129 (34.11%), Postives = 64/129 (49.61%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K+  C++CGK +    +L+ H+               ++  G+ +Y C  C K F W  NLT H  +HTG++ + C  C K F     +  HM+SHTG R + C+ C K FT     T HMR HN +
Sbjct:  139 GEKLYTCQQCGKSFNRRQNLKEHM---------------KIHKGEKLYTCQKCEKSFTWKQNLTTHMRIHTGEKPYNCQHCGKSFTCKQHLTDHMSSHTGERQHTCQQCGKSFTRKQYLTDHMRMHNGE 252          

HSP 2 Score: 63.929 bits (154), Expect = 1.343e-10
Identity = 39/120 (32.50%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            C +CGK +    +L+ HI +        GD P         Y C  C K F    NL  H  +H G++ + C  C K F     ++ HM  H G + Y C+ C+K FT     T HMR H
Sbjct:   89 CNQCGKSFNRRQNLKEHIKIHN------GDKP---------YACQQCGKSFNRRPNLKEHMNIHKGEKLYTCQQCGKSFNRRQNLKEHMKIHKGEKLYTCQKCEKSFTWKQNLTTHMRIH 193          

HSP 3 Score: 63.5438 bits (153), Expect = 1.622e-10
Identity = 41/143 (28.67%), Postives = 60/143 (41.96%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQH 1159
            KS+        +     G +   C++CGK +     L  H+                + +G+  + CP C K F W  +L  H  +HTG++ + C  C K F     +  HM  HTG  R+ C  C K FT   + T HMR H
Sbjct:  206 KSFTCKQHLTDHMSSHTGERQHTCQQCGKSFTRKQYLTDHM---------------RMHNGEKPHACPHCGKSFTWKHHLVTHMRIHTGEKPYNCQQCGKSFSWKQYLTDHMRIHTGEKRHSCLQCGKGFTRKRSLTEHMRIH 333          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: si:dkey-77f5.13 (si:dkey-77f5.13 [Source:ZFIN;Acc:ZDB-GENE-131119-99])

HSP 1 Score: 80.4925 bits (197), Expect = 4.405e-16
Identity = 44/129 (34.11%), Postives = 64/129 (49.61%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K+  C++CGK +    +L+ H+               ++  G+ +Y C  C K F W  NLT H  +HTG++ + C  C K F     +  HM+SHTG R + C+ C K FT     T HMR HN +
Sbjct:  139 GEKLYTCQQCGKSFNRRQNLKEHM---------------KIHKGEKLYTCQKCEKSFTWKQNLTTHMRIHTGEKPYNCQHCGKSFTCKQHLTDHMSSHTGERQHTCQQCGKSFTRKQYLTDHMRMHNGE 252          

HSP 2 Score: 63.929 bits (154), Expect = 1.343e-10
Identity = 39/120 (32.50%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            C +CGK +    +L+ HI +        GD P         Y C  C K F    NL  H  +H G++ + C  C K F     ++ HM  H G + Y C+ C+K FT     T HMR H
Sbjct:   89 CNQCGKSFNRRQNLKEHIKIHN------GDKP---------YACQQCGKSFNRRPNLKEHMNIHKGEKLYTCQQCGKSFNRRQNLKEHMKIHKGEKLYTCQKCEKSFTWKQNLTTHMRIH 193          

HSP 3 Score: 63.5438 bits (153), Expect = 1.622e-10
Identity = 41/143 (28.67%), Postives = 60/143 (41.96%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQH 1159
            KS+        +     G +   C++CGK +     L  H+                + +G+  + CP C K F W  +L  H  +HTG++ + C  C K F     +  HM  HTG  R+ C  C K FT   + T HMR H
Sbjct:  206 KSFTCKQHLTDHMSSHTGERQHTCQQCGKSFTRKQYLTDHM---------------RMHNGEKPHACPHCGKSFTWKHHLVTHMRIHTGEKPYNCQQCGKSFSWKQYLTDHMRIHTGEKRHSCLQCGKGFTRKRSLTEHMRIH 333          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: si:dkey-77f5.13 (si:dkey-77f5.13 [Source:ZFIN;Acc:ZDB-GENE-131119-99])

HSP 1 Score: 80.4925 bits (197), Expect = 4.405e-16
Identity = 44/129 (34.11%), Postives = 64/129 (49.61%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K+  C++CGK +    +L+ H+               ++  G+ +Y C  C K F W  NLT H  +HTG++ + C  C K F     +  HM+SHTG R + C+ C K FT     T HMR HN +
Sbjct:  139 GEKLYTCQQCGKSFNRRQNLKEHM---------------KIHKGEKLYTCQKCEKSFTWKQNLTTHMRIHTGEKPYNCQHCGKSFTCKQHLTDHMSSHTGERQHTCQQCGKSFTRKQYLTDHMRMHNGE 252          

HSP 2 Score: 63.929 bits (154), Expect = 1.343e-10
Identity = 39/120 (32.50%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            C +CGK +    +L+ HI +        GD P         Y C  C K F    NL  H  +H G++ + C  C K F     ++ HM  H G + Y C+ C+K FT     T HMR H
Sbjct:   89 CNQCGKSFNRRQNLKEHIKIHN------GDKP---------YACQQCGKSFNRRPNLKEHMNIHKGEKLYTCQQCGKSFNRRQNLKEHMKIHKGEKLYTCQKCEKSFTWKQNLTTHMRIH 193          

HSP 3 Score: 63.5438 bits (153), Expect = 1.622e-10
Identity = 41/143 (28.67%), Postives = 60/143 (41.96%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQH 1159
            KS+        +     G +   C++CGK +     L  H+                + +G+  + CP C K F W  +L  H  +HTG++ + C  C K F     +  HM  HTG  R+ C  C K FT   + T HMR H
Sbjct:  206 KSFTCKQHLTDHMSSHTGERQHTCQQCGKSFTRKQYLTDHM---------------RMHNGEKPHACPHCGKSFTWKHHLVTHMRIHTGEKPYNCQQCGKSFSWKQYLTDHMRIHTGEKRHSCLQCGKGFTRKRSLTEHMRIH 333          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: ENSXETT00000046299.1 (zinc finger protein 628 [Source:NCBI gene;Acc:100489381])

HSP 1 Score: 78.9518 bits (193), Expect = 1.044e-14
Identity = 43/143 (30.07%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            K++ G S  +Y+     G +  +C  CGK ++    L+ H               + +  G   + C  C   F+W  +   H   HTG+R ++C++C+K F ++  +RRH N HTG R Y+C IC K FT       H R H
Sbjct:   67 KAFKGSSALLYHQRSHTGERPYKCESCGKAFKRSSLLQIH---------------QSVHTGVKSFKCNICGMAFKWSSHYQYHVRQHTGERPYQCNVCEKAFKNSSSLRRHRNIHTGERPYECAICGKAFTQSTNLRQHQRIH 194          

HSP 2 Score: 77.411 bits (189), Expect = 3.131e-14
Identity = 59/188 (31.38%), Postives = 83/188 (44.15%), Query Frame = 2
Query:  650 PKMSRLTALSKGLLTTE-LNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSL----RHHICLRRKEVWKKGDVPK---------ELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P+ S +T  S     TE ++   K     K++ G S   Y+     G +  +C ECGK ++    L    R H  +R  +  + G   K             G+  Y C  C K F+    L RH  +HTG+R F C +C K F     +R+H  +HTG R YKC  CDK FT       H R H++D
Sbjct:  372 PQTSEITQPSTATPATETVDRQYKCTECGKAFKGTSGLRYHMRDHTGERPYKCSECGKAFKRSSLLSIHQRVHTGVRAFKCAECGLTFKWSSHYQYHLRQHTGERPYTCTDCGKSFKNTSCLRRHRQLHTGERPFTCLMCGKTFTQTSNLRQHERTHTGERPYKCDKCDKSFTHSSNLQLHQRTHSSD 559          

HSP 3 Score: 73.1738 bits (178), Expect = 5.921e-13
Identity = 40/133 (30.08%), Postives = 61/133 (45.86%), Query Frame = 2
Query:  764 YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            Y+     G +   C +CGK ++N   LR H               ++L  G+  + C  C K F    NL +H   HTG+R +KCD CDK F  +  ++ H  +H+  + +KC +C K F        H+R H
Sbjct:  467 YHLRQHTGERPYTCTDCGKSFKNTSCLRRH---------------RQLHTGERPFTCLMCGKTFTQTSNLRQHERTHTGERPYKCDKCDKSFTHSSNLQLHQRTHSSDKPFKCTVCGKSFVMSSYLQRHLRTH 584          

HSP 4 Score: 67.781 bits (164), Expect = 3.251e-11
Identity = 39/138 (28.26%), Postives = 62/138 (44.93%), Query Frame = 2
Query:  764 YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHT-GMRYKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            Y+     G +  +C  C K ++N  SLR H               + +  G+  Y C  C K F    NL +H  +HTG+R +KC+ C K F  +  +  H  +H+ G+ +KC IC K F        H++ H  + +
Sbjct:  133 YHVRQHTGERPYQCNVCEKAFKNSSSLRRH---------------RNIHTGERPYECAICGKAFTQSTNLRQHQRIHTGERPYKCEDCGKSFTHSSNLLLHQRTHSAGVSHKCEICGKVFISDSFLQKHLQSHAIEQA 255          

HSP 5 Score: 62.3882 bits (150), Expect = 1.408e-9
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            C ECGK ++    L HH      +    G+ P         Y C  C K F+    L  H   HTG+R +KC+ C K F  +  ++ H + HTG++ +KC IC   F       +H+RQH
Sbjct:   34 CHECGKVFKWSSRLIHH------QRTHTGERP---------YKCTECPKAFKGSSALLYHQRSHTGERPYKCESCGKAFKRSSLLQIHQSVHTGVKSFKCNICGMAFKWSSHYQYHVRQH 138          

HSP 6 Score: 58.5362 bits (140), Expect = 2.022e-8
Identity = 29/66 (43.94%), Postives = 34/66 (51.52%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            Y C  C K F+W   L  H   HTG+R +KC  C K F  +  +  H  SHTG R YKC  C K F
Sbjct:   32 YECHECGKVFKWSSRLIHHQRTHTGERPYKCTECPKAFKGSSALLYHQRSHTGERPYKCESCGKAF 97          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: ZBTB24 (zinc finger and BTB domain containing 24 [Source:NCBI gene;Acc:100496803])

HSP 1 Score: 77.0258 bits (188), Expect = 3.013e-14
Identity = 46/139 (33.09%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKE------VWKKGDVPK-------ELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G +  RC ECGK +   +SL+ H  +   E      V  K    K        L  G+  + C  C K F     L  H+ VHTG+   +C IC ++F  + Q+++H+ SHTG R + C IC K FT   +   H+R H
Sbjct:  299 GERPFRCAECGKGFSQKHSLQVHERIHTGERPYTCTVCNKALATKHSLMEHMSLHAGKKSFTCDQCGKYFSQKRQLKSHYRVHTGRTLPECTICQRKFMDSAQLKKHLRSHTGERPFTCEICGKSFTAKSSLQTHIRIH 437          

HSP 2 Score: 58.151 bits (139), Expect = 2.639e-8
Identity = 38/149 (25.50%), Postives = 63/149 (42.28%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHH-------------ICLRRKEVWKKGDVPKELVD--GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSNPI 1183
            G+K   C +CGK++     L+ H             IC R+        + K L    G+  + C  C K F    +L  H  +H G++ + C IC K F  +   RRH   H+G + + C  C   F+ +     HM+ H+ +  + +
Sbjct:  355 GKKSFTCDQCGKYFSQKRQLKSHYRVHTGRTLPECTICQRK--FMDSAQLKKHLRSHTGERPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKSFSDSSAKRRHCILHSGKKPFSCPDCSLQFSRMDNLKTHMKIHSKEKHSQV 501          

HSP 3 Score: 53.5286 bits (127), Expect = 7.229e-7
Identity = 27/77 (35.06%), Postives = 38/77 (49.35%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            C  C K F+    L  H  +HTG+R F+C  C K F   + ++ H   HTG R Y C +C+K     ++   HM  H
Sbjct:  277 CKDCEKSFKNNHFLAIHQRIHTGERPFRCAECGKGFSQKHSLQVHERIHTGERPYTCTVCNKALATKHSLMEHMSLH 353          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: txnip (thioredoxin interacting protein [Source:Xenbase;Acc:XB-GENE-968442])

HSP 1 Score: 73.559 bits (179), Expect = 2.098e-13
Identity = 45/136 (33.09%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  755 RAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            R ++   G  G+K+  C EC K + N  +LR H       V   G  P         + C  C + FR   +L RH+ +HTG+R FKC IC K F     + +H   HTG + Y+C IC+K F  ++    H ++H
Sbjct:  105 RPLHLKFGPSGQKLYECGECKKCFNNSSNLRKHT------VIHTGMKP---------FTCNVCDQRFRQATHLQRHYLIHTGERPFKCSICQKGFRDTSDLLKHQRVHTGEKPYQCSICEKSFKHLHNARLHRQRH 225          

HSP 2 Score: 56.9954 bits (136), Expect = 5.043e-8
Identity = 45/156 (28.85%), Postives = 61/156 (39.10%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHH---------------ICLR--RKEVWKKGDVPKELV--------------------------DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            GRK   C  CG+ + +  +LR H                C +  R       D+P E                             GQ +Y C  C K F    NL +H  +HTG + F C++CD+ F  A  ++RH   HTG R +KC IC K F
Sbjct:   29 GRKQYECDLCGRCFSDPSNLRRHKNIHTGLRPYVCDCPYCSKGFRDSTELHEDLPVEFQCSFCSKWFVTREELEAHRPLHLKFGPSGQKLYECGECKKCFNNSSNLRKHTVIHTGMKPFTCNVCDQRFRQATHLQRHYLIHTGERPFKCSICQKGF 184          

HSP 3 Score: 54.299 bits (129), Expect = 3.143e-7
Identity = 27/64 (42.19%), Postives = 34/64 (53.12%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPF 1120
            C  C+K F  +  L RH+ +HTG R F C +C K F     + RH   HTG  RY+C  C K F
Sbjct:  283 CTLCTKTFARVSGLHRHYLIHTGHRPFGCHLCGKTFRQLSHLDRHKRIHTGERRYQCITCHKAF 346          

HSP 4 Score: 49.6766 bits (117), Expect = 8.097e-6
Identity = 28/87 (32.18%), Postives = 42/87 (48.28%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHT-GMRYKCRICDKPFTCVYACTWHMRQHNTDS 1171
            G   + C  C K FR + +L RH  +HTG+R ++C  C K F  +  + RH   HT    + CR C K ++ +     H   H  +S
Sbjct:  305 GHRPFGCHLCGKTFRQLSHLDRHKRIHTGERRYQCITCHKAFRESSDLLRHQQVHTKDNLFCCRQCQKTYSQIQQLKAHELSHEQNS 391          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: ENSXETT00000017443.1 (zinc finger protein 436-like [Source:NCBI gene;Acc:100491613])

HSP 1 Score: 73.559 bits (179), Expect = 3.346e-13
Identity = 48/143 (33.57%), Postives = 61/143 (42.66%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            KS+   S  V       G K   C ECG  + +  SL  H      ++   G+ P         Y C  C K F +  +L RH  VHTG++ + C  C K F  +  + RH   HTG R Y CR C K FTC      H R H
Sbjct:  330 KSFVISSDLVKVQISHSGEKSHICSECGSGFVSSSSLLKH------QIIHTGEKP---------YTCKDCGKSFSFNSSLIRHQRVHTGEKPYVCKECGKSFSISTTLVRHQRVHTGERPYACRDCGKRFTCNSHLVIHQRLH 457          

HSP 2 Score: 58.9214 bits (141), Expect = 1.385e-8
Identity = 42/143 (29.37%), Postives = 61/143 (42.66%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHH----------ICLRRKEVWKKGDVPKELV------DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            G K   C++CGK +  + SL  H          +C   KE  K   +   LV       G+  Y C  C K F    +L  H  +HTG+R + C  C   F +   + +H  +HTG R Y C  C K F+ +     H + H+
Sbjct:  375 GEKPYTCKDCGKSFSFNSSLIRHQRVHTGEKPYVC---KECGKSFSISTTLVRHQRVHTGERPYACRDCGKRFTCNSHLVIHQRLHTGERPYTCVECGNCFSNGSDLVKHQRTHTGERPYSCSECGKCFSIISNLITHQKGHS 514          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: txnip (thioredoxin interacting protein [Source:Xenbase;Acc:XB-GENE-968442])

HSP 1 Score: 73.1738 bits (178), Expect = 3.848e-13
Identity = 43/123 (34.96%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  755 RAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            R ++   G  G+K+  C EC K + N  +LR H       V   G  P         + C  C + FR   +L RH+ +HTG+R FKC IC K F     + +H   HTG + Y+C IC+K F
Sbjct:  207 RPLHLKFGPSGQKLYECGECKKCFNNSSNLRKHT------VIHTGMKP---------FTCNVCDQRFRQATHLQRHYLIHTGERPFKCSICQKGFRDTSDLLKHQRVHTGEKPYQCSICEKSF 314          

HSP 2 Score: 66.6254 bits (161), Expect = 4.114e-11
Identity = 43/127 (33.86%), Postives = 58/127 (45.67%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            GRK   C  CG+ + +  +LR H               K +  G   Y C  C   FR    L RH  VHTG+R F+C  C K F  + ++R H   HTG R Y C +C K F+ +     +MR+H 
Sbjct:   48 GRKQYECDLCGRCFSDPSNLRRH---------------KNIHTGLRPYVCDACGSSFRQKSQLDRHRLVHTGERPFQCPYCSKGFRDSTELRVHFRVHTGERPYSCPVCQKSFSRI----CYMRKHQ 155          

HSP 3 Score: 57.3806 bits (137), Expect = 3.916e-8
Identity = 36/115 (31.30%), Postives = 52/115 (45.22%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKE--LVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPF 1120
            G +  +C  C K +R+   L  H      +    G+ P +  + +      C  C+K F  +  L RH+ +HTG R F C +C K F     + RH   HTG  RY+C  C K F
Sbjct:  273 GERPFKCSICQKGFRDTSDLLKH------QRVHTGEKPYQCSICEKSFNLKCTLCTKTFARVSGLHRHYLIHTGHRPFGCHLCGKTFRQLSHLDRHKRIHTGERRYQCITCHKAF 381          

HSP 4 Score: 50.0618 bits (118), Expect = 8.668e-6
Identity = 32/89 (35.96%), Postives = 41/89 (46.07%), Query Frame = 2
Query:  905 LVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            +V G+  Y C  C + F    NL RH  +HTG R + CD C   F    Q+ RH   HTG R ++C  C K F        H R H  +
Sbjct:   45 VVMGRKQYECDLCGRCFSDPSNLRRHKNIHTGLRPYVCDACGSSFRQKSQLDRHRLVHTGERPFQCPYCSKGFRDSTELRVHFRVHTGE 133          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp11 (zinc finger protein 11 [Source:MGI Symbol;Acc:MGI:99156])

HSP 1 Score: 75.485 bits (184), Expect = 6.319e-14
Identity = 50/143 (34.97%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  791 KMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKE-------------LVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            K  RC+ECGK ++  ++L  H      +V  KG+ P +             L   Q+I      Y C  C K FR+   LTRH  VHTG + +KC  CDK F ++  + RH   HTG + YKC+ C + F C      HM+ H
Sbjct:  167 KPYRCQECGKAFKRSHTLSQH------QVIHKGEKPHKCDECGRAFSKHSSLTQHQVIHTGEKPYQCRECGKAFRYQSTLTRHHIVHTGAKPYKCPECDKAFNNSSTLSRHQIIHTGEKPYKCQECGRAFYCSSFLIQHMKIH 303          

HSP 2 Score: 70.8626 bits (172), Expect = 1.901e-12
Identity = 44/121 (36.36%), Postives = 59/121 (48.76%), Query Frame = 2
Query:  800 RCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            RCRECGK +R    L  H               + +  G+  Y C  C K F++  NLTRH  +HTG + +KC  C K F ++  + RH   HTG + YKC+ C K F C      HM+ H
Sbjct:  310 RCRECGKPFRLSSQLIRH---------------QRIHTGEEPYICRECGKTFKYQSNLTRHQILHTGAKPYKCPECGKAFNNSSTLTRHQIIHTGEKPYKCQECSKAFYCSSYLIQHMKIH 415          

HSP 3 Score: 69.3218 bits (168), Expect = 5.763e-12
Identity = 45/130 (34.62%), Postives = 61/130 (46.92%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSL-RHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSH-TGMRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  +CRECGK +R   +L RHHI                +  G   Y CP C K F     L+RH  +HTG++ +KC  C + F+ +  + +HM  H   M Y+CR C KPF        H R H  +
Sbjct:  221 GEKPYQCRECGKAFRYQSTLTRHHI----------------VHTGAKPYKCPECDKAFNNSSTLSRHQIIHTGEKPYKCQECGRAFYCSSFLIQHMKIHFEEMPYRCRECGKPFRLSSQLIRHQRIHTGE 334          

HSP 4 Score: 63.929 bits (154), Expect = 2.737e-10
Identity = 46/137 (33.58%), Postives = 60/137 (43.80%), Query Frame = 2
Query:  800 RCRECGKHYRNDYSLRHH----------ICLRRKEVWKKGDVPKELVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            RC+ECGK ++    L  H          IC   KE  K  +    L   Q I      Y C  C K F     L++H  +H G R +KC  C K ++ + Q+ RH   HTG + Y C+ C K F C    T H R H
Sbjct:  422 RCKECGKPFKCSSQLIRHQRIHSGEKPYIC---KECGKAFNCTSYLTKHQRIHTGEKPYVCQECGKAFNCSSYLSKHQRIHIGDRLYKCKECGKAYYFSSQLNRHQRIHTGEKPYVCQECGKAFNCSSYLTKHQRIH 555          

HSP 5 Score: 62.3882 bits (150), Expect = 8.047e-10
Identity = 45/150 (30.00%), Postives = 62/150 (41.33%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHH----------ICLRRKEVWKKGDVPKELVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSNPI 1183
            G ++ +C+ECGK Y     L  H          +C   +E  K  +    L   Q I      Y C  CSK F     LT+H  +H G R +KC  C K +  + Q+ RH   HT  R Y+C+ C K F        H   H   + N +
Sbjct:  501 GDRLYKCKECGKAYYFSSQLNRHQRIHTGEKPYVC---QECGKAFNCSSYLTKHQRIHIVEKPYVCKECSKAFSCSSYLTKHQRIHAGDRLYKCTECGKAYCFSSQLNRHQRIHTRERPYRCKECGKAFITSSCLKRHQETHTLQTPNSV 647          

HSP 6 Score: 61.2326 bits (147), Expect = 2.039e-9
Identity = 45/142 (31.69%), Postives = 65/142 (45.77%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSL-RHHICLRRKEVWKKGDVPKE------LVDGQLIYF------CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  +C ECGK + N  +L RH I    ++ +K  +  K       L+    I+F      C  C KPF+    L RH  +H+G++ + C  C K F     + +H   HTG + Y C+ C K F C    + H R H  D
Sbjct:  361 GAKPYKCPECGKAFNNSSTLTRHQIIHTGEKPYKCQECSKAFYCSSYLIQHMKIHFEEIPYRCKECGKPFKCSSQLIRHQRIHSGEKPYICKECGKAFNCTSYLTKHQRIHTGEKPYVCQECGKAFNCSSYLSKHQRIHIGD 502          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp948 (zinc finger protein 948 [Source:MGI Symbol;Acc:MGI:3040683])

HSP 1 Score: 75.0998 bits (183), Expect = 8.791e-14
Identity = 44/126 (34.92%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G +  RC ECGK +R   +LR H               K++  G+  Y C  C K F    +L RH  VHTG++ +KC  CDK F   + +R+H   HT  + YKC+ CD  F C+     H + H
Sbjct:  545 GERPYRCTECGKSFREGTTLRTH---------------KKIHTGEKPYNCTVCDKSFIRYSHLQRHQRVHTGEKPYKCMECDKSFTECFLLRKHQRIHTEEKPYKCKDCDLAFVCISNLRKHQKNH 655          

HSP 2 Score: 69.3218 bits (168), Expect = 5.831e-12
Identity = 39/108 (36.11%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            C ECGK +     LR H                ++  G  +Y C  C K F    +L +H  +HTG+R +KC  C+K F     +RRH + HTG + YKC+ CDK FT
Sbjct:  383 CEECGKSFTELLQLRRHY---------------KIHSGATLYKCRDCDKSFTQYSHLQKHQTIHTGERPYKCKDCEKSFLHNSLLRRHQSVHTGEKPYKCKECDKSFT 475          

HSP 3 Score: 63.5438 bits (153), Expect = 3.617e-10
Identity = 33/86 (38.37%), Postives = 44/86 (51.16%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G+  Y C  C K FR    L  H  +HTG++ + C +CDK F     ++RH   HTG + YKC  CDK FT  +    H R H  +
Sbjct:  545 GERPYRCTECGKSFREGTTLRTHKKIHTGEKPYNCTVCDKSFIRYSHLQRHQRVHTGEKPYKCMECDKSFTECFLLRKHQRIHTEE 630          

HSP 4 Score: 59.6918 bits (143), Expect = 5.876e-9
Identity = 45/145 (31.03%), Postives = 61/145 (42.07%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEV-WKKGDVPKELVDGQLIYF--------------CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            KS+  +S    +     G K  +C+EC K +  +  LR H  +  KE  +K  +  K     QL Y               C  C K F     L  H  VHTG+R ++C  C K F     +R H   HTG + Y C +CDK F
Sbjct:  444 KSFLHNSLLRRHQSVHTGEKPYKCKECDKSFTRNSILRQHQKIHTKEKPYKCVECDKSFT--QLTYLRTHQRVHTKEKPYNCTVCDKSFTTGATLRIHQRVHTGERPYRCTECGKSFREGTTLRTHKKIHTGEKPYNCTVCDKSF 586          

HSP 5 Score: 58.9214 bits (141), Expect = 1.097e-8
Identity = 27/70 (38.57%), Postives = 39/70 (55.71%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
             ++ Y C  C K F  +  L RH+ +H+G   +KC  CDK F     +++H   HTG R YKC+ C+K F
Sbjct:  377 SEIDYECEECGKSFTELLQLRRHYKIHSGATLYKCRDCDKSFTQYSHLQKHQTIHTGERPYKCKDCEKSF 446          

HSP 6 Score: 58.5362 bits (140), Expect = 1.436e-8
Identity = 30/79 (37.97%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            Y C  C + F    NLT H  +HTG++ +KC+ CDK F     ++ H   HTG + YKC+ C K F  + A   H + H
Sbjct:  214 YQCGQCQRCFSTSANLTIHQRIHTGEKPYKCNFCDKSFAQCTTLKTHQRLHTGEKPYKCKECGKSFPQLSALKSHQKMH 292          

HSP 7 Score: 56.6102 bits (135), Expect = 5.361e-8
Identity = 40/126 (31.75%), Postives = 55/126 (43.65%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G +  +C++C K      S  H+  LRR +    G+ P         Y C  C K F     L +H  +HT ++ +KC  CDK F     +R H   HT  + Y C +CDK FT       H R H
Sbjct:  433 GERPYKCKDCEK------SFLHNSLLRRHQSVHTGEKP---------YKCKECDKSFTRNSILRQHQKIHTKEKPYKCVECDKSFTQLTYLRTHQRVHTKEKPYNCTVCDKSFTTGATLRIHQRVH 543          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp141 (zinc finger protein 141 [Source:MGI Symbol;Acc:MGI:3584269])

HSP 1 Score: 75.0998 bits (183), Expect = 8.963e-14
Identity = 47/142 (33.10%), Postives = 66/142 (46.48%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLR-HHICLRRKEVWKKGDVPKELVDGQLI------------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K  +C+ECGK + + YSLR HH     ++ +K  D  +   +G  +            Y C  C K F    N   H  +HTG R +KC  C K F  ++ +R+H  +HTG + YKC  C K FT       H R H  +
Sbjct:  434 GEKPYKCKECGKSFTHGYSLRIHHRFHTGEKPYKCKDCGRSFAEGSSLKSHHRIHTGEKPYKCKECGKSFAKQSNFETHSRIHTGDRPYKCTDCGKSFTRSFCLRKHHKTHTGEKAYKCEECGKAFTQRSTLKTHYRIHTGE 575          

HSP 2 Score: 64.6994 bits (156), Expect = 1.946e-10
Identity = 37/129 (28.68%), Postives = 56/129 (43.41%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G +  +C +CGK +   + LR H                +   G+  Y C  C K F     L  H+ +HTG++ +KC+ C K F     ++ H+  HTG + YKC+ C K F        H R H  +
Sbjct:  518 GDRPYKCTDCGKSFTRSFCLRKH---------------HKTHTGEKAYKCEECGKAFTQRSTLKTHYRIHTGEKPYKCNECGKSFTEGSTLKTHLKIHTGEKPYKCKECGKSFAEASTLKTHHRIHTGE 631          

HSP 3 Score: 62.7734 bits (151), Expect = 7.291e-10
Identity = 41/140 (29.29%), Postives = 61/140 (43.57%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKE-VWKKGDVPKELVDGQLI------------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            G K  +C ECGK +    +L+ H  +   E  +K  +  K   +G  +            Y C  C K F     L  H  +HTG++ +KC  C K F  +  ++ H   HTG + YKC+ C K F    +   H R H+
Sbjct:  546 GEKAYKCEECGKAFTQRSTLKTHYRIHTGEKPYKCNECGKSFTEGSTLKTHLKIHTGEKPYKCKECGKSFAEASTLKTHHRIHTGEKPYKCTDCGKSFTQSSHLQSHCRIHTGEKPYKCKECGKSFAKDSSLQKHHRIHS 685          

HSP 4 Score: 52.373 bits (124), Expect = 1.254e-6
Identity = 29/86 (33.72%), Postives = 41/86 (47.67%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G+  Y C  C + F     L  H  +HTG++ +KC  C K F   Y +R H   HTG + YKC+ C + F    +   H R H  +
Sbjct:  406 GEKPYKCKICKRSFTTGSYLQAHQRIHTGEKPYKCKECGKSFTHGYSLRIHHRFHTGEKPYKCKDCGRSFAEGSSLKSHHRIHTGE 491          

HSP 5 Score: 50.447 bits (119), Expect = 4.278e-6
Identity = 26/77 (33.77%), Postives = 39/77 (50.65%), Query Frame = 2
Query:  941 CSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            C K F        +  +HTG++ +KC IC + F +   ++ H   HTG + YKC+ C K FT  Y+   H R H  +
Sbjct:  387 CGKSFSQFSGYRENGTIHTGEKPYKCKICKRSFTTGSYLQAHQRIHTGEKPYKCKECGKSFTHGYSLRIHHRFHTGE 463          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp628 (zinc finger protein 628 [Source:MGI Symbol;Acc:MGI:2665174])

HSP 1 Score: 75.0998 bits (183), Expect = 1.247e-13
Identity = 51/159 (32.08%), Postives = 70/159 (44.03%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSL----RHHICLRRKEVWKKGDVPK---------ELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++ G S   Y+     G +  +C ECGK ++    L    R H  LR     + G   K          L  G+  Y C  C K FR    L RH +VHTG+R   C +C K F     +R+H   HTG R ++C +C K FT       H R H+ +
Sbjct:  453 KAFKGSSGLRYHLRDHTGERPYQCGECGKAFKRSSLLAIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRLHSGERPYACTECGKAFRNTSCLRRHRHVHTGERPHSCSVCGKSFAQTSNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLHQRTHSAE 611          

HSP 2 Score: 74.3294 bits (181), Expect = 1.766e-13
Identity = 49/156 (31.41%), Postives = 72/156 (46.15%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLR----HHICLRRKEVWKKGDVPK---------ELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            K++ G S  +Y+  G  G +  +C +C K ++    L+     H  LR     + G   K             G+  Y CP C K F+   +L RH +VHTG+R + C IC K F  +  +R+H   HTG R ++C +C K FT       H R H
Sbjct:   69 KAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRSVHTGLRAFTCGQCGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYTCGICGKSFTQSTNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLHHRTH 224          

HSP 3 Score: 71.2478 bits (173), Expect = 1.994e-12
Identity = 41/128 (32.03%), Postives = 56/128 (43.75%), Query Frame = 2
Query:  782 DGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
             G +   C ECGK +RN        CLRR      G+ P         + C  C K F    NL +H  VHTG+R F+C +C K F  +  +  H  +H+  R + C IC + F        H+R H 
Sbjct:  525 SGERPYACTECGKAFRNTS------CLRRHRHVHTGERP---------HSCSVCGKSFAQTSNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLHQRTHSAERPFACPICGRGFVMAAYLQRHLRTHT 637          

HSP 4 Score: 66.2402 bits (160), Expect = 6.898e-11
Identity = 45/159 (28.30%), Postives = 69/159 (43.40%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKE-VWKKGDVPKELVDGQLI------------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            KS+   SR +++     G +  +C +C K ++   +L +H      E  ++  D PK      L+            + C  C   F+W  +   H   HTG+R + C  C K F ++  +RRH + HTG R Y C IC K FT       H R H  +
Sbjct:   41 KSFRWSSRLLHHQRTHTGERPYKCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRSVHTGLRAFTCGQCGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYTCGICGKSFTQSTNLRQHQRVHTGE 199          

HSP 5 Score: 61.6178 bits (148), Expect = 1.718e-9
Identity = 39/127 (30.71%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSNP 1180
            C ECGK +R    L HH               +    G+  Y CP C K F+    L  H   HTG+R ++C  C K F  +  ++ H + HTG+R + C  C   F       +H+RQH  +   P
Sbjct:   36 CGECGKSFRWSSRLLHH---------------QRTHTGERPYKCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRSVHTGLRAFTCGQCGLAFKWSSHYQYHLRQHTGERPYP 147          

HSP 6 Score: 56.225 bits (134), Expect = 7.763e-8
Identity = 28/66 (42.42%), Postives = 33/66 (50.00%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            Y C  C K FRW   L  H   HTG+R +KC  C K F  +  +  H   HTG R Y+C  C K F
Sbjct:   34 YECGECGKSFRWSSRLLHHQRTHTGERPYKCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAF 99          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp790 (zinc finger protein 790 [Source:MGI Symbol;Acc:MGI:1923431])

HSP 1 Score: 73.9442 bits (180), Expect = 2.080e-13
Identity = 56/195 (28.72%), Postives = 83/195 (42.56%), Query Frame = 2
Query:  635 THPPKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKG--------------DVPK--ELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            T PP PK++R  A+  G    + +   K+     S  G  R         G K   C+ECGK +R    L  H+   R    +K               D+ +   +  G+  Y C  C K F    +LTRH  +HTG++ ++C+ C K F     + +H   HTG + Y C+ C K FTC    + H + H  D
Sbjct:  204 TFPPGPKLTRYRAVQDGKKAFQCDECGKAFSFRSSLTGHKRI------HTGEKPFTCKECGKAFRFHSLLSVHV---RTHTGEKSYECKACGKFFNYSSDLTRHHRIHTGEKPYQCRECGKAFSCGSDLTRHERIHTGEKPYECNECGKAFIQQSHLIKHQRIHTGEKPYVCKECGKAFTCGSQLSQHRKIHTGD 389          

HSP 2 Score: 66.6254 bits (161), Expect = 4.134e-11
Identity = 42/130 (32.31%), Postives = 65/130 (50.00%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            G+K+  C+ECGK     +SLR  +              K++ + + ++ C  C K FR   +L+RH  +HTG++ +KC  C K F     + RH   HTG++ Y C+ C K FT     T H + H+  S
Sbjct:  444 GKKLYECKECGK----AFSLRSIV-----------SSLKKIHNREKLFKCKDCEKAFRCPSDLSRHQKIHTGEKPYKCKECGKGFICRSDLGRHQRVHTGVKPYVCKECGKAFTRGAHLTQHQKIHSKKS 558          

HSP 3 Score: 61.2326 bits (147), Expect = 2.083e-9
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSNPI 1183
            + C  C K FR+   LTRH  +HTG++ +KC  C K F SA  + RH   HTG R Y+C  C K F        H R H+ +    +
Sbjct:  640 FQCKECPKAFRYSSELTRHQRLHTGEKPYKCQECWKAFASASDLARHQRIHTGERPYECNECGKAFIQQSHLIKHQRVHSAEQPKDV 726          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|C9JN71|ZN878_HUMAN (Zinc finger protein 878 OS=Homo sapiens OX=9606 GN=ZNF878 PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 5.497e-16
Identity = 52/154 (33.77%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  749 DSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRR-------KEVWKKGDVPKELVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
             S    +G    G K   C+ECGK +R   S+R H  +         K+  K    P  +   + I      Y C  C K   ++ +   H  +HTG+R  KC+IC K FFS   ++RH  SHTG  RYKC+ CDK F C  +  +H R H+ +
Sbjct:  127 SSSLAIHGRTHTGEKPYECKECGKAFRFPSSVRRHERIHSAKKPYECKQCGKAFSFPSSVRRHERIHSAKKPYECKQCGKALSYLVSFQTHMRMHTGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGE 280          

HSP 2 Score: 68.1662 bits (165), Expect = 7.882e-11
Identity = 42/136 (30.88%), Postives = 61/136 (44.85%), Query Frame = 2
Query:  764 YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            Y+     G K   C++CGK +R+   L+ HI                   G+  Y C  C K FR    L  H   HTG++ ++C  C K F S+  +R H  +HTG + YKC+ C K F    +  +H R H  +
Sbjct:  384 YHERTHTGEKPYECKQCGKAFRSASVLQKHI---------------RTHTGEKPYGCKQCGKVFRVASQLKMHERTHTGEKPYECKQCGKAFISSNSIRYHKRTHTGEKPYKCKQCGKAFISSNSFLYHERIHTGE 504          

HSP 3 Score: 62.3882 bits (150), Expect = 5.049e-9
Identity = 43/146 (29.45%), Postives = 66/146 (45.21%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++F  S    +     G K  +C++C K +    S ++H      E    G+ P         Y C  C K FR +  L  H   HTG++ ++C +C K F S+   R H  +HTG + Y+C+ C K F+ V     H R H  +
Sbjct:  234 KAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYH------ERTHSGEKP---------YECTQCRKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFRYHEKTHTGEKPYECKKCVKAFSFVKDLRIHERTHTGE 364          

HSP 4 Score: 60.077 bits (144), Expect = 3.133e-8
Identity = 40/129 (31.01%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K   C+ CGK + +  S R+H      E    G+ P         Y C  C K F ++ +L  H   HTG++ F+C  C K F S+     H  +HTG + Y+C+ C K F        H+R H  +
Sbjct:  307 GEKPYECKLCGKGFISSTSFRYH------EKTHTGEKP---------YECKKCVKAFSFVKDLRIHERTHTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECKQCGKAFRSASVLQKHIRTHTGE 420          

HSP 5 Score: 53.1434 bits (126), Expect = 4.611e-6
Identity = 41/143 (28.67%), Postives = 61/143 (42.66%), Query Frame = 2
Query:  782 DGRKMLRCRECGKHYRNDYSLRHHICLRRK----EVWKKGDVPKELVD---------GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
              +K   C++CGK +    S+R H  +       E  + G     LV          G+  + C  C K F    +L RH   HTG++ +KC  CDK F      + H  +H+G + Y+C  C K F  V     H R+H  +
Sbjct:  166 SAKKPYECKQCGKAFSFPSSVRRHERIHSAKKPYECKQCGKALSYLVSFQTHMRMHTGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGEKPYECTQCRKAFRSVKYLRVHERKHTGE 308          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|Q24732|GLAS_DROVI (Protein glass OS=Drosophila virilis OX=7244 GN=gl PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.616e-16
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  746 GDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            GD+ A   G      K   CR CGK Y    +L+ H  LR                G+  Y CP C+K F    NLT H   HTGQ+ F+C ICD+ F  +  V  HM +H+G R Y+C  C K F+     T H+R H+ +
Sbjct:  410 GDADADGEGSAGGDMKPNLCRLCGKTYARPSTLKTH--LRTHS-------------GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGE 536          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|P13360|GLAS_DROME (Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.152e-15
Identity = 57/174 (32.76%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  650 PKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P     T+     L   L+A +     ++   GD  +    GGE   K   CR CGK Y    +L+ H  LR                G+  Y CP C+K F    NLT H   HTGQ+ F+C ICD+ F  +  V  HM +H+G R Y+C  C K F+     T H+R H+ +
Sbjct:  393 PPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGS---SGGE--MKPNLCRLCGKTYARPSTLKTH--LRTHS-------------GERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGE 546          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|Q9Y6Q3|ZFP37_HUMAN (Zinc finger protein 37 homolog OS=Homo sapiens OX=9606 GN=ZFP37 PE=2 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 1.200e-14
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            K++   S  + +     G K   C+ECGK +R + SL  H+                   G++ Y C  C K F++  +LT+H  +HTG++ F+C+ C K F     +  H  +HT  + YKC  C K F    + T+HMR H  +S
Sbjct:  384 KTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHV---------------RTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGES 515          

HSP 2 Score: 66.2402 bits (160), Expect = 3.414e-10
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 2
Query:  737 SYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            ++   S  V +     G K   C +CGK + + ++L  H+                +  G+  Y C  C K FR   NL +H   HTG++ ++C  C K F     +  H+ +HTG + Y+C  C K F    + T HMR H  +
Sbjct:  329 AFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHL---------------RIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGE 458          

HSP 3 Score: 65.4698 bits (158), Expect = 6.451e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  743 FGDSRAV-YYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSN 1177
            FG S ++ Y+     G     C +CGK ++    L  H               + +  G+  Y C  C K F    +L  H   HTG++ ++C+ C+K F +  Q+  H  SHTG + Y+C  C K F    + T H++ H+ D S+
Sbjct:  498 FGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQH---------------QRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEDKSH 629          

HSP 4 Score: 64.3142 bits (155), Expect = 1.582e-9
Identity = 39/146 (26.71%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++   S  + +       K  +C ECGK + +  SL +H+                   G+  + C  C K F+ +  LT+H  VHTG++ ++C+ C K F     +  H  +HTG + Y+C  C+K F        H R H  +
Sbjct:  468 KAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHM---------------RTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGE 598          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|O88553|ZFP37_RAT (Zinc finger protein 37 OS=Rattus norvegicus OX=10116 GN=Zfp37 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.594e-14
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K   C+ECGK +R + S   H+                   G++ Y C  C K F++  +LT+H  +HTG++ F+C  C K F     +  H  +HT  + YKC+ C K F    + T+HMR H  D
Sbjct:  367 GEKPYECKECGKSFRYNSSFTEHV---------------RTHTGEIPYECNECGKAFKYGSSLTKHMRIHTGEKPFECTECGKTFSKKSHLVIHQRTHTKEKPYKCKECGKAFGHSSSLTYHMRTHTGD 480          

HSP 2 Score: 62.7734 bits (151), Expect = 4.216e-9
Identity = 48/164 (29.27%), Postives = 75/164 (45.73%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHI----------CLRRKEVWKK--GDVPKELV-DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR----YKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            K++   S  V +       K  +C+ECGK + +  SL +H+          C +  + +K+  G    + V  G+  Y C  C K F    +L  H   HTG++ F+C  C K F +  Q+  H  SHTG +    Y+C  C K F    + T HM+ H+ + S
Sbjct:  434 KTFSKKSHLVIHQRTHTKEKPYKCKECGKAFGHSSSLTYHMRTHTGDCPFECNKCGKAFKQIEGLTQHQRVHTGEKPYECVECGKAFSQKSHLIVHQRTHTGEKPFECYECGKAFNAKSQLVIHQRSHTGEKPYKPYECVECGKAFKQNASLTRHMKTHSEEQS 597          

HSP 3 Score: 61.2326 bits (147), Expect = 1.451e-8
Identity = 38/123 (30.89%), Postives = 57/123 (46.34%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            C +CGK + + ++L  H+      +   G+ P         Y C  C K FR   NL +H   HTG++ ++C  C K F        H+ +HTG + Y+C  C K F    + T HMR H  +
Sbjct:  316 CVQCGKAHGHKHALTDHL-----RISHTGEKP---------YKCNECGKTFRHSSNLMQHIRSHTGEKPYECKECGKSFRYNSSFTEHVRTHTGEIPYECNECGKAFKYGSSLTKHMRIHTGE 424          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: G4VGJ7 (Putative zinc finger protein OS=Schistosoma mansoni OX=6183 GN=Smp_074040 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.744e-75
Identity = 144/346 (41.62%), Postives = 201/346 (58.09%), Query Frame = 2
Query:  251 DGYVIVSFSNRKKAQIQTATFSDVSK-----------------------NSSEAMN------ILKNQ-SNVINHISK--------GDDQNMPDEDNFYGEAFWIGXXXXXXXXXXXXTKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNNDNESVNSHTHPPKPKMSRLTA---LSKGLLTTELNAIKKSAGKHKSYFGDS--RAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQH 1159
            +GY+I++F  +KKA ++TA F+DVS                         S  A++      +L+N+ +N    +SK         D        + YGEAFW+G ++    + +  +  ++ G+    +    +       + T T+T       + ++ S+N+    P+  ++RLT      K        A K +     S+F     RA     G+  +KMLRC +CGK+YRNDYSL HHICL+RK+VWKKGDVP E++DGQ++YFCP+C KPF+W+GNLTRHFYVHTGQRFF+CDIC KEFFSAYQV+RHMNSHTG+R+KC +CDKPFTC YAC WH RQH
Sbjct:   33 EGYLILTFDKKKKAVLKTAVFADVSDPRFADDYEDDDEDESNDNCWPLHESKLAVSQQGNDGVLENEVTNAKGFLSKPLVISTDAADKNPCSPYTSCYGEAFWVGEDELNAKQNTTSSWDLSPGNKASQSLIRTSPLTCDTHSVTPTSTLQ----SSTESWSLNT----PQSTITRLTGTFPYRKATYPINHLARKYNHNTFSSHFQPKWPRAFNVHLGDHSKKMLRCDQCGKYYRNDYSLHHHICLKRKDVWKKGDVPSEMIDGQVMYFCPSCRKPFKWLGNLTRHFYVHTGQRFFRCDICSKEFFSAYQVKRHMNSHTGVRFKCEVCDKPFTCKYACAWHTRQH 370          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A1S8X0U0 (Zinc finger, C2H2 type (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_04000 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 9.047e-75
Identity = 111/155 (71.61%), Postives = 125/155 (80.65%), Query Frame = 2
Query:  716 KSAGKHKSYFGDSRAVYYGGGEDG-----RKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNT 1165
            +S+G   + F  S   Y   GE G     RKMLRC  CGK+YRN+YSL HHICLRRK+VWKKGDVP ++VDGQL+YFCPTC KPF+W+GNLTRHFYVHTGQRFFKCDIC KEFFSAYQV+RHMNSHTG R+KC +CDKPFTC YAC WH RQH T
Sbjct:  255 RSSGFLHTGFSSSTGSYTDDGEPGDDKYPRKMLRCDACGKYYRNEYSLHHHICLRRKDVWKKGDVPSDVVDGQLVYFCPTCHKPFKWLGNLTRHFYVHTGQRFFKCDICSKEFFSAYQVKRHMNSHTGRRFKCEVCDKPFTCKYACAWHTRQHYT 409          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A0X3NM62 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR168200 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.133e-74
Identity = 103/133 (77.44%), Postives = 118/133 (88.72%), Query Frame = 2
Query:  776 GEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            G   RKMLRC ECGK+YRN+YSL HHICL+RK+VWKKGDVP  L+DGQ+IYFCP C+KPF+W+GNLTRH+YVHTGQRFFKCDIC KEFFSAYQV+RHMNSHTG+R+ C +CDKPFTC YAC WHMRQH+  SS
Sbjct:  156 GGLSRKMLRCEECGKYYRNEYSLHHHICLKRKDVWKKGDVPSGLIDGQVIYFCPACNKPFKWLGNLTRHYYVHTGQRFFKCDICQKEFFSAYQVKRHMNSHTGLRFNCEVCDKPFTCKYACAWHMRQHSNSSS 288          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A183RLA4 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.264e-74
Identity = 143/346 (41.33%), Postives = 200/346 (57.80%), Query Frame = 2
Query:  251 DGYVIVSFSNRKKAQIQTATFSDVSK-----------------------NSSEAMN------ILKNQ-SNVINHISK--------GDDQNMPDEDNFYGEAFWIGXXXXXXXXXXXXTKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNNDNESVNSHTHPPKPKMSRLTA---LSKGLLTTELNAIKKSAGKHKSYFGD--SRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQH 1159
            +GY+I++F  +KKA ++TA F+DVS                         S  A++      +L+N+ +N    +SK         D        + YGEAFW+G ++    + +  +  ++ G+    +    +       + T T+T       + ++  +N+    P+  ++RLT      K        A K +     S+F     RA     G+  +KMLRC +CGK+YRNDYSL HHICL+RK+VWKKGDVP E++DGQ++YFCP+C KPF+W+GNLTRHFYVHTGQRFF+CDIC KEFFSAYQV+RHMNSHTG+R+KC +CDKPFTC YAC WH RQH
Sbjct:   33 EGYLILTFDKKKKAVLKTAVFADVSDPRFADDYEDDDEDESNDNCWPLHESKLAVSQQGNDGVLENEVTNAKGFLSKPLVISTDAADKNPCSPYTSCYGEAFWVGEDELNAKQNTTSSWDLSPGNKASQSLIRTSPLTCDTHSVTPTSTLQ----SSTESWPLNT----PQSTITRLTGTFPYRKATYPINHLARKYNHNTFSSHFQPKWPRAFNVHLGDHSKKMLRCDQCGKYYRNDYSLHHHICLKRKDVWKKGDVPSEMIDGQVMYFCPSCRKPFKWLGNLTRHFYVHTGQRFFRCDICSKEFFSAYQVKRHMNSHTGVRFKCEVCDKPFTCKYACAWHTRQH 370          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A0X3NIS1 (Zinc finger protein 90 OS=Schistocephalus solidus OX=70667 GN=ZFP90 PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.340e-74
Identity = 103/133 (77.44%), Postives = 118/133 (88.72%), Query Frame = 2
Query:  776 GEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            G   RKMLRC ECGK+YRN+YSL HHICL+RK+VWKKGDVP  L+DGQ+IYFCP C+KPF+W+GNLTRH+YVHTGQRFFKCDIC KEFFSAYQV+RHMNSHTG+R+ C +CDKPFTC YAC WHMRQH+  SS
Sbjct:  254 GGLSRKMLRCEECGKYYRNEYSLHHHICLKRKDVWKKGDVPSGLIDGQVIYFCPACNKPFKWLGNLTRHYYVHTGQRFFKCDICQKEFFSAYQVKRHMNSHTGLRFNCEVCDKPFTCKYACAWHMRQHSNSSS 386          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: znf408 (zinc finger protein 408 [Source:NCBI gene;Acc:103029472])

HSP 1 Score: 83.5741 bits (205), Expect = 1.627e-16
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  797 LRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTD 1168
            ++C +CGK   N  SLR+H+                L  G+  Y C  C K FR  GNL  H  +HTG++ ++C  CD+ F    ++RRH+ SHTG  Y C +C K     +    H R H  +
Sbjct:  477 IKCTKCGKELANRSSLRNHM---------------RLHTGERPYVCSDCGKSFRQRGNLQSHLRIHTGEKPYRCKHCDQSFSQVPELRRHLISHTGEAYLCPVCGKALRDPHTLRAHERLHTGE 585          

HSP 2 Score: 69.3218 bits (168), Expect = 5.436e-12
Identity = 39/127 (30.71%), Postives = 58/127 (45.67%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            G K  RC+ C + +     LR H+      +   G+           Y CP C K  R    L  H  +HTG+R +KC+ C K +  A ++RRHM SH   + +KC  C   FT + +   H++ H 
Sbjct:  529 GEKPYRCKHCDQSFSQVPELRRHL------ISHTGEA----------YLCPVCGKALRDPHTLRAHERLHTGERPYKCEQCGKGYTLATKLRRHMKSHLDEKPHKCETCGTRFTLMQSLQRHLQSHQ 639          

HSP 3 Score: 56.225 bits (134), Expect = 6.938e-8
Identity = 40/132 (30.30%), Postives = 58/132 (43.94%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGD--VPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            G K   C  CGK +    SLR H  + R    K+ D   PK          C  C K      +L  H  +HTG+R + C  C K F     ++ H+  HTG + Y+C+ CD+ F+ V     H+  H  ++
Sbjct:  439 GEKPFVCDVCGKAFARRPSLRIHKEIHR---AKEADYQAPK--------IKCTKCGKELANRSSLRNHMRLHTGERPYVCSDCGKSFRQRGNLQSHLRIHTGEKPYRCKHCDQSFSQVPELRRHLISHTGEA 559          

HSP 4 Score: 53.1434 bits (126), Expect = 5.098e-7
Identity = 35/129 (27.13%), Postives = 50/129 (38.76%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGM-------RYKCRICDKPFTCVYACTWHMRQHNTD 1168
            C EC K Y +  S R H+ + R               GQ  + C  C + +    +L  H  +HTG++ F CD+C K F     +R H   H          + KC  C K      +   HMR H  +
Sbjct:  389 CTECDKTYSSQESYRAHLLMHR---------------GQRPFKCQQCDRSYGLKRDLKEHQVLHTGEKPFVCDVCGKAFARRPSLRIHKEIHRAKEADYQAPKIKCTKCGKELANRSSLRNHMRLHTGE 502          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: znf408 (zinc finger protein 408 [Source:NCBI gene;Acc:103029472])

HSP 1 Score: 83.1889 bits (204), Expect = 2.059e-16
Identity = 42/121 (34.71%), Postives = 59/121 (48.76%), Query Frame = 2
Query:  797 LRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQH 1159
            ++C +CGK   N  SLR+H+                L  G+  Y C  C K FR  GNL  H  +HTG++ ++C  CD+ F    ++RRH+ SHTG  Y C +C K     +    H R H
Sbjct:  402 IKCTKCGKELANRSSLRNHM---------------RLHTGERPYVCSDCGKSFRQRGNLQSHLRIHTGEKPYRCKHCDQSFSQVPELRRHLISHTGEAYLCPVCGKALRDPHTLRAHERLH 507          

HSP 2 Score: 68.9366 bits (167), Expect = 6.452e-12
Identity = 39/127 (30.71%), Postives = 58/127 (45.67%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            G K  RC+ C + +     LR H+      +   G+           Y CP C K  R    L  H  +HTG+R +KC+ C K +  A ++RRHM SH   + +KC  C   FT + +   H++ H 
Sbjct:  454 GEKPYRCKHCDQSFSQVPELRRHL------ISHTGEA----------YLCPVCGKALRDPHTLRAHERLHTGERPYKCEQCGKGYTLATKLRRHMKSHLDEKPHKCETCGTRFTLMQSLQRHLQSHQ 564          

HSP 3 Score: 55.4546 bits (132), Expect = 1.055e-7
Identity = 40/132 (30.30%), Postives = 58/132 (43.94%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGD--VPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            G K   C  CGK +    SLR H  + R    K+ D   PK          C  C K      +L  H  +HTG+R + C  C K F     ++ H+  HTG + Y+C+ CD+ F+ V     H+  H  ++
Sbjct:  364 GEKPFVCDVCGKAFARRPSLRIHKEIHR---AKEADYQAPK--------IKCTKCGKELANRSSLRNHMRLHTGERPYVCSDCGKSFRQRGNLQSHLRIHTGEKPYRCKHCDQSFSQVPELRRHLISHTGEA 484          

HSP 4 Score: 52.7582 bits (125), Expect = 7.637e-7
Identity = 35/126 (27.78%), Postives = 49/126 (38.89%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGM-------RYKCRICDKPFTCVYACTWHMRQH 1159
            C EC K Y +  S R H+ + R               GQ  + C  C + +    +L  H  +HTG++ F CD+C K F     +R H   H          + KC  C K      +   HMR H
Sbjct:  314 CTECDKTYSSQESYRAHLLMHR---------------GQRPFKCQQCDRSYGLKRDLKEHQVLHTGEKPFVCDVCGKAFARRPSLRIHKEIHRAKEADYQAPKIKCTKCGKELANRSSLRNHMRLH 424          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000017686.2 (zinc finger protein 502-like [Source:NCBI gene;Acc:107197608])

HSP 1 Score: 75.485 bits (184), Expect = 5.475e-14
Identity = 45/146 (30.82%), Postives = 65/146 (44.52%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K +   S  + +     G K L C +CGK + N   L+ H+                   G+  + CP C K F  +GNL  H  +HTG++ + C  C K F SA  ++ H  SHTG + Y C +C+K F      T H R H  +
Sbjct:  625 KCFALRSSLLAHLSNHTGEKPLLCTQCGKRFFNKIQLKSHM---------------RCHSGERPHMCPHCGKCFSLLGNLNIHVRIHTGEKPYVCHQCGKGFISAGDLQVHQRSHTGEKPYFCNVCEKRFVVSSHLTAHKRVHTGE 755          

HSP 2 Score: 65.0846 bits (157), Expect = 1.175e-10
Identity = 43/126 (34.13%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K   C +CGK + +   L+ H      +    G+ P         YFC  C K F    +LT H  VHTG+R F C  C K F   Y   +HM +H+G++ Y C IC K +T       HM+ H
Sbjct:  698 GEKPYVCHQCGKGFISAGDLQVH------QRSHTGEKP---------YFCNVCEKRFVVSSHLTAHKRVHTGERPFCCTQCGKTFVRRYDWNKHMYTHSGIKPYPCNICQKSYTRRTHLNRHMQSH 808          

HSP 3 Score: 51.2174 bits (121), Expect = 2.353e-6
Identity = 27/80 (33.75%), Postives = 39/80 (48.75%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            C  C K F    +L  H   HTG++   C  C K FF+  Q++ HM  H+G R + C  C K F+ +     H+R H  +
Sbjct:  620 CDQCGKCFALRSSLLAHLSNHTGEKPLLCTQCGKRFFNKIQLKSHMRCHSGERPHMCPHCGKCFSLLGNLNIHVRIHTGE 699          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000055951.1 (zinc finger protein 502-like [Source:NCBI gene;Acc:107197608])

HSP 1 Score: 75.485 bits (184), Expect = 6.434e-14
Identity = 45/146 (30.82%), Postives = 65/146 (44.52%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K +   S  + +     G K L C +CGK + N   L+ H+                   G+  + CP C K F  +GNL  H  +HTG++ + C  C K F SA  ++ H  SHTG + Y C +C+K F      T H R H  +
Sbjct:  606 KCFALRSSLLAHLSNHTGEKPLLCTQCGKRFFNKIQLKSHM---------------RCHSGERPHMCPHCGKCFSLLGNLNIHVRIHTGEKPYVCHQCGKGFISAGDLQVHQRSHTGEKPYFCNVCEKRFVVSSHLTAHKRVHTGE 736          

HSP 2 Score: 64.6994 bits (156), Expect = 1.383e-10
Identity = 43/126 (34.13%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K   C +CGK + +   L+ H      +    G+ P         YFC  C K F    +LT H  VHTG+R F C  C K F   Y   +HM +H+G++ Y C IC K +T       HM+ H
Sbjct:  679 GEKPYVCHQCGKGFISAGDLQVH------QRSHTGEKP---------YFCNVCEKRFVVSSHLTAHKRVHTGERPFCCTQCGKTFVRRYDWNKHMYTHSGIKPYPCNICQKSYTRRTHLNRHMQSH 789          

HSP 3 Score: 50.8322 bits (120), Expect = 2.728e-6
Identity = 27/80 (33.75%), Postives = 39/80 (48.75%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            C  C K F    +L  H   HTG++   C  C K FF+  Q++ HM  H+G R + C  C K F+ +     H+R H  +
Sbjct:  601 CDQCGKCFALRSSLLAHLSNHTGEKPLLCTQCGKRFFNKIQLKSHMRCHSGERPHMCPHCGKCFSLLGNLNIHVRIHTGE 680          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000057905.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:34021632:34036547:1 gene:ENSAMXG00000042325.1 transcript:ENSAMXT00000057905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.076e-13
Identity = 42/146 (28.77%), Postives = 66/146 (45.21%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++ G S  +Y+     G K  +C +CGK ++    L+ H               + +  G   + CP C   F+W  +   H   HTG+  + CD C K F ++  +RRH N H G++ Y C +C K F+       HMR H  +
Sbjct:   82 KAFKGSSALLYHQRSHSGEKPYKCDDCGKAFKRSSLLQVH---------------RSVHTGLRTFQCPYCPLTFKWSSHYQYHLRQHTGECPYPCDSCPKAFKNSSSLRRHKNVHLGVKPYVCVVCSKAFSQSTNLRQHMRIHTGE 212          

HSP 2 Score: 68.9366 bits (167), Expect = 8.888e-12
Identity = 47/171 (27.49%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  668 TALSKGLLTTELNAIKKS---AGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            TA+S+     EL ++++    +   KS+ G S   Y+     G +  RC ECGK ++    L  H               + +  G   + C  CS  F+W  +   H   HTG+R + C  C K F +   +RRH   H+G+R + C +C K F+       H R H+ +
Sbjct:  376 TAVSESAQGAELLSLERPYRCSECGKSFKGSSGLRYHMRDHTGERPYRCTECGKSFKRSSLLSIH---------------QRVHTGVRAFQCSYCSLTFKWSSHYQYHLRQHTGERPYVCQECGKSFKNTSCLRRHSQLHSGLRPHACSVCGKSFSQTSNLKQHERTHSGE 531          

HSP 3 Score: 64.6994 bits (156), Expect = 1.651e-10
Identity = 37/126 (29.37%), Postives = 57/126 (45.24%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G +   C+ECGK ++N   LR H                +L  G   + C  C K F    NL +H   H+G+R F+C  C K F  +  ++ H+ +H   + +KC+ C+K F        H+R H
Sbjct:  474 GERPYVCQECGKSFKNTSCLRRH---------------SQLHSGLRPHACSVCGKSFSQTSNLKQHERTHSGERPFQCMQCHKSFTHSSNLQLHLRTHYSRKDFKCQHCNKEFVMHSYLQRHLRTH 584          

HSP 4 Score: 62.003 bits (149), Expect = 1.112e-9
Identity = 42/143 (29.37%), Postives = 65/143 (45.45%), Query Frame = 2
Query:  758 AVYYGGGEDG-RKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSSNP 1180
            A+  G GE G R   +C +CGK ++    L HH   +R              + +  Y C  C K F+    L  H   H+G++ +KCD C K F  +  ++ H + HTG+R ++C  C   F       +H+RQH  +   P
Sbjct:   33 ALCSGAGEPGTRHPYQCLDCGKSFKWSSRLAHH---QRSH------------NNERPYRCNLCPKAFKGSSALLYHQRSHSGEKPYKCDDCGKAFKRSSLLQVHRSVHTGLRTFQCPYCPLTFKWSSHYQYHLRQHTGECPYP 160          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 1.463e-14
Identity = 43/150 (28.67%), Postives = 67/150 (44.67%), Query Frame = 2
Query:  716 KSAGKHKSYFGDSRAVYYGGGEDG-RKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            + + +H+      ++ Y   GE+  R+  RC  C K ++    L+ H+   R               G+  + C  C + F   G L  H   HTG++ +KCD+CD  F +   + RHM  HT M  +KC  C++ F     C  HMR H
Sbjct:  927 QESSQHEVQLSAEQSEYQSDGEESTRRSYRCGYCNKGFKKSSHLKQHV---RSHT------------GEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFCEESFRTSLHCRKHMRTH 1061          

HSP 2 Score: 68.1662 bits (165), Expect = 2.679e-12
Identity = 43/129 (33.33%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQ-LIYFCPTCSKPFRWMGNLTRHFYVH--------TGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            C EC +   +   LR H+                LV G+  ++ CP CSK F+   +L  H   H           R +KCD CDK F    Q++RH   HTG R Y C++CDK F    A   HM++H
Sbjct: 1628 CPECHQPCTSPMLLRQHL---------------RLVHGEDRLHTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKH 1741          

HSP 3 Score: 68.1662 bits (165), Expect = 3.076e-12
Identity = 53/186 (28.49%), Postives = 76/186 (40.86%), Query Frame = 2
Query:  641 PPKPKMSRLTALSKGL---------LTTE---LNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            P KP   RL     GL         L TE   +  + +S+  +  Y  D   +  G G D  +  RC  C K ++    L+ HI   R               G+  Y C  CS+ F   G L  H   H G + +KC +CD  F +   ++RHM++H+  R + C  C K F     C  HM+ H
Sbjct:  574 PRKPSRRRLPKQDMGLPEIPLQEPILITESGLIQQVTRSSHMYSQYLPDG-MLSDGSGLD--RPYRCGYCNKAFKKSSHLKQHI---RSHT------------GEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMKTH 741          

HSP 4 Score: 65.855 bits (159), Expect = 1.392e-11
Identity = 32/81 (39.51%), Postives = 47/81 (58.02%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNT 1165
            Y C  C+K F+   +L +H   HTG++ FKC  C + F S+  ++ HM +HTG + YKC +CD  FT   + T HM  H +
Sbjct:  955 YRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHTS 1035          

HSP 5 Score: 64.6994 bits (156), Expect = 4.088e-11
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 2
Query:  776 GEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            GED  ++  C  C K ++    L+ H+             P+       +Y C  C K F     L RH  +HTG+R + C +CDK F     ++ HM  HTG + YKC+ CD  F+
Sbjct: 1650 GED--RLHTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPR-------LYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFS 1757          

HSP 6 Score: 61.6178 bits (148), Expect = 3.610e-10
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            Y C  C+K F+   +L +H   HTG++ ++C  C + F S+  ++ H+ +H G++ YKC +CD  FT   +   HM  H+
Sbjct:  635 YRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHS 714          

HSP 7 Score: 60.4622 bits (145), Expect = 8.604e-10
Identity = 28/85 (32.94%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  908 VDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            V+G   + CP C+K F+   +L RH  +HT ++ +KC  C + F     +  H  +HTG++ + C +CDK F+   +   H+R H
Sbjct:  450 VNGVRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLH 534          

HSP 8 Score: 55.0694 bits (131), Expect = 3.396e-8
Identity = 33/132 (25.00%), Postives = 59/132 (44.70%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHI--CLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            G +   CR C + ++   +LR H+    + +         + +      + C  C K F+    L RH  +HTG+R F C+ C + F     ++ H   HTG R Y+C  C   F+       H+++ ++D+
Sbjct:  114 GARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDA 245          

HSP 9 Score: 52.7582 bits (125), Expect = 1.631e-7
Identity = 49/178 (27.53%), Postives = 76/178 (42.70%), Query Frame = 2
Query:  668 TALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRE---CGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            TAL +    T    I +S G+ +     S ++   GG+    M++ R        +R    +R H+C    + +KK   P +LV    I      Y C  C + F     LT H   HTG + F C +CDK F +   ++ H+  HTG + + C  C+K F        H+  H  D+
Sbjct:  396 TALQRAAAAT----IPRSTGRPRLQLPGSLSLARQGGKKQLSMIKKRIEMFLLGTWRRVNGVRWHMCPYCNKEFKK---PSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASHFKDA 566          

HSP 10 Score: 51.9878 bits (123), Expect = 3.380e-7
Identity = 39/141 (27.66%), Postives = 53/141 (37.59%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVH----TGQRFFKCDICDKEFFSAYQVRRHMNSH------------------TGMRYKCRICDKPFTCVYACTWHMRQH 1159
            C +CG+ +    SL+ HI L  KE        + L+       C  C   F     L RH  +H    +G R F C IC +EF     +R HM SH                  +G  ++C  C K F        H+R H
Sbjct:   60 CPDCGRTFSRIASLKAHIMLHEKE--------ENLM-------CTECGDEFTLQSQLERHMDMHRQELSGARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRIH 185          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001428.1 (pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1 gene:ENSPMAG00000001294.1 transcript:ENSPMAT00000001428.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 5.205e-13
Identity = 46/142 (32.39%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHI------CLRRKEVWKKGDV-PKELVD------GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K+ +C  CGK +     L+ H+         R  V +KG + P EL +      G+  + C  C K F+    L  H   HTG+R  KC +C+K+F     ++ HM +HTG R YKC +C+K F    +   HM+ H+ +
Sbjct:  196 GEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGE 337          

HSP 2 Score: 64.6994 bits (156), Expect = 1.508e-11
Identity = 36/108 (33.33%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  800 RCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGM-RYKCRICDKPF 1120
            RC  CGK +   + L+ H+      +   G+ P +         CP C K F  +  L  H  +HTG++  KC +C K F  + Q++RHM +HTG  R++C +C K F
Sbjct:  145 RCSVCGKGFSRSFVLKTHM------MTHTGERPHK---------CPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGF 237          

HSP 3 Score: 63.1586 bits (152), Expect = 5.135e-11
Identity = 36/129 (27.91%), Postives = 60/129 (46.51%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G +  +C  CGK ++   +L+ H+               +   G+  + C  C K F+    L  H   HTG+R +KC +C+K+F  +  ++ HM +H+G + YKC  C K F        HM+ H  +
Sbjct:  252 GERPHKCSVCGKAFKQYTALKSHM---------------KTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTHTGE 365          

HSP 4 Score: 56.225 bits (134), Expect = 8.206e-9
Identity = 38/130 (29.23%), Postives = 55/130 (42.31%), Query Frame = 2
Query:  782 DGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGM-RYKCRICDKPFTCVYACTWHMRQHNTD 1168
            +G K  RC  CGK +    +L  H  +   E                 + CP C K F     L  H  +H+G    KC +C KEF    Q++ HM +HTG   ++C +C K F+  +    HM  H  +
Sbjct:   55 NGEKPYRCSVCGKGFNRSSTLATHATIHATEK---------------PHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGE 169          

HSP 5 Score: 55.8398 bits (133), Expect = 9.127e-9
Identity = 35/107 (32.71%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            C  CGK +   ++L+ H+      V   GD P +         C  C K FR    L  H   HTG+   +C +C K F  ++ ++ HM +HTG R +KC +C K F
Sbjct:   90 CPVCGKGFSRPFALKCHV------VIHSGDCPHK---------CALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGF 181          

HSP 6 Score: 51.6026 bits (122), Expect = 2.409e-7
Identity = 24/64 (37.50%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            C  CSK F    +L  H   HTG++ +KC +C+  F +A  ++ HM+ H G + Y+C +C K F
Sbjct:    6 CSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGF 69          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000449.1 (pep scaffold:Pmarinus_7.0:GL478964:311851:312750:-1 gene:ENSPMAG00000000404.1 transcript:ENSPMAT00000000449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 3.319e-12
Identity = 38/121 (31.40%), Postives = 59/121 (48.76%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            C+ECGK +     L +H        W+       +  G+  Y C  C K F  + NL  H+  HTG++ ++C IC K F     +  H  +HTG + ++C++CDK F+ V     H R H+
Sbjct:  137 CKECGKAFSQVTQLNNH--------WR-------IHTGEKPYHCKMCDKAFSQVTNLNNHYRTHTGEKPYRCQICGKAFTQVTNLNNHYRTHTGEKPFRCKMCDKAFSQVANLNSHQRIHH 242          

HSP 2 Score: 65.0846 bits (157), Expect = 3.645e-12
Identity = 47/159 (29.56%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDV-------PKELVDGQLI------YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            +SY  + + ++ G  E+ R   RC +CG+ +        H C+ R+E      V        K L + Q I      + C  C K F  +  L  H+ +HTG++ + C +CDK F     +  H  +HTG + Y+C+IC K FT V     H R H  +
Sbjct:   63 RSYLKNEQRIHRG--ENCR---RCEKCGEAFSKVTKRNSHQCIHRQETPHCCKVCNKVFSHAKHLNNHQHIHMRDKPFICKECGKAFSQVTQLNNHWRIHTGEKPYHCKMCDKAFSQVTNLNNHYRTHTGEKPYRCQICGKAFTQVTNLNNHYRTHTGE 216          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 5.223e-12
Identity = 26/67 (38.81%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            + CP C K F    +L  H   HTG++ FKC +C+K F  +  +++H  +HTG + +KC +C+K FT
Sbjct:   32 FRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFT 98          

HSP 2 Score: 48.521 bits (114), Expect = 1.303e-7
Identity = 27/86 (31.40%), Postives = 42/86 (48.84%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G+  + C  C K F     LT H   HT  + F+C +C K F  +  ++ H  +HTG + +KC +C+K F+       H R H  +
Sbjct:    2 GEKPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGE 85          

HSP 3 Score: 48.521 bits (114), Expect = 1.522e-7
Identity = 27/93 (29.03%), Postives = 40/93 (43.01%), Query Frame = 2
Query:  791 KMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHM 1069
            K  RC  CGK +     L+ H               +    G+  + C  C K F    NL +H   HTG++ FKC +C+K F  +  +R+H 
Sbjct:   30 KPFRCPLCGKAFAKSSDLQSH---------------QRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKHQ 107          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003937.1 (pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gene:ENSPMAG00000003606.1 transcript:ENSPMAT00000003937.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.044e-11
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  896 PKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            P +  +G+ IY C  C K F  + NL  H  +H+G+R FKC  C K F     +++H   HTG + Y+C++C + F+       H+R H+ +
Sbjct:    5 PLKKQNGKTIYECNICGKTFGQLSNLKVHLRIHSGERPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQVCCRRFSSTSNLKTHLRLHSGE 96          

HSP 2 Score: 61.6178 bits (148), Expect = 2.881e-11
Identity = 33/128 (25.78%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  779 EDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            ++G+ +  C  CGK +    +L+ H+                +  G+  + C TC K F  + +L +H  VHTG++ ++C +C + F S   ++ H+  H+G + ++C++C   FT       H R H
Sbjct:    9 QNGKTIYECNICGKTFGQLSNLKVHL---------------RIHSGERPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQVCCRRFSSTSNLKTHLRLHSGEKPFQCKLCPAKFTQFIHLKLHRRLH 121          

HSP 3 Score: 45.8246 bits (107), Expect = 6.815e-6
Identity = 29/124 (23.39%), Postives = 54/124 (43.55%), Query Frame = 2
Query:  782 DGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHM 1150
             G +  +C+ CGK +     L H   L++  +   G+ P         Y C  C + F    NL  H  +H+G++ F+C +C  +F     ++ H   H   R ++C  C + +    + + H+
Sbjct:   38 SGERPFKCQTCGKGFTQ---LAH---LQKHHLVHTGEKP---------YQCQVCCRRFSSTSNLKTHLRLHSGEKPFQCKLCPAKFTQFIHLKLHRRLHARERPHRCADCQRSYIHQISLSLHL 146          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 54.6842 bits (130), Expect = 2.635e-8
Identity = 28/77 (36.36%), Postives = 35/77 (45.45%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            CP C + F    +L  H   H G + F CD C K F     +R H   HTG + Y C ICDK F+       H+  H
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTH 671          

HSP 2 Score: 53.9138 bits (128), Expect = 3.916e-8
Identity = 27/89 (30.34%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRI--CDKPFTCVYACTWHMRQHNTDSSNPI 1183
            + C  C K F   GNL  H  +HTG++ + CDICDK+F     +  H+ +H  ++ + C++  C+K FT +     H  + + ++ N +
Sbjct:  621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNAL 709          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 54.6842 bits (130), Expect = 2.674e-8
Identity = 26/79 (32.91%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            Y C TC + F     L +H   H+G++ +KC IC+K+F  +  ++ H+ +HTG +  +C+IC K F      + H++ H
Sbjct:  768 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH 846          

HSP 2 Score: 50.447 bits (119), Expect = 4.628e-7
Identity = 29/88 (32.95%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  905 LVDGQLIYFC--PTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            L  G+  Y C    C + F     L RH  VH+  + +KC  C + F S   + +H  +H+G + YKC IC+K F    +   H+R H
Sbjct:  731 LTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTH 818          

HSP 3 Score: 50.0618 bits (118), Expect = 6.995e-7
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPF 1120
            G+  Y C  C+K F    +L  H   HTG++  +C IC K F  +  + +H+ +H   +YKC  C K F
Sbjct:  792 GEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQK-KYKCSDCSKSF 859          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 48.521 bits (114), Expect = 2.031e-6
Identity = 28/71 (39.44%), Postives = 36/71 (50.70%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTG-MRYKC--RICD-KPFTC 1126
            + C  C K F    NL  H   HT +R F C IC K F   +  +RH + HTG  RY C  ++ D KP+ C
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGC 639          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO47692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH7])

HSP 1 Score: 68.9366 bits (167), Expect = 3.244e-14
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            Y C  C K F    NLT HF +H+G++ F+C +C ++F  +  V  HM +H G R YKC++C+K F      T H+R H  +
Sbjct:   22 YQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGE 103          

HSP 2 Score: 54.299 bits (129), Expect = 4.027e-9
Identity = 27/85 (31.76%), Postives = 45/85 (52.94%), Query Frame = 2
Query:  911 DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
             G+  + C  C + F    ++T H   H G+R +KC +C+K F  +  + +H+ +HTG + Y+C IC + F+       H R HN
Sbjct:   45 SGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIHN 129          

HSP 3 Score: 46.9802 bits (110), Expect = 1.398e-6
Identity = 22/70 (31.43%), Postives = 38/70 (54.29%), Query Frame = 2
Query:  962 MGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            +  L  H   H+G + ++C +C K F  A  +  H   H+G + ++CR+C + F+   + T HMR HN +
Sbjct:    6 LSTLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGE 75          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 68.1662 bits (165), Expect = 1.629e-13
Identity = 40/121 (33.06%), Postives = 59/121 (48.76%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRR-KEVWKKGDVPKELV------------DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            C+ C K +   ++ + H+ +   ++ +K    PK                G+  Y C  CS+ F  + NL RH   HTG++  KC  C K F S+  +RRH+  HTG R YKC+ C K FT
Sbjct:    6 CQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFT 126          

HSP 2 Score: 53.5286 bits (127), Expect = 1.758e-8
Identity = 31/100 (31.00%), Postives = 45/100 (45.00%), Query Frame = 2
Query:  779 EDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSH 1078
              G K  +C  C K + +   LR H+                +  G+  Y C  CSK F   GNL  H   HTG++ +KC IC+ +F S+  +R H+  H
Sbjct:   82 HTGEKPHKCTYCPKAFVSSSDLRRHV---------------RIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIRIH 166          

HSP 3 Score: 53.1434 bits (126), Expect = 2.048e-8
Identity = 38/128 (29.69%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  779 EDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
              G K   C  C + +    +L+ HI      +   G+ P +         C  C K F    +L RH  +HTG+R +KC  C K F ++  ++ H+ +HTG + YKC IC+  F        H+R H
Sbjct:   54 HTGEKPYTCNICSRGFAQLTNLQRHI------LTHTGEKPHK---------CTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIRIH 166          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO47736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLR3])

HSP 1 Score: 66.6254 bits (161), Expect = 2.617e-13
Identity = 44/122 (36.07%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHHICLRRKEVWKKGDV---------PKELV------DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            C  CGK + N  +L  H+  RR    +  D          P E         G   Y CP C K FR+ G+L +H  +HTGQR ++C+ C K F +   +R+H   HTG R YKC ICD+ +
Sbjct:    1 CSFCGKSFGNPRALELHV--RRHSGHRPYDCQFCSKSFFQPSERAVHMRTHTGARPYRCPYCLKLFRYSGDLKQHINIHTGQRPYQCESCSKAFTNHSTLRQHRRIHTGERPYKCEICDRTY 120          

HSP 2 Score: 54.6842 bits (130), Expect = 3.866e-9
Identity = 35/116 (30.17%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHT 1081
            KS+F  S    +     G +  RC  C K +R    L+ HI                +  GQ  Y C +CSK F     L +H  +HTG+R +KC+ICD+ +     +++H+ +HT
Sbjct:   34 KSFFQPSERAVHMRTHTGARPYRCPYCLKLFRYSGDLKQHI---------------NIHTGQRPYQCESCSKAFTNHSTLRQHRRIHTGERPYKCEICDRTYRYHSSLKQHLATHT 134          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO33340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSH6])

HSP 1 Score: 70.8626 bits (172), Expect = 2.779e-13
Identity = 43/142 (30.28%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  788 RKMLRCRECGKHYRNDYSLRHH-------------ICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            +K L C EC K +  + +LR H             +C +R       +V +++   +  Y C  C K F+   +L RH  +H G + FKC+ CD  FF+A+++++H   HTG + Y C  C+K F+   + + HM++H  D+
Sbjct:  126 KKPLECTECDKSFVQESALRVHMMRHDGVKPFSCPLCTQRFVNQSALNVHQKVHSEERPYKCEVCMKAFKCSTHLIRHGKIHVGNKPFKCNDCDAAFFAAHELKKHSRRHTGEKPYACVNCNKAFSSSSSLSLHMKRHAGDT 267          

HSP 2 Score: 61.6178 bits (148), Expect = 2.374e-10
Identity = 34/86 (39.53%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G+  Y C  C K F    NL RH   HT ++ ++C  CDK+F      +RH   HTG + Y C+IC K FT     T HM+QH+ +
Sbjct:   13 GEKPYICHYCGKAFAQTSNLARHTRSHTNEKPYECRYCDKQFADFSSRKRHEWQHTGEKPYSCKICGKGFTNPGNVTSHMKQHSDE 98          

HSP 3 Score: 53.9138 bits (128), Expect = 8.898e-8
Identity = 27/64 (42.19%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  932 CPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            C  C KPF    +L  H   HTG++ F C IC K   +   ++RH+  HTG R YKC+IC + F
Sbjct:  300 CQLCGKPFLHSCSLEVHMRSHTGEKEFICKICGKASTTRDALKRHLRIHTGERPYKCKICKRAF 363          

HSP 4 Score: 47.7506 bits (112), Expect = 6.523e-6
Identity = 34/129 (26.36%), Postives = 57/129 (44.19%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K   C+ CGK + N  ++  H+   ++   +KG            Y C  C + F+    L  H +VH  ++  +C  CDK F     +R HM  H G++ + C +C + F    A   H + H+ +
Sbjct:   69 GEKPYSCKICGKGFTNPGNVTSHM---KQHSDEKG------------YKCVECGRAFKLSTTLKTHMWVHKEKKPLECTECDKSFVQESALRVHMMRHDGVKPFSCPLCTQRFVNQSALNVHQKVHSEE 182          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO43181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ74])

HSP 1 Score: 66.2402 bits (160), Expect = 3.081e-13
Identity = 31/84 (36.90%), Postives = 47/84 (55.95%), Query Frame = 2
Query:  914 GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            G+  + CP C +PF     L  H  VHTGQ+ +KC++C++ F  +  V+ HM +HTG + ++C IC+K F        H R H 
Sbjct:   18 GEKPFKCPICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHERTHT 101          

HSP 2 Score: 58.151 bits (139), Expect = 2.542e-10
Identity = 35/125 (28.00%), Postives = 55/125 (44.00%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQ 1156
            G K  +C  CG+ +     L  H               K +  GQ  Y C  C + F     +  H   HTG++ F+C IC+K+F     V++H  +HTG++ + C  C   FT +     H+R+
Sbjct:   18 GEKPFKCPICGRPFAQSSGLESH---------------KRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHERTHTGIKPFTCPECGLKFTQIGNMNKHLRK 127          

HSP 3 Score: 52.373 bits (124), Expect = 2.388e-8
Identity = 26/68 (38.24%), Postives = 37/68 (54.41%), Query Frame = 2
Query:  968 NLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
             L  H  VHTG++ FKC IC + F  +  +  H   HTG + YKC +C++ F+   A   HMR H  +
Sbjct:    8 TLKTHQRVHTGEKPFKCPICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHTGE 75          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000008809.2 (pep primary_assembly:ASM223467v1:17:10987430:10993813:-1 gene:ENSORLG00000007009.2 transcript:ENSORLT00000008809.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 8.280e-17
Identity = 49/159 (30.82%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHH-------------ICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K++  +S   ++     G K   C +CGK +    SL+ H             IC +        ++ ++   G+ +YFC TC K F    +LT H   HTG+R F C+ C K F  ++ ++ HM +HTG R + C ICD+ FTC      H+R H  +
Sbjct:  167 KAFTQNSTLQHHMRTHTGEKPFSCEQCGKRFIKSGSLKVHMKSHTDERPFFCEICGKSFNRNASLNIHRKSHTGEKLYFCKTCGKRFFTSSSLTVHMKTHTGERPFSCETCGKSFNLSWSLKAHMRTHTGERPFSCIICDRSFTCSSTLKAHVRTHTGE 325          

HSP 2 Score: 65.4698 bits (158), Expect = 4.961e-11
Identity = 39/129 (30.23%), Postives = 60/129 (46.51%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K+  C+ CGK +    SL  H+               +   G+  + C TC K F    +L  H   HTG+R F C ICD+ F  +  ++ H+ +HTG R + C++C K F    +   H+R H  +
Sbjct:  240 GEKLYFCKTCGKRFFTSSSLTVHM---------------KTHTGERPFSCETCGKSFNLSWSLKAHMRTHTGERPFSCIICDRSFTCSSTLKAHVRTHTGERPFTCKMCGKGFKRNASLEAHVRTHTGE 353          

HSP 3 Score: 62.3882 bits (150), Expect = 4.948e-10
Identity = 40/121 (33.06%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  809 ECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            EC + ++N YS    IC +   V  +  V      G+  + C  C K F+  G+L  H   HTG++ F C+IC K       ++ HM +HTG R + C IC K F    +   HMR H  +
Sbjct:   40 ECEEIFKN-YSCE--ICGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIHTGE 157          

HSP 4 Score: 58.5362 bits (140), Expect = 7.041e-9
Identity = 36/131 (27.48%), Postives = 53/131 (40.46%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFT 1123
            K +F  S    +     G +   C  CGK +   +SL+ H+                   G+  + C  C + F     L  H   HTG+R F C +C K F     +  H+ +HTG R + C +C K FT
Sbjct:  251 KRFFTSSSLTVHMKTHTGERPFSCETCGKSFNLSWSLKAHM---------------RTHTGERPFSCIICDRSFTCSSTLKAHVRTHTGERPFTCKMCGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFT 366          

HSP 5 Score: 58.5362 bits (140), Expect = 7.692e-9
Identity = 40/126 (31.75%), Postives = 54/126 (42.86%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKE------VWKKGDVPKELV-------DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            G K   C  CGK    + SL+ H+     E      +  KG V    +        G+  + C TC K F     L  H   HTG++ F C+ C K F  +  ++ HM SHT  R + C IC K F
Sbjct:  100 GEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCEQCGKRFIKSGSLKVHMKSHTDERPFFCEICGKSF 225          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000032407.1 (pep primary_assembly:ASM223467v1:2:4309472:4312955:1 gene:ENSORLG00000023809.1 transcript:ENSORLT00000032407.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 5.864e-16
Identity = 42/126 (33.33%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K L C+EC K +R +++L+ H+                   G+  +FC  C K F    +L RH   HTG++ F C  CDK F   + +++HM +HTG + + C+ CDK F+C      HM+ H
Sbjct:  386 GEKPLFCKECDKRFRCNFNLQKHM---------------RTHTGEKPFFCKACDKSFSCSSHLKRHMRTHTGEKPFFCKECDKSFRCNFNLQKHMRTHTGEKPFFCKACDKSFSCSSHLKRHMKTH 496          

HSP 2 Score: 79.7221 bits (195), Expect = 1.544e-15
Identity = 44/126 (34.92%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K   C EC K +  +  L+ H+      +   G+ P          FC  C K FR   NL +H   HTG++ F C  CDK F  +  ++RHM +HTG + + C+ CDK F C +    HMR H
Sbjct:  358 GEKSFSCEECNKSFSCNTHLKSHM------ITHTGEKP---------LFCKECDKRFRCNFNLQKHMRTHTGEKPFFCKACDKSFSCSSHLKRHMRTHTGEKPFFCKECDKSFRCNFNLQKHMRTH 468          

HSP 3 Score: 75.485 bits (184), Expect = 3.524e-14
Identity = 41/126 (32.54%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K   C++C   +   YSL+ H+                   G+  + C  C K F  + +L RH   HTG++ F C+ CD+ F     V+RHM +HTG + Y C+ C K F+ +Y    HMR H
Sbjct:  218 GEKPFPCKDCDASFSRIYSLKTHM---------------RTHTGEKPFACEECDKGFSHISDLKRHMRSHTGEKSFACEECDQSFSQISDVKRHMRTHTGEKLYSCKECKKCFSEIYNLKTHMRTH 328          

HSP 4 Score: 70.8626 bits (172), Expect = 1.225e-12
Identity = 44/139 (31.65%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRR-------KEVWK----KGDVPKELVD--GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K+  C+EC K +   Y+L+ H+           KE  K    K D+ + +    G+  + C  C+K F    +L  H   HTG++   C  CDK F   + +++HM +HTG + + C+ CDK F+C      HMR H
Sbjct:  302 GEKLYSCKECKKCFSEIYNLKTHMRTHTGEKPFTCKECDKCFNTKSDLKRHIRTHTGEKSFSCEECNKSFSCNTHLKSHMITHTGEKPLFCKECDKRFRCNFNLQKHMRTHTGEKPFFCKACDKSFSCSSHLKRHMRTH 440          

HSP 5 Score: 65.855 bits (159), Expect = 4.390e-11
Identity = 42/139 (30.22%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHI----------CLRRKEVWKK-GDVPKELVD--GQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            G K   C EC K + +   L+ H+          C    + + +  DV + +    G+ +Y C  C K F  + NL  H   HTG++ F C  CDK F +   ++RH+ +HTG + + C  C+K F+C      HM  H
Sbjct:  246 GEKPFACEECDKGFSHISDLKRHMRSHTGEKSFACEECDQSFSQISDVKRHMRTHTGEKLYSCKECKKCFSEIYNLKTHMRTHTGEKPFTCKECDKCFNTKSDLKRHIRTHTGEKSFSCEECNKSFSCNTHLKSHMITH 384          

HSP 6 Score: 63.1586 bits (152), Expect = 2.843e-10
Identity = 30/90 (33.33%), Postives = 45/90 (50.00%), Query Frame = 2
Query:  908 VDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSS 1174
             + +  Y C  C K F ++  +  H   HTG++ F C  CD  F   Y ++ HM +HTG + + C  CDK F+ +     HMR H  + S
Sbjct:  188 TESERPYVCQECGKSFDYLYKVRDHMRTHTGEKPFPCKDCDASFSRIYSLKTHMRTHTGEKPFACEECDKGFSHISDLKRHMRSHTGEKS 277          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000046977.1 (zinc finger protein 782-like [Source:NCBI gene;Acc:105355363])

HSP 1 Score: 79.7221 bits (195), Expect = 1.055e-15
Identity = 39/106 (36.79%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  869 KEVWKKGDVPKELV-----DGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            + V + G+ P  LV       +  Y C  C K F  + NL RH   HTG++ F C ICD  F     ++RH+ +HTG + + C++CD  F+CV     HMR H  D
Sbjct:   93 ESVKRTGNAPSVLVHMGTESDKRPYVCEECGKGFTCISNLKRHMTTHTGEKPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGD 198          

HSP 2 Score: 73.559 bits (179), Expect = 8.868e-14
Identity = 41/129 (31.78%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G K   C+ C   +    +L+ H+          GD P         + C  C   F  M +L  H   HTG+R F C ICD  F     ++RH+ +HTG + + C++CD  F+CV     HMR H  D
Sbjct:  169 GEKPFSCKVCDTSFSCVSNLKTHM------RTHTGDKP---------FSCKVCGTGFSQMSSLNAHIRTHTGERPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGD 282          

HSP 3 Score: 62.003 bits (149), Expect = 5.767e-10
Identity = 39/130 (30.00%), Postives = 55/130 (42.31%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            G K   C+ C   +    +L+ H+          GD P         + C  C   F  M +L  H   HTG+R F C ICD  F     +  HM +HTG R + C++C K F+   +   H R H  +S
Sbjct:  253 GEKPFSCKVCDTSFSCVSNLKTHM------RTHTGDKP---------FSCKVCGTGFSQMSSLNAHIRTHTGERPFSCKICDTSFSQKSILDSHMRTHTGDRPFSCKVCKKSFSQKSSLNAHRRTHTGES 367          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000040261.1 (pep primary_assembly:ASM223467v1:17:10987144:10993813:-1 gene:ENSORLG00000007009.2 transcript:ENSORLT00000040261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.068e-15
Identity = 45/134 (33.58%), Postives = 66/134 (49.25%), Query Frame = 2
Query:  803 CRECGKHYRNDYSLRHH-------------ICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            C +CGK +    SL+ H             IC +        ++ ++   G+ +YFC TC K F    +LT H   HTG+R F C+ C K F  ++ ++ HM +HTG R + C ICD+ FTC      H+R H 
Sbjct:  149 CEQCGKRFIKSGSLKVHMKSHTDERPFFCEICGKSFNRNASLNIHRKSHTGEKLYFCKTCGKRFFTSSSLTVHMKTHTGERPFSCETCGKSFNLSWSLKAHMRTHTGERPFSCIICDRSFTCSSTLKAHVRTHT 282          

HSP 2 Score: 65.4698 bits (158), Expect = 3.931e-11
Identity = 39/127 (30.71%), Postives = 59/127 (46.46%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHN 1162
            G K+  C+ CGK +    SL  H+               +   G+  + C TC K F    +L  H   HTG+R F C ICD+ F  +  ++ H+ +HTG R + C++C K F    +   H+R H 
Sbjct:  199 GEKLYFCKTCGKRFFTSSSLTVHM---------------KTHTGERPFSCETCGKSFNLSWSLKAHMRTHTGERPFSCIICDRSFTCSSTLKAHVRTHTGERPFTCKMCGKGFKRNASLEAHVRTHT 310          

HSP 3 Score: 64.3142 bits (155), Expect = 7.934e-11
Identity = 42/147 (28.57%), Postives = 59/147 (40.14%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDS 1171
            K +F  S    +     G +   C  CGK +   +SL+ H+                   G+  + C  C + F     L  H   HTG+R F C +C K F     +  H+ +HTG R + C +C K FT     T HMR H   S
Sbjct:  210 KRFFTSSSLTVHMKTHTGERPFSCETCGKSFNLSWSLKAHM---------------RTHTGERPFSCIICDRSFTCSSTLKAHVRTHTGERPFTCKMCGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAHMRTHTEKS 341          

HSP 4 Score: 59.6918 bits (143), Expect = 2.401e-9
Identity = 39/130 (30.00%), Postives = 55/130 (42.31%), Query Frame = 2
Query:  734 KSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPF 1120
            K +   SR   +     G +   C+ CGK +++  SL+ H                    G+  Y C  C K F    +LT H   HT +R F C+ C K F  +  ++ HM SHT  R + C IC K F
Sbjct:   70 KDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHT---------------RTHTGEKPYSCTLCGKSFSRNDSLTSHVKTHTSERPFSCEQCGKRFIKSGSLKVHMKSHTDERPFFCEICGKSF 184          

HSP 5 Score: 55.8398 bits (133), Expect = 5.038e-8
Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 2
Query:  926 YFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            Y C  C K F     LT H   HTG+R F C +C K F  +  ++ H  +HTG + Y C +C K F+   + T H++ H ++
Sbjct:   63 YSCEICGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPYSCTLCGKSFSRNDSLTSHVKTHTSE 144          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000038008.1 (zinc finger protein 782-like [Source:NCBI gene;Acc:105355363])

HSP 1 Score: 77.7962 bits (190), Expect = 2.295e-15
Identity = 42/138 (30.43%), Postives = 64/138 (46.38%), Query Frame = 2
Query:  758 AVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
             + + G E  ++   C ECGK +    +L+ H+          G+ P         + C  C   F  + +L  H   HTG+R F C ICD  F     ++RH+ +HTG + + C++CD  F+CV     HMR H  D
Sbjct:   89 VLVHMGTESDKRPYVCEECGKGFTCISNLKRHM------TTHTGEKP---------FPCDVCGIGFSQISSLNAHKRTHTGERPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGD 211          

HSP 2 Score: 67.0106 bits (162), Expect = 6.973e-12
Identity = 37/131 (28.24%), Postives = 56/131 (42.75%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQ--VRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            G +   C+ C   +    SL+ HI                   G+  + C  C   F  + NL  H   HTG + F C +C   F    +  ++RH+ +HTG + + C++CD  F+CV     HMR H  D
Sbjct:  154 GERPFSCKICDTSFSIKSSLKRHI---------------RTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGDKPFSCKVCGTGFSQIIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGD 269          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000075102.1 (SMESG000075102.1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 402/402 (100.00%), Postives = 402/402 (100.00%), Query Frame = 2
Query:  137 MTDRTSLAKRLIKDLVIPKPDNIGLTGREKLPDSEISSDGYVIVSFSNRKKAQIQTATFSDVSKNSSEAMNILKNQSNVINHISKGDDQNMPDEDNFYGEAFWIGXXXXXXXXXXXXTKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNNDNESVNSHTHPPKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSSNPIXXXXXXXXXXXXXXXXXXXXXKMXXXXXXXXXXXXXXXXKKPISSKPDITEKN 1342
            MTDRTSLAKRLIKDLVIPKPDNIGLTGREKLPDSEISSDGYVIVSFSNRKKAQIQTATFSDVSKNSSEAMNILKNQSNVINHISKGDDQNMPDEDNFYGEAFWIGSEDEEEPELSDETKAITGGSGTGGNNGFNNNSMTSITNTTTTTTESDKSSQNNDNESVNSHTHPPKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSSNPISDSVLSIPITSSSSSSDTLASKMIISVPSNNNNISTVSNKKPISSKPDITEKN
Sbjct:    1 MTDRTSLAKRLIKDLVIPKPDNIGLTGREKLPDSEISSDGYVIVSFSNRKKAQIQTATFSDVSKNSSEAMNILKNQSNVINHISKGDDQNMPDEDNFYGEAFWIGSEDEEEPELSDETKAITGGSGTGGNNGFNNNSMTSITNTTTTTTESDKSSQNNDNESVNSHTHPPKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSSNPISDSVLSIPITSSSSSSDTLASKMIISVPSNNNNISTVSNKKPISSKPDITEKN 402          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000042630.1 (SMESG000042630.1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.161e-12
Identity = 43/148 (29.05%), Postives = 63/148 (42.57%), Query Frame = 2
Query:  734 KSYFGDSRA--VYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            K YF +S    V+      GR+   C  C K + +  SL  H     +E                 + CP C K F+    L+ H  +HTG R F C  C K F     +++H  +HTG + YKC +C K F+       H R+H+ +
Sbjct:  140 KKYFPNSHGLEVHVRRSHSGRRPYECDICPKSFGHSVSLSQHRVTHTQEKQ---------------FQCPQCGKRFKRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEKPYKCVVCGKAFSQSSNLITHSRKHSGE 272          

HSP 2 Score: 57.7658 bits (138), Expect = 8.317e-9
Identity = 35/129 (27.13%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  791 KMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMR-QHNTDS 1171
            K  +C +CGK ++   +L  H+ +                 G   + CP CSK F    ++ +H Y HTG++ +KC +C K F  +  +  H   H+G + + C  C + F        H++ QH  DS
Sbjct:  189 KQFQCPQCGKRFKRSSTLSTHLLIH---------------TGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEKPYKCVVCGKAFSQSSNLITHSRKHSGEKPFWCHKCSRGFQRNVDLRRHIQSQHGDDS 302          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.117e-11
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  800 RCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQH 1159
            +C  CG+ Y    +L+ H+                   G+  + C  CSK F  + NLT H  +H+G++ F C IC + F  +  V  HM +H+G R Y+C  C K F+     T H R H
Sbjct:  318 QCHLCGRSYARPSTLKIHM---------------RTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVH 423          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.521e-11
Identity = 49/186 (26.34%), Postives = 75/186 (40.32%), Query Frame = 2
Query:  629 SHTHPPKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRA-----VYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            S T P  P  S   A++K +L      I  S    K  F + +       Y     DG+    C  C K +    +L+ H               +    G+  + C TC K F  + +L +H  VHTG++  +C +C K F S   ++ HM  H G + +KC  C   FT +     H+R H  +
Sbjct:  329 SKTEPIYPHSSISQAVTKSILNENNRDIILSK---KQIFSNEKINGHHLSYTLIKTDGKSKYNCSVCKKIFGQLSNLKVH---------------QRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNE 496          

HSP 2 Score: 53.9138 bits (128), Expect = 1.856e-7
Identity = 37/131 (28.24%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            G +   C+ CGK +     L H   L++  +   G+ P E         C  CSK F    NL  H  +H G++ FKC+ C  +F     ++ H+  HT  R + C  C+K +  +      +R H ++SS
Sbjct:  411 GERPFVCQTCGKGFTQ---LAH---LQKHNLVHTGEKPHE---------CSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISG----IRTHWSNSS 522          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 64.6994 bits (156), Expect = 9.487e-11
Identity = 49/186 (26.34%), Postives = 75/186 (40.32%), Query Frame = 2
Query:  629 SHTHPPKPKMSRLTALSKGLLTTELNAIKKSAGKHKSYFGDSRA-----VYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTD 1168
            S T P  P  S   A++K +L      I  S    K  F + +       Y     DG+    C  C K +    +L+ H               +    G+  + C TC K F  + +L +H  VHTG++  +C +C K F S   ++ HM  H G + +KC  C   FT +     H+R H  +
Sbjct:  302 SKTEPIYPHSSISQAVTKSILNENNRDIILSK---KQIFSNEKINGHHLSYTLIKTDGKSKYNCSVCKKIFGQLSNLKVH---------------QRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNE 469          

HSP 2 Score: 53.9138 bits (128), Expect = 2.167e-7
Identity = 37/131 (28.24%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  785 GRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKKGDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKEFFSAYQVRRHMNSHTGMR-YKCRICDKPFTCVYACTWHMRQHNTDSS 1174
            G +   C+ CGK +     L H   L++  +   G+ P E         C  CSK F    NL  H  +H G++ FKC+ C  +F     ++ H+  HT  R + C  C+K +  +      +R H ++SS
Sbjct:  384 GERPFVCQTCGKGFTQ---LAH---LQKHNLVHTGEKPHE---------CSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISG----IRTHWSNSS 495          
The following BLAST results are available for this feature:
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF8781.145e-1633.77zinc finger protein 878 [Source:HGNC Symbol;Acc:HG... [more]
ZFP372.141e-1530.61ZFP37 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZFP372.252e-1530.61ZFP37 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZFP372.499e-1530.61ZFP37 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZNF2271.324e-1432.87zinc finger protein 227 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
blmp-18.882e-1442.35B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-11.037e-1342.35B lymphocyte-induced maturation protein 1 homolog ... [more]
che-12.017e-1230.65Transcription factor che-1 [Source:UniProtKB/Swis... [more]
che-12.024e-1230.65Transcription factor che-1 [Source:UniProtKB/Swis... [more]
Y55F3AM.144.074e-1029.53pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gl9.384e-1732.76gene:FBgn0004618 transcript:FBtr0083585[more]
gl1.149e-1632.76gene:FBgn0004618 transcript:FBtr0083584[more]
gl1.690e-1632.76gene:FBgn0004618 transcript:FBtr0330042[more]
Opbp3.339e-1433.85gene:FBgn0050443 transcript:FBtr0086109[more]
Aef14.323e-1327.53gene:FBgn0005694 transcript:FBtr0078348[more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf4086.511e-1735.48zinc finger protein 408 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:dkey-7i4.112.121e-1631.25si:dkey-7i4.11 [Source:ZFIN;Acc:ZDB-GENE-131120-10... [more]
si:dkey-77f5.134.405e-1634.11si:dkey-77f5.13 [Source:ZFIN;Acc:ZDB-GENE-131119-9... [more]
si:dkey-77f5.134.405e-1634.11si:dkey-77f5.13 [Source:ZFIN;Acc:ZDB-GENE-131119-9... [more]
si:dkey-77f5.134.405e-1634.11si:dkey-77f5.13 [Source:ZFIN;Acc:ZDB-GENE-131119-9... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046299.11.044e-1430.07zinc finger protein 628 [Source:NCBI gene;Acc:1004... [more]
ZBTB243.013e-1433.09zinc finger and BTB domain containing 24 [Source:N... [more]
txnip2.098e-1333.09thioredoxin interacting protein [Source:Xenbase;Ac... [more]
ENSXETT00000017443.13.346e-1333.57zinc finger protein 436-like [Source:NCBI gene;Acc... [more]
txnip3.848e-1334.96thioredoxin interacting protein [Source:Xenbase;Ac... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp116.319e-1434.97zinc finger protein 11 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp9488.791e-1434.92zinc finger protein 948 [Source:MGI Symbol;Acc:MGI... [more]
Zfp1418.963e-1433.10zinc finger protein 141 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6281.247e-1332.08zinc finger protein 628 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7902.080e-1328.72zinc finger protein 790 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|C9JN71|ZN878_HUMAN5.497e-1633.77Zinc finger protein 878 OS=Homo sapiens OX=9606 GN... [more]
sp|Q24732|GLAS_DROVI5.616e-1635.92Protein glass OS=Drosophila virilis OX=7244 GN=gl ... [more]
sp|P13360|GLAS_DROME1.152e-1532.76Protein glass OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q9Y6Q3|ZFP37_HUMAN1.200e-1430.61Zinc finger protein 37 homolog OS=Homo sapiens OX=... [more]
sp|O88553|ZFP37_RAT5.594e-1432.56Zinc finger protein 37 OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VGJ72.744e-7541.62Putative zinc finger protein OS=Schistosoma manson... [more]
A0A1S8X0U09.047e-7571.61Zinc finger, C2H2 type (Fragment) OS=Opisthorchis ... [more]
A0A0X3NM621.133e-7477.44Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183RLA41.264e-7441.33Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A0X3NIS11.340e-7477.44Zinc finger protein 90 OS=Schistocephalus solidus ... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf4081.627e-1633.87zinc finger protein 408 [Source:NCBI gene;Acc:1030... [more]
znf4082.059e-1634.71zinc finger protein 408 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000017686.25.475e-1430.82zinc finger protein 502-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000055951.16.434e-1430.82zinc finger protein 502-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000057905.11.076e-1328.77pep primary_assembly:Astyanax_mexicanus-2.0:10:340... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005225.11.463e-1428.67pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
ENSPMAT00000001428.15.205e-1332.39pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1... [more]
ENSPMAT00000000449.13.319e-1231.40pep scaffold:Pmarinus_7.0:GL478964:311851:312750:-... [more]
ENSPMAT00000007831.15.223e-1238.81pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000003937.11.044e-1133.70pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gen... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
AZF12.635e-836.36Zinc-finger transcription factor; involved in diau... [more]
ZAP12.674e-832.91Zinc-regulated transcription factor; binds to zinc... [more]
CRZ12.031e-639.44Transcription factor, activates transcription of s... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476923.244e-1439.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491161.629e-1333.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477362.617e-1336.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333402.779e-1330.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431813.081e-1336.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000008809.28.280e-1730.82pep primary_assembly:ASM223467v1:17:10987430:10993... [more]
ENSORLT00000032407.15.864e-1633.33pep primary_assembly:ASM223467v1:2:4309472:4312955... [more]
ENSORLT00000046977.11.055e-1536.79zinc finger protein 782-like [Source:NCBI gene;Acc... [more]
ENSORLT00000040261.11.068e-1533.58pep primary_assembly:ASM223467v1:17:10987144:10993... [more]
ENSORLT00000038008.12.295e-1530.43zinc finger protein 782-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075102.10.000e+0100.00SMESG000075102.1[more]
SMESG000042630.14.161e-1229.05SMESG000042630.1[more]
SMESG000000679.15.117e-1131.40SMESG000000679.1[more]
SMESG000005754.17.521e-1126.34SMESG000005754.1[more]
SMESG000005754.19.487e-1126.34SMESG000005754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002213 ID=SMED30002213|Name=Zinc finger, C2H2 type|organism=Schmidtea mediterranea sexual|type=transcript|length=1550bp
TTGAGGATTTGTTACTTAATTTGCTTGTTTAACTATTAACAAAAGAATTG
AATTTAGCGTGTGATTGTCAATTGATTTTTCAGATTTAAAAAGTCTATTC
ATGATACAAAATTTTTAGATATATTTACATTAACAGATGACAGACAGAAC
ATCGCTAGCAAAACGATTGATCAAAGACCTAGTGATTCCCAAACCAGACA
ATATAGGACTAACTGGTCGTGAAAAATTGCCAGATTCTGAAATATCATCA
GATGGTTACGTGATTGTGTCATTTAGTAATCGGAAAAAAGCACAGATACA
AACTGCAACGTTTTCAGATGTTTCGAAAAATTCATCGGAAGCAATGAATA
TTTTGAAAAACCAAAGCAATGTAATTAATCACATAAGTAAAGGTGATGAT
CAAAATATGCCAGATGAAGATAATTTCTATGGTGAAGCATTCTGGATTGG
ATCAGAAGACGAAGAAGAGCCAGAATTATCAGATGAAACGAAAGCAATCA
CCGGCGGAAGTGGAACAGGAGGAAATAACGGATTTAACAATAACAGTATG
ACATCAATAACCAATACAACGACTACTACAACTGAAAGCGATAAATCTAG
CCAGAACAACGACAACGAGTCTGTCAACAGTCACACACATCCGCCTAAAC
CTAAAATGTCGCGATTGACTGCATTATCAAAAGGTTTATTGACCACTGAA
TTAAACGCCATTAAGAAATCAGCTGGTAAACATAAAAGCTATTTCGGCGA
TAGCAGAGCTGTTTATTACGGCGGCGGCGAAGACGGGCGCAAAATGCTCC
GTTGCAGAGAGTGCGGCAAGCATTACCGCAACGATTACAGTCTCAGACAT
CACATTTGCTTGCGTCGGAAGGAAGTATGGAAAAAAGGCGACGTTCCAAA
GGAGCTCGTTGATGGGCAATTGATTTATTTCTGTCCGACTTGTTCGAAAC
CGTTCAGATGGATGGGAAATTTGACTCGTCATTTCTATGTGCACACTGGC
CAAAGATTTTTCAAGTGCGATATTTGTGACAAGGAATTTTTCTCAGCCTA
TCAAGTTCGCCGCCACATGAATTCGCACACCGGGATGCGTTACAAGTGCA
GGATTTGCGACAAACCGTTTACCTGTGTTTATGCGTGCACGTGGCACATG
CGACAACACAATACAGATTCAAGTAATCCAATTTCAGATTCGGTGCTCTC
CATTCCAATCACCTCATCGTCTTCATCCAGCGACACGTTGGCTTCCAAGA
TGATTATCTCCGTGCCTTCTAACAACAACAACATTTCCACAGTTTCTAAC
AAAAAACCTATTTCTTCAAAGCCAGATATCACGGAAAAAAATTGAAAAAT
CCGCGCCTTATTCGGATTGTACAGCGTCAATACTAATCAAGCAACTTATT
GCTTAAAATTTGTTGCTTATTCTTTCCATTAATATTTGCTCATTAACCTT
TATGTTTCATTATAGAAAATTTTAATATATTCTCACAAATTTGATTCGTG
TACATACGTTTTTTTTGTGTTGATTATTAATAAATAATTCTACTGAAAAA
back to top

protein sequence of SMED30002213-orf-1

>SMED30002213-orf-1 ID=SMED30002213-orf-1|Name=SMED30002213-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
MTDRTSLAKRLIKDLVIPKPDNIGLTGREKLPDSEISSDGYVIVSFSNRK
KAQIQTATFSDVSKNSSEAMNILKNQSNVINHISKGDDQNMPDEDNFYGE
AFWIGSEDEEEPELSDETKAITGGSGTGGNNGFNNNSMTSITNTTTTTTE
SDKSSQNNDNESVNSHTHPPKPKMSRLTALSKGLLTTELNAIKKSAGKHK
SYFGDSRAVYYGGGEDGRKMLRCRECGKHYRNDYSLRHHICLRRKEVWKK
GDVPKELVDGQLIYFCPTCSKPFRWMGNLTRHFYVHTGQRFFKCDICDKE
FFSAYQVRRHMNSHTGMRYKCRICDKPFTCVYACTWHMRQHNTDSSNPIS
DSVLSIPITSSSSSSDTLASKMIISVPSNNNNISTVSNKKPISSKPDITE
KN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 264..286
e-value: 0.008
score: 25.4
coord: 292..314
e-value: 5.0E-4
score: 29.4
coord: 319..341
e-value: 0.19
score: 20.8
coord: 221..241
e-value: 140.0
score: 3.3
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 266..286
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 294..314
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 321..341
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 264..291
score: 12.632
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 319..346
score: 9.473
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 292..319
score: 12.05
NoneNo IPR availablePFAMPF13894zf-C2H2_4coord: 292..314
e-value: 1.8E-4
score: 22.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 287..352
e-value: 5.8E-12
score: 47.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 198..286
e-value: 4.9E-8
score: 34.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 144..175
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 144..171
NoneNo IPR availablePANTHERPTHR24377:SF807coord: 217..347
NoneNo IPR availablePANTHERPTHR24377FAMILY NOT NAMEDcoord: 94..343
coord: 217..347
NoneNo IPR availablePANTHERPTHR24377:SF807coord: 94..343
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 263..314
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 301..343