Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30002175
Length (bp)647
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30002175) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30002175) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30002175) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30002175) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002175

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002175 SmedASXL_006601SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30002175 dd_Smed_v4_7131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002175 dd_Smed_v4_7131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30002175 dd_Smed_v6_7131_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002175 OX_Smed_1.0.01721ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 116.316 bits (290), Expect = 1.410e-31
Identity = 64/179 (35.75%), Postives = 95/179 (53.07%), Query Frame = 3
Query:   93 LEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAY---GDYQWVGQNVAMFSGQNIS--KGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCP-YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN*FFI 611
            +EAHN +R  V        PPAADM  +IW    A  A+  A++C F H+   D++Y     +++VG+N+ +   ++ +    +  W+NE   Y + + +CS + CGHYTQL+WA S  +GC VA CP     +    VCNY P GN  +  PY  G++CS C     C   LC   F+
Sbjct:   38 IEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRV-CGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFL 208          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 116.316 bits (290), Expect = 1.786e-31
Identity = 63/175 (36.00%), Postives = 93/175 (53.14%), Query Frame = 3
Query:   93 LEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAY---GDYQWVGQNVAMFSGQNIS--KGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCP-YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            +EAHN +R  V        PPAADM  +IW    A  A+  A++C F H+   D++Y     +++VG+N+ +   ++ +    +  W+NE   Y + + +CS + CGHYTQL+WA S  +GC VA CP     +    VCNY P GN  +  PY  G++CS C     C   LC 
Sbjct:   38 IEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRV-CGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCR 204          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 117.857 bits (294), Expect = 2.237e-30
Identity = 63/187 (33.69%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   60 GDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFS--GQNISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            G L +++K  ++E HN++R  V+       P A+DML + W  + A+ A+  A +C + H+    R        G+N+   +  G ++   +E W +E   Y+ +   CS G  CGHYTQ++WA ++ +GCG   C          I  LVCNY P GN   ++PYQ G  CS+CP G  C + LC 
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLCE 198          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 117.857 bits (294), Expect = 2.237e-30
Identity = 63/187 (33.69%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   60 GDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFS--GQNISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            G L +++K  ++E HN++R  V+       P A+DML + W  + A+ A+  A +C + H+    R        G+N+   +  G ++   +E W +E   Y+ +   CS G  CGHYTQ++WA ++ +GCG   C          I  LVCNY P GN   ++PYQ G  CS+CP G  C + LC 
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLCE 198          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 117.857 bits (294), Expect = 2.237e-30
Identity = 63/187 (33.69%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   60 GDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFS--GQNISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            G L +++K  ++E HN++R  V+       P A+DML + W  + A+ A+  A +C + H+    R        G+N+   +  G ++   +E W +E   Y+ +   CS G  CGHYTQ++WA ++ +GCG   C          I  LVCNY P GN   ++PYQ G  CS+CP G  C + LC 
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLCE 198          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 105.916 bits (263), Expect = 2.214e-26
Identity = 71/209 (33.97%), Postives = 99/209 (47.37%), Query Frame = 3
Query:   48 FVCYGDLLED-QKSQLLEAHNIFRQTVAKGLV------KSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQN------ISKGLELWFNEVTGYSYTTGAC--------SGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCS---KCPIGTAC--TDGLC 596
            F C   L+ D  ++  LE HN +R  +AKG         SQP A+ M+K+ +       AQ  A+ C F+H +  +R        GQN+ M S  N      I   +E W+ E+  +                G + GHYTQ+ W  +  LGCG+A+CP  SY    +VC+Y P GN  + K Y++GD C     CPIGT C  T  LC
Sbjct:  304 FQCDNSLVSDVTRNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPNQ-----GQNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCPKMSY----VVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDCEKTTSLC 503          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 105.531 bits (262), Expect = 2.220e-26
Identity = 71/209 (33.97%), Postives = 99/209 (47.37%), Query Frame = 3
Query:   48 FVCYGDLLED-QKSQLLEAHNIFRQTVAKGLV------KSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQN------ISKGLELWFNEVTGYSYTTGAC--------SGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCS---KCPIGTAC--TDGLC 596
            F C   L+ D  ++  LE HN +R  +AKG         SQP A+ M+K+ +       AQ  A+ C F+H +  +R        GQN+ M S  N      I   +E W+ E+  +                G + GHYTQ+ W  +  LGCG+A+CP  SY    +VC+Y P GN  + K Y++GD C     CPIGT C  T  LC
Sbjct:  270 FQCDNSLVSDVTRNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPNQ-----GQNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCPKMSY----VVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDCEKTTSLC 469          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 104.375 bits (259), Expect = 2.456e-26
Identity = 71/209 (33.97%), Postives = 99/209 (47.37%), Query Frame = 3
Query:   48 FVCYGDLLED-QKSQLLEAHNIFRQTVAKGLV------KSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQN------ISKGLELWFNEVTGYSYTTGAC--------SGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCS---KCPIGTAC--TDGLC 596
            F C   L+ D  ++  LE HN +R  +AKG         SQP A+ M+K+ +       AQ  A+ C F+H +  +R        GQN+ M S  N      I   +E W+ E+  +                G + GHYTQ+ W  +  LGCG+A+CP  SY    +VC+Y P GN  + K Y++GD C     CPIGT C  T  LC
Sbjct:  174 FQCDNSLVSDVTRNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPN-----QGQNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCPKMSY----VVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDCEKTTSLC 373          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 95.1301 bits (235), Expect = 4.259e-24
Identity = 63/211 (29.86%), Postives = 96/211 (45.50%), Query Frame = 3
Query:    3 MNNTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLV----KSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDY-QWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACS----GISCGHYTQLIWATSKELGCGVASCPYSS--YTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTAC--TDGLC 596
            M+ +IL +  + +     Y     + ++ +L  HN  R  +AKG       ++P A+DMLK+ W    A+ AQ  A+KC   H   +      Y  W    +     Q  + G   W  E   Y +++   S        GH TQ+ WA +  +GCGV +C   +  +  + +VC Y P GN  ++  Y  G  CSKCP GT+C    GLC
Sbjct:    1 MHTSILLLTALCAG---AYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAGLGENLYWYWTSATITNID-QFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLC 207          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 90.5077 bits (223), Expect = 2.872e-22
Identity = 64/213 (30.05%), Postives = 100/213 (46.95%), Query Frame = 3
Query:    3 MNNTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLV----KSQPPAADMLKLIWSTDSASKAQGLADKCAFSHD-SMSDRAYGDYQWVGQNVAMFSGQNI-SKGLELWFNEVTGYSYTTGAC------SGISCGHYTQLIWATSKELGCGVASCPYSSY-TILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTAC--TDGLC 596
            MN     I +++ +      +  E  K+ +L  HN  R  +A G       ++P A++M+KLIW T   + AQ  +  C   H  S ++     Y W    V     + + ++   LW +E   + +           SGI  GH TQ+ WAT+ ++GCG++ C   S+ T   +VC Y+P GN      Y+ G+ CS CP GT C  + GLC
Sbjct:    1 MNCYFRLICLLIFSFCETLCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRANIGENMYWWTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGI--GHATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESSTGLC 211          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 109.768 bits (273), Expect = 4.506e-28
Identity = 67/197 (34.01%), Postives = 100/197 (50.76%), Query Frame = 3
Query:   15 ILAIVIILS--NLFVCYGDLLE-----DQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMF--------SGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGD-NCS 557
            +L  ++I+S    F C G ++      +++S +L+ HN  RQ VA G    QP A +M +++W  + A++AQ  AD C F HD    R    +  +GQN+A+            +    ++ WFNEV  YS+  G       GHY+QL+W  +  +GCG A    +S      VCNY PGGN     PY+VG  +CS
Sbjct:    8 LLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDP--HRTINRFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF--GDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 62.003 bits (149), Expect = 3.526e-11
Identity = 52/183 (28.42%), Postives = 77/183 (42.08%), Query Frame = 3
Query:   63 DLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMF--------SGQNISKGLELWFNEVTGYSYT-----TGACSGISCGHYTQLIWATSKELGC-GVASC-PYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCP 566
            ++ E ++  LL+ HN+ R  +A G +     AA M  L W T+    A   A +C F+HD    R    +++ GQN+  F          + +   +  WF E    + +          G   GH+T L+      +GC GV    P S+     L CNY    N  +E  YQ G   SKCP
Sbjct:   90 EMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC--RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 59.6918 bits (143), Expect = 1.338e-10
Identity = 46/172 (26.74%), Postives = 75/172 (43.60%), Query Frame = 3
Query:   90 LLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLEL------WFNE----VTGYSYTTGACSGISCGHYTQLIWATSKELGCGVAS-CPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIG 572
            +L+ HN  R  +A G V   P A  M  + W T  A  A   A +C  +HD    R    Y++ GQN+++   +++   + L      WF+E     +G         G + GH+T ++   +  +GC +A     ++     L CNYA   N  +   Y+ G   S+C  G
Sbjct:   64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC--RNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAV-TNVVNNPVYRAGTAASECTTG 232          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 57.7658 bits (138), Expect = 2.763e-10
Identity = 32/95 (33.68%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  237 HDSMSDRAYGDYQWVGQNVAMFSGQNISKGL--ELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGN 515
             ++M+ R    Y   G+N+ +  G +++  L  E+W+ E+  Y +   A    + GH+TQLIW +S E+G GVA     ++    +VCNY P GN
Sbjct:   71 QNTMAHRPNPKY---GENIFLSGGMDVTGDLPVEMWYREINSYDFNK-AQFVPTAGHFTQLIWKSSVEMGSGVARKADRTW----VVCNYNPPGN 157          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 57.3806 bits (137), Expect = 1.031e-9
Identity = 50/184 (27.17%), Postives = 75/184 (40.76%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQN-------ISKGLELWFNEV--TGYSYTTGACS---GISCGHYTQLIWATSKELGCGVASCPYS--SYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGT 575
            L   +K  L+   N +R  +A GL  +   A  M  + W+ + A  A      C   HD   +     + W GQN+A     N       +  G+++W++E   T  +Y     S   G + GH+T L+   + E+GC  A+   S  SY    L CNYA       +         SKC  GT
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: CABZ01068499.1 (cysteine-rich venom protein natrin-1-like [Source:NCBI gene;Acc:100536500])

HSP 1 Score: 107.071 bits (266), Expect = 2.227e-28
Identity = 62/177 (35.03%), Postives = 95/177 (53.67%), Query Frame = 3
Query:   69 LEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSG-QNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            L   + ++++ HN FR+ V       QP A++MLK+ WS   A  A+G  +KC  +H   S R    Y+ +G+N+   +G  + +  ++ W +EV  Y Y  G+ +G + GHYTQ++W +S E+GC V  C  S+Y   F  C+Y   GN     PY +G  C+ CP    C D LC
Sbjct:    5 LSSVQQEIVDVHNAFRRAV-------QPSASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYE-MGENLFKATGISSWTSVVDAWHSEVNNYKYPIGSINGQATGHYTQVVWYSSYEVGCAVTQCG-SNY---FYGCHYYRAGNFRTVPPYSLGSPCASCP--NNCEDNLC 167          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 105.145 bits (261), Expect = 7.112e-26
Identity = 66/195 (33.85%), Postives = 94/195 (48.21%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDS----MSDRAYGDYQWVGQNVAMFSGQNISKG--LELWFNEVTGYSYT---------TGACSGISCGHYTQLIWATSKELGCGVASCPYSSY------TILFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLC 596
            + ++L+ HN  R  V        P A++M  +IW  +    A   A++C + H      MS         +GQN+A+  G+  S    ++ W++EV  Y+Y             CSG  C HYTQL+WAT+  +GC V  CP  +         ++LVCNY+P GN   E PYQ G  CS+CP   G  C D LC
Sbjct:   65 REEILKLHNKLRGEV-------YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLLMS---------IGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC 243          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 100.138 bits (248), Expect = 1.987e-25
Identity = 63/183 (34.43%), Postives = 93/183 (50.82%), Query Frame = 3
Query:   90 LLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILF---------LVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLCN 599
            LL+ HN  R  V        PPAA+M  ++W    A  A+  A +C + H       +   Q +GQN+++ SG+  +I   ++ W++E   +SY +  CSG  C HYTQ++WA S ++GC +  C   S   +F         LVCNYA  GN   E PY++G  CS CP   G +C    C+
Sbjct:   69 LLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHG-----PHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPS-RCSGSVCTHYTQMVWAASNKIGCAIKKC---SDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQCD 235          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 100.138 bits (248), Expect = 1.987e-25
Identity = 63/183 (34.43%), Postives = 93/183 (50.82%), Query Frame = 3
Query:   90 LLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILF---------LVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLCN 599
            LL+ HN  R  V        PPAA+M  ++W    A  A+  A +C + H       +   Q +GQN+++ SG+  +I   ++ W++E   +SY +  CSG  C HYTQ++WA S ++GC +  C   S   +F         LVCNYA  GN   E PY++G  CS CP   G +C    C+
Sbjct:   69 LLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHG-----PHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPS-RCSGSVCTHYTQMVWAASNKIGCAIKKC---SDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQCD 235          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 96.6709 bits (239), Expect = 4.664e-24
Identity = 58/185 (31.35%), Postives = 87/185 (47.03%), Query Frame = 3
Query:   87 QLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHD---SMSDRAYGDYQWVGQNV---AMFSGQNISKGLELWFNEVTGYSYTTGACSGIS-CGHYTQLIWATSKELGCGVASCP-------YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            + +  HN  R +V+       P AA+M  + W    A  A+  A  C F H+     + R +  +  VG+N+   A +S   +   +  W NE+  Y+Y    C+    CGHYTQ++WA S ++GC V +CP       +S+   +  VCNYA  GN     PY+ G +CS C     C   LC 
Sbjct:   34 ECVREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLCR 211          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.088e-33
Identity = 64/181 (35.36%), Postives = 100/181 (55.25%), Query Frame = 3
Query:   75 DQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYTTGAC-SGISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            ++K  +L+ HN +R        +++P A+DM+KL W +   + A+  A+KC + H+   DR +     +G+N+ + SG   +++ GL+ W  E   Y++TTG C  G  CGHYTQ++WA ++ +GCG   CP         +  LVCNY P GN   E PY+ G  C++CP    C   LC
Sbjct:   33 EEKRIILDKHNFYRS-------QTEPSASDMIKLTWDSALEAMAKSYAEKCIWEHNK--DRGF-----IGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVCIGSLC 199          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crisp2-like (cysteine-rich secretory protein 2-like [Source:NCBI gene;Acc:100495843])

HSP 1 Score: 102.449 bits (254), Expect = 1.469e-26
Identity = 71/203 (34.98%), Postives = 109/203 (53.69%), Query Frame = 3
Query:   24 IVIILSNLF-VCYGD------LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGD-YQWV-GQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTND--EKPYQVGDNCSKCPIGTACTDGLC 596
             +I +S LF   YGD      L  + ++ L++ HN+ R++V        P A DMLK+ WS  +A  AQ  A KC   H S ++R   D + +V G+N+ + + + + +  +  WFNE   ++Y  G  S    GHYTQ+ WA +  LGCG+A CP  +Y     +C+Y P GN  +  + PY+ G+ C+ CP   +C D LC
Sbjct:    9 FIICISALFHSTYGDDGGTPMLDTETQNYLVDLHNLLRRSV-------DPTAKDMLKMEWSPGAALNAQNAAAKCVMQHSSATERQIQDPFNYVCGENIYVTTAKPDWAAAVNSWFNERNDFTYGVGPNSDKMIGHYTQVAWAKTYLLGCGLAFCP-GNYYPYVSICHYCPMGNMINSIKTPYEAGEWCASCP--ESCEDKLC 201          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: ENSXETT00000010663.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460357.1:2036819:2079188:-1 gene:ENSXETG00000001370.1 transcript:ENSXETT00000010663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 1.764e-26
Identity = 65/183 (35.52%), Postives = 91/183 (49.73%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYG-DYQW-VGQNVA-MFSGQNISKGLELWFNEVTGYSYTTGAC-SGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTND--EKPYQVGDNCSKCPIGTACTDGLC 596
            L  + ++ +++ HN +R  V        PPAADMLK+ W     +KA+  A  C+F H ++S R YG D+ +  G+N+   +   +    +  WFNE   + Y  G    G   GH+TQ+IWA +  L C VA C  + Y   F VC Y P GN  D  + PYQ G  C  C     C D LC
Sbjct:   30 LDPNNRNFIVDKHNYYRSWV-------NPPAADMLKMHWDNYYLAKAKEWALTCSFKHSNLSFRQYGVDFYYSAGENIMNSYFRHSWEYVINYWFNEHVNWEYAVGTTKEGAVTGHFTQIIWAPTHALACYVAKCYGTPYN-YFYVCIYYPTGNREDKVKTPYQNGTTCGLC--QKDCDDQLC 202          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 97.0561 bits (240), Expect = 4.368e-24
Identity = 61/190 (32.11%), Postives = 93/190 (48.95%), Query Frame = 3
Query:   84 SQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYT---------TGACSGISCGHYTQLIWATSKELGCGVASCP------YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLC 596
            S LL+ HN  R  V        PPAA+M  ++W    A  A+  A++C + H       Y     +GQN+++ SG+  +I   ++ W++E   YS+             C+G  C HYTQ++WA+S  +GC V  C        +     +LVCNY+  GN   E PY++G  CS CP   G  C++ +C
Sbjct:   59 SALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 97.0561 bits (240), Expect = 4.768e-24
Identity = 61/190 (32.11%), Postives = 93/190 (48.95%), Query Frame = 3
Query:   84 SQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYT---------TGACSGISCGHYTQLIWATSKELGCGVASCP------YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLC 596
            S LL+ HN  R  V        PPAA+M  ++W    A  A+  A++C + H       Y     +GQN+++ SG+  +I   ++ W++E   YS+             C+G  C HYTQ++WA+S  +GC V  C        +     +LVCNY+  GN   E PY++G  CS CP   G  C++ +C
Sbjct:   64 SALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 119.398 bits (298), Expect = 8.283e-33
Identity = 63/184 (34.24%), Postives = 96/184 (52.17%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLEL--WFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            L ED+K  +++ HN +R  V+       PPA+DML++ W  + A+ A+  A KC + H+    R        G+N+   + + +   L +  W  E   Y+++T  C     CGHYTQ++W+ ++ +GCG   C          I  LVCNY P GN    KPYQ G  CS+CP+G +C + LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 119.398 bits (298), Expect = 1.513e-32
Identity = 63/184 (34.24%), Postives = 96/184 (52.17%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLEL--WFNEVTGYSYTTGACSGIS-CGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            L ED+K  +++ HN +R  V+       PPA+DML++ W  + A+ A+  A KC + H+    R        G+N+   + + +   L +  W  E   Y+++T  C     CGHYTQ++W+ ++ +GCG   C          I  LVCNY P GN    KPYQ G  CS+CP+G +C + LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 119.398 bits (298), Expect = 1.513e-32
Identity = 63/184 (34.24%), Postives = 96/184 (52.17%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLEL--WFNEVTGYSYTTGACSGIS-CGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            L ED+K  +++ HN +R  V+       PPA+DML++ W  + A+ A+  A KC + H+    R        G+N+   + + +   L +  W  E   Y+++T  C     CGHYTQ++W+ ++ +GCG   C          I  LVCNY P GN    KPYQ G  CS+CP+G +C + LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr1l3 (GLI pathogenesis-related 1 like 3 [Source:MGI Symbol;Acc:MGI:3620621])

HSP 1 Score: 116.316 bits (290), Expect = 1.063e-31
Identity = 70/206 (33.98%), Postives = 107/206 (51.94%), Query Frame = 3
Query:   18 LAIVIILSNLFVCYGDLLEDQKSQL--------LEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYG---DYQWVGQNVAMFSGQNISKGL-ELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCP-YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            LA+ +I + L   +G+ L    S L        L  HN  R+ V       QPPAADM ++IW    A  A+    +C   H+  + + YG   DY ++G+N+ +   +   + +   W+NE T Y++    CS I C +YTQ+ WA + ++GC V++CP  + Y+    VCNY+P GN  D +PY+ GD CS C     C + LC
Sbjct:   13 LALYLIATRLPKAFGNDLPRVPSILDPKFIDAFLNIHNELRRKV-------QPPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYDFIGENIYLGEIETQPEDVVNNWYNENTDYNFVDNTCSKI-CRNYTQVFWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGNFLDFRPYRKGDPCSMCG-QRKCENSLC 209          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 118.627 bits (296), Expect = 9.875e-31
Identity = 63/185 (34.05%), Postives = 96/185 (51.89%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLEL--WFNEVTGYSYTTGAC-SGISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            L ED+K  +++ HN +R  V+       PPA+DML++ W  + A+ A+  A KC + H+    R        G+N+   + + +   L +  W  E   Y+++T  C     CGHYTQ++W+ ++ +GCG   C          I  LVCNY P GN    KPYQ G  CS+CP+G +C + LC 
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCE 200          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P10736|VA52_DOLMA (Venom allergen 5.01 OS=Dolichovespula maculata OX=7441 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.140e-31
Identity = 70/179 (39.11%), Postives = 102/179 (56.98%), Query Frame = 3
Query:   39 SNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKS-----QPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSG-----QNISKGLELWFNEVTGYSYTTGACSG--ISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQ 539
             N+   YG L  D+K+++L+ HN FRQ VAKGL        QPPA +M  L+W+ + A  AQ  A++C F+HD   + A   YQ VGQN+A+ S         SK ++ W +EVT ++Y  G  +      GHYTQ++W  +KE+GCG       ++   +LVCNY PGGN  ++  Y+
Sbjct:   51 RNVVKAYG-LTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTA--KYQ-VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYE 225          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q2L6Z1|VAL5_VESMC (Venom allergen 5 OS=Vespula maculifrons OX=7453 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 6.303e-31
Identity = 69/179 (38.55%), Postives = 99/179 (55.31%), Query Frame = 3
Query:   39 SNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKS-----QPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSG-----QNISKGLELWFNEVTGYSYTTGACSG--ISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQ 539
            + + V YG L + +K  +L+ HN FRQ VA+GL        QPPA +M  L+W+ + A  AQ  A++C + HD+  D A   YQ VGQNVA+        +N    +++W NEV  Y+          I  GHYTQ++WA +KE+GCG      + +   +LVCNY P GN  +E+ YQ
Sbjct:   51 NKVVVSYG-LTKQEKQDILKEHNDFRQKVARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVA--KYQ-VGQNVALTGSTAAKYENPVNLVKMWENEVKDYNPKKKFSENNFIKIGHYTQMVWANTKEIGCGSMKYTENKWHYHYLVCNYGPSGNFGNEELYQ 225          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q6UWM5|GPRL1_HUMAN (GLIPR1-like protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1L1 PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 8.578e-31
Identity = 63/175 (36.00%), Postives = 93/175 (53.14%), Query Frame = 3
Query:   93 LEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAY---GDYQWVGQNVAMFSGQNIS--KGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCP-YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            +EAHN +R  V        PPAADM  +IW    A  A+  A++C F H+   D++Y     +++VG+N+ +   ++ +    +  W+NE   Y + + +CS + CGHYTQL+WA S  +GC VA CP     +    VCNY P GN  +  PY  G++CS C     C   LC 
Sbjct:   38 IEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRV-CGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCR 204          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q58D34|PI16_BOVIN (Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 8.731e-31
Identity = 61/183 (33.33%), Postives = 99/183 (54.10%), Query Frame = 3
Query:   72 EDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCP----YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            E++K  ++E HN++R  V+       PPA +ML++ W  + A+ A+  A +C + H+    R        G+N+   +G+  ++   +E W +E   Y+ +  +C+ G  CGHYTQ++WA ++ +GCG   C          I  LVCNY P GN   ++PYQ G  CS+CP+G  C + LC 
Sbjct:   30 EEEKHVMVELHNLYRTQVS-------PPATNMLQMRWDEELAAFAKAYAQQCVWGHNKERGRR-------GENLFAITGEGLDVPLAMEEWHHEREHYNLSAISCAAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGYHCKNSLCE 198          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P10737|VA53_DOLMA (Venom allergen 5.02 (Fragment) OS=Dolichovespula maculata OX=7441 PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 1.706e-30
Identity = 67/168 (39.88%), Postives = 96/168 (57.14%), Query Frame = 3
Query:   75 DQKSQLLEAHNIFRQTVAKGLVKS-----QPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ-----NISKGLELWFNEVTGYSY---TTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQ 539
            D+K++++  HN FRQ VAKGL        QPPA +M  L+W+ + A  AQ  A++C+F HD    R    YQ VGQNVA+ S        +SK +E+W NEV  ++    T G  +    GHYTQ++W  +KE+GCG      +++   +LVCNY P GN  D+  Y+
Sbjct:   49 DEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQC--RNTEKYQ-VGQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIYE 213          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A564YFQ7 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.026e-45
Identity = 72/160 (45.00%), Postives = 108/160 (67.50%), Query Frame = 3
Query:   57 YGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPY 536
            +G L +D K +LL+  N +R+ VA G V +QP ++ +  L W+T+  + AQ  AD+C F HDS  DR   ++ WVGQN+A  S   I++ +++WF E   Y+Y+   CSG+ CGHYTQL+WA + ++GCGV+ C +S +  +F+VCNY PGGN N++KPY
Sbjct:   46 FGRLSKD-KQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAYSSS--IAQNVKMWFEEHKDYNYSHNYCSGV-CGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPGGNFNNQKPY 201          
BLAST of Venom allergen 5 vs. TrEMBL
Match: I1ZI85 (GLI pathogenesis related-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 3.600e-45
Identity = 68/128 (53.12%), Postives = 95/128 (74.22%), Query Frame = 3
Query:   30 IILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQL 413
             +L  L  C GDL E +K  LL  HN FR  +A+G V  QPPA +M +++W+ +SASKAQ  ADKC F+HD++ DR YGD++WVGQNVA F+GQ+IS+G+ LW+N+V+G+++   ACS  +CGHYTQ+
Sbjct:    3 FVLVVLDFCSGDLSEKEKKLLLALHNGFRSNLAQGEVSGQPPATNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDISRGVTLWYNQVSGFTFENSACSLKTCGHYTQV 130          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A5K3ENG8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.825e-44
Identity = 69/157 (43.95%), Postives = 103/157 (65.61%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPY 536
            +L  +KS+LL  HN +R+ V+ G ++ QP ++ +  L WST+  + AQ  AD C F+HDS   R    + WVGQN+A  S  +I+K +E+WF+E   Y+Y +  CSG+ CGHYTQL+WA +  +GCGV+ C +  +  +++VCNY PGGN N  +PY
Sbjct:   52 VLSAEKSELLNLHNKYRRLVSDGQIREQPSSSKIHDLKWSTELEASAQRHADTCRFAHDSADARRTPQWDWVGQNIAYSS--SIAKNVEMWFDEYKEYNYQSNYCSGV-CGHYTQLVWANTTHVGCGVSKCNFRGFNAVYVVCNYGPGGNYNGRRPY 205          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A1C9ZZV5 (SCP domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.749e-42
Identity = 76/179 (42.46%), Postives = 107/179 (59.78%), Query Frame = 3
Query:   75 DQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSS-----YTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            + K  LL+AHN  R+ +A G   +QP AA+M++++W    A KA+  A KC   HD+  DR    + +VGQN  MF+G N  + ++ W++E   Y+Y    CS + CGHYTQ+ W+ S  +GC   +C   +     Y  LF +CNY P GN NDE PY+VG  CSKCP GT+C + LC
Sbjct:   29 EYKDFLLKAHNDLRRDIALGKTPNQPAAANMIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQN--MFAGSNYKEVVQGWYDEYKDYTYEGKGCSAV-CGHYTQVAWSKSYAVGCAAVNCKEKTGGSFAYGWLF-ICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 203          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A0R3SFR1 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3694 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.411e-40
Identity = 66/151 (43.71%), Postives = 100/151 (66.23%), Query Frame = 3
Query:   57 YGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPG 509
            +G L +D K +LL+  N +R+ VA G V +QP ++ +  L W+T+  + AQ  AD+C F HDS  DR   ++ WVGQN+A  S   I++ +++WF E   Y+Y+   CSG+ CGHYTQL+WA + ++GCGV+ C +S +  +F+VCNY PG
Sbjct:   46 FGRLSKD-KQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAYSSS--IAQNVKMWFEEHKDYNYSHNYCSGV-CGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPG 192          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 118.242 bits (295), Expect = 1.662e-32
Identity = 70/187 (37.43%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   60 GDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCPYSS----YTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTA-CTDGLCN 599
            G   ++ + +++  HN  R TV       +PPAADM+ + WS + A  A+  A KC + H+  S         +G+N+ + +G  +I K L  WF E   YSY    C+    CGHYTQ++WA +KE+GCG   C             LVCNY P GN   +KPYQVG+ CSKCP     C D  C+
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACD 196          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 118.627 bits (296), Expect = 1.685e-32
Identity = 70/187 (37.43%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   60 GDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCPYSS----YTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTA-CTDGLCN 599
            G   ++ + +++  HN  R TV       +PPAADM+ + WS + A  A+  A KC + H+  S         +G+N+ + +G  +I K L  WF E   YSY    C+    CGHYTQ++WA +KE+GCG   C             LVCNY P GN   +KPYQVG+ CSKCP     C D  C+
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACD 196          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 118.627 bits (296), Expect = 3.046e-32
Identity = 70/187 (37.43%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   60 GDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACS-GISCGHYTQLIWATSKELGCGVASCPYSS----YTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTA-CTDGLCN 599
            G   ++ + +++  HN  R TV       +PPAADM+ + WS + A  A+  A KC + H+  S         +G+N+ + +G  +I K L  WF E   YSY    C+    CGHYTQ++WA +KE+GCG   C             LVCNY P GN   +KPYQVG+ CSKCP     C D  C+
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACD 196          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000032496.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:32321795:32342374:-1 gene:ENSAMXG00000031919.1 transcript:ENSAMXT00000032496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 4.256e-29
Identity = 68/183 (37.16%), Postives = 97/183 (53.01%), Query Frame = 3
Query:   60 GDLLEDQKS---QLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
             D+  D  S   +++  HN+FR+ V+       P A +MLK+ WS ++A  AQ  A+ C+  H   S R  G YQ +G+N+   +G    +  +  W NEV  Y Y TG+ +    GHYTQ++W +S  +GCG A C  S+Y   F VC+Y   GN     PY  G +C+ CP   AC D LC
Sbjct:   33 ADICTDVTSVQDEIVNLHNVFRRGVS-------PSATNMLKMNWSREAAVSAQNWANTCSMVHGDPSTRMLGTYQ-MGENLFKSTGMVKWTSVVTAWHNEVANYVYPTGSANTQPIGHYTQVVWYSSYSVGCGAAKCG-SNY---FYVCHYYRAGNFKGVAPYTQGQSCAACP--GACDDKLC 201          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000042591.1 (GLI pathogenesis related 1 [Source:NCBI gene;Acc:111193446])

HSP 1 Score: 100.908 bits (250), Expect = 1.333e-25
Identity = 59/177 (33.33%), Postives = 87/177 (49.15%), Query Frame = 3
Query:  102 HNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSM---SDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCP--------YSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            HN  R  V       QP A++M  + W    A  A+  A KC F H++      R +  +  VG+N+   +  ++   ++ W +EV  YSY+T  C  + CGHYTQ++WA + ++GC V  CP        Y     +F VCNY   GN  ++KPY+ G  C  C  G  C + LC 
Sbjct:   38 HNQHRANV-------QPAASNMRYMTWDEGLAVTARAWARKCLFIHNTHLKEEGRVHPVFSSVGENLWAGTHFSVQGAIKSWADEVKDYSYSTMTCKQV-CGHYTQVVWANTYKVGCAVQYCPNGVEQTPFYPRQAFIF-VCNYGTAGNVFNQKPYRTGPECRDC-TGELCENRLCR 204          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 6.150e-29
Identity = 69/200 (34.50%), Postives = 100/200 (50.00%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSG--QNISKGLELWFNEVTGYSYT---------TGACSGISCGHYTQLIWATSKELGCGVASC----------PYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLC 596
            + +D++  L E HN  R +V        P AADM  + W  + A  A+  A +C + H   SD+       +GQN+A++ G  + ++  ++ WF+E   Y Y             C G  C HYTQL+WA S+ +GC V +C          PY+    L+LVCNY+P GN   E PY+ G  CS+CP   G +C  GLC
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGP-SDQLDA----IGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYA----LYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 96.6709 bits (239), Expect = 8.315e-25
Identity = 63/196 (32.14%), Postives = 97/196 (49.49%), Query Frame = 3
Query:   63 DLLEDQKSQ----------LLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWV-GQNVAMFSGQ-NISKGLELWFNEV--TGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFL-VCNYAPGGNTNDE--KPYQVGDNCSKCPIGTACTDGLCN 599
            DL+ D +S           +++ HN  R+ V        P A +ML+++W  ++   A   A+ C F H   + R     QW  G+N+ M S     +  +  W+NEV   G+ Y  G+ +  + GHYTQL+W  S +LGC V  CP +     +L VC+Y P GN N    +PY +G +C+ CP    C + LC+
Sbjct:   28 DLVNDWRSLKTVHGSVQTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRK--TTQWTCGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCPKN--CVNNLCD 212          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 5.560e-19
Identity = 53/189 (28.04%), Postives = 80/189 (42.33%), Query Frame = 3
Query:   96 EAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAY-GDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYT---------TGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTI----------LFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLC 596
            E HN  R  V        PP+++M  + W      +A     +C      M+   + G   W+      F        ++ W++E   Y Y             C+G  C HYTQL+WAT+  +GC + +C    Y +          ++LVCNY+P GN     PY+ G  CS+CP   G +C + LC
Sbjct:    1 ELHNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHFLGQPHWLSHRPPSFH-------VQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTC----YNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 64.6994 bits (156), Expect = 1.102e-13
Identity = 36/92 (39.13%), Postives = 51/92 (55.43%), Query Frame = 3
Query:  336 WFNE--VTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDE--KPYQVGDNCSKCPIGTACTDGLCN 599
            W+NE  V G+ +  G  +    GHYTQ++W +S +LGC V  CP + Y  ++ VC+Y P GN N    +PY  G  C  CP    C + LC+
Sbjct:   21 WYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAIYKYVY-VCHYCPAGNLNTRLSRPYNEGSPCRSCP--NDCENDLCS 109          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 63.929 bits (154), Expect = 5.895e-13
Identity = 35/96 (36.46%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  321 KGLELWFNEVT--GYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDE--KPYQVGDNCSKCPIGTACTDGLC 596
            + +++W +E    G+ Y  G  +    GHYTQ+IW ++ ++GC +  CP  +Y  ++L C Y P GN N+   KPY  G +C  CP    C D LC
Sbjct:   62 EAIKVWVDEANSPGFDYGKGPRNPGIVGHYTQIIWYSTYQVGCTINYCPEEAYKYMYL-CAYCPVGNWNNRLTKPYDEGPSCQDCP--NDCDDKLC 154          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 58.9214 bits (141), Expect = 6.004e-11
Identity = 41/122 (33.61%), Postives = 64/122 (52.46%), Query Frame = 3
Query:  162 DMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAY--GDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASC--PYSSYTILFLVCNYAPGGN 515
            D   L WS   A+ AQ  AD    S+D   +  +  G Y   G+N+A+  G   +  ++ W+NE+T Y Y+    S  S GH+TQ++W  + E+GCG+ SC   +  Y    ++C+Y   GN
Sbjct:  209 DTGSLTWSDTLATYAQNYAD----SYDCSGNLVHSGGPY---GENLAL--GYGTTGSVDAWYNEITSYDYSNPGFSE-SAGHFTQVVWKGTSEVGCGLKSCGGEWGDY----IICSYKAAGN 316          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 59.3066 bits (142), Expect = 6.256e-11
Identity = 47/151 (31.13%), Postives = 75/151 (49.67%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADK--CA--FSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASC--PYSSYTILFLVCNYAPGGN 515
            +S +L  HN FR               D   L WS   A+ AQ  AD+  C+   +H   SD  YG      +N+A+  G   +  ++ W+ E++ Y+Y+    S  S GH+TQ++W ++ E+GCG   C   +++Y    +VC+Y P GN
Sbjct:   26 ESDVLNEHNKFRAL-----------HVDTAPLTWSDTLATYAQNYADQYDCSGVLTH---SDGPYG------ENLAL--GYTDTGAVDAWYGEISKYNYSNPGFSE-STGHFTQVVWKSTAEIGCGYKYCGTTWNNY----IVCSYNPPGN 149          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 56.6102 bits (135), Expect = 3.410e-10
Identity = 36/122 (29.51%), Postives = 63/122 (51.64%), Query Frame = 3
Query:  162 DMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDE 527
            D   L WS   AS AQ  AD   +        + G Y   G+N+A+  G +    ++ W+NE++ Y ++    S  + GH+TQ++W ++ ++GCG+ +C        +++C+Y P GN   E
Sbjct:  179 DTPALSWSDTLASYAQDYADN--YDCSGTLTHSGGPY---GENLAL--GYDGPAAVDAWYNEISNYDFSNPGFSS-NTGHFTQVVWKSTTQVGCGIKTC--GGAWGDYVICSYDPAGNYEGE 290          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 75.0998 bits (183), Expect = 2.447e-17
Identity = 52/148 (35.14%), Postives = 74/148 (50.00%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKG---LELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGN 515
            K+Q ++ HN +R       + S PP      L WS + A +AQ  A+K A    SM   +       G+N+AMFSG+  + G    E+W+ E   YS+  G  S +  GH+TQ++W  SKELG G A    S     ++V  Y P GN
Sbjct:    4 KNQCVDNHNKYR------AMHSAPP------LKWSDELAREAQYYAEKLA-QQRSMQHSSKCSRNDAGENLAMFSGRYDTAGDMACEMWYEESKKYSFVRGG-SQMGTGHFTQMVWKGSKELGMGRAKT--SDGRCTYVVARYQPAGN 135          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 72.7886 bits (177), Expect = 4.114e-16
Identity = 56/153 (36.60%), Postives = 75/153 (49.02%), Query Frame = 3
Query:   69 LEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHD-SMSDRAYGDYQWVGQNVAMFSGQNISKGLE---LWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGN 515
            LE  + Q L+AHN FR   A   VK+         L WS D A  AQ  A+K A       S R  G+    G+N+AMF+G+  S G E   +W+ E   Y++        + GH+TQ++W  +KELG G A  P    T  F+V  Y P GN
Sbjct:   38 LELFQQQALDAHNYFR---AFHGVKN---------LKWSHDLARGAQAWAEKLARERTLKHSTRERGE---DGENLAMFTGKYESAGEEATNMWYEESAYYNFNRPGYQS-NTGHFTQVVWKGTKELGLGRAKTPDGRLT--FVVGRYRPSGN 172          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 72.0182 bits (175), Expect = 5.666e-15
Identity = 48/154 (31.17%), Postives = 71/154 (46.10%), Query Frame = 3
Query:   72 EDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCA----FSHDSMSDRAYGDYQWVGQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNT 518
            ED +S++L+ HN +R      +  + P       L WS   A  AQ  A K A      H S  DR Y      G+N+   S   +I   L++W+NE   Y Y     + ++ GH+TQ++W  ++E+G G A  P    T  + V  Y P GN 
Sbjct:  211 EDTRSRILDIHNNYR-----AMHNAAP-------LRWSAALAKDAQAWAGKLAREGRLEHASREDRYYK-----GENICRMSHHFDIGDALQIWYNESESYQYDNPGFA-LTTGHFTQIVWRGTREVGVGFAKSPDGRLT--YAVARYNPPGNN 344          

HSP 2 Score: 69.707 bits (169), Expect = 3.892e-14
Identity = 48/145 (33.10%), Postives = 69/145 (47.59%), Query Frame = 3
Query:   93 LEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLEL----WFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGN 515
            L+AHN +R       + + PP      L WS   A +AQ  A+K A     + D++       G+NV M SG N     E     W+ EV  Y++  G       GH+TQ++W +S+ELG   A    S    +F+V  Y+PGGN
Sbjct:    9 LDAHNRYR------AMHNVPP------LTWSNSIAREAQKWANKLAKEGKLIHDKSRSGQ---GENVFMSSGANFDDAGEAACESWYQEVERYNFQRGGHQS-GTGHFTQVVWKSSEELGVARAK---SKKGAVFVVARYSPGGN 134          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO40545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z3])

HSP 1 Score: 65.4698 bits (158), Expect = 1.290e-13
Identity = 47/157 (29.94%), Postives = 76/157 (48.41%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAM--------FSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDE 527
            + + L  HN FRQ      V + PP    L    S  +   A+ +A+  A  H S  +R     + VG+N+A+         +G+   + +  W+NEV  Y +  GA + +  GH+TQ++W  S ELG G A+   +    +F+V  Y P GN N++
Sbjct:    7 EEEALLTHNNFRQ------VHNAPPMT--LNRELSLQAKGYAEKIANLGALQHSSSGERG----EDVGENLAVGCKSFGVPLTGK---EAVTNWYNEVCKYDFNNGAFA-METGHFTQVVWTDSIELGMGKATGKLNGIPCVFVVGRYRPPGNFNNQ 147          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 63.929 bits (154), Expect = 3.086e-13
Identity = 52/160 (32.50%), Postives = 77/160 (48.12%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQ----GLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNIS--KGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQV 542
            K+ +L+ HN +R   A+   K+         L W+   AS+AQ     LA + A  H S   R YG+      ++A  SG  ++  K  ++W+ EV  Y +     S  S GH+TQ++WA S E+G G A+   SS    F+V  Y P GN   + P  V
Sbjct:    3 KNDILKTHNDYR---AQHGTKA---------LKWNARLASEAQSWAENLAQRNAIQHSS--SREYGE------SIAYMSGAVLTGRKATDMWYGEVDKYRFENPGFS-TSSGHFTQVVWAGSTEMGAGKAT---SSSGAHFVVARYTPPGNVMGQFPENV 138          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 108.227 bits (269), Expect = 7.077e-29
Identity = 59/173 (34.10%), Postives = 92/173 (53.18%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGL-ELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            ++++++ HN FR+ V       +PPAADML + +S + A  AQ   DKC   H   S R    Y+ +G+N+   +   + K +   W+ EV+ +++   + +G   GHYTQ++W +S ++GCGV  C   S  I    C+Y   GN     PY+VG  C+ CP    C D LC
Sbjct:   16 QAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLC---SNNIYLYGCHYYRAGNFKRWPPYKVGTPCASCP--NDCVDKLC 175          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 111.309 bits (277), Expect = 7.953e-29
Identity = 68/185 (36.76%), Postives = 99/185 (53.51%), Query Frame = 3
Query:   66 LLEDQKSQLL-EAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ-NISKGLELWFNEVTGYSYTTGACSGIS-CGHYTQLIWATSKELGCGVASCPYSSY----TILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIG-TACTDGLC 596
            LL DQ+ ++L E HN +R  V+       P AA ML L W  +    A+G A KC + H++       + +  G+N+   +G+ ++S+ +E WF E   YSY   +C     CGHYTQ++WA +  +GC V  C          + +LVCNY P GN +DE+PY  GD CS+CP     C + LC
Sbjct:   56 LLTDQQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLC 226          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 108.227 bits (269), Expect = 1.037e-28
Identity = 59/173 (34.10%), Postives = 92/173 (53.18%), Query Frame = 3
Query:   81 KSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGL-ELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            ++++++ HN FR+ V       +PPAADML + +S + A  AQ   DKC   H   S R    Y+ +G+N+   +   + K +   W+ EV+ +++   + +G   GHYTQ++W +S ++GCGV  C   S  I    C+Y   GN     PY+VG  C+ CP    C D LC
Sbjct:   31 QAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLC---SNNIYLYGCHYYRAGNFKRWPPYKVGTPCASCP--NDCVDKLC 190          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 105.916 bits (263), Expect = 3.428e-26
Identity = 66/200 (33.00%), Postives = 97/200 (48.50%), Query Frame = 3
Query:   66 LLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDS----MSDRAYGDYQWVGQNVAMFSGQNISKGLEL--WFNEVTGYSYTTGA---------CSGISCGHYTQLIWATSKELGCGVASCPYSSY------TILFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLC 596
            +L   + ++L  HN  R +V        P AA+M  ++W  +    A   A++C + H      MS         +GQN+A+  G+  S    +  W++EV  Y+Y   +         CSG  C HYTQL+WAT+  +GC V  CP  +       T ++LVCNY+P GN   E PY+ G  CS+CP   G  C + LC
Sbjct:   71 ILWSDREEILLLHNKLRSSV-------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQDLLMS---------IGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 97.4413 bits (241), Expect = 2.177e-24
Identity = 63/204 (30.88%), Postives = 102/204 (50.00%), Query Frame = 3
Query:   90 LLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQ--NISKGLELWFNEVTGYSYTTGA---------CSGISCGHYTQLIWATSKELGCGVASCPYSSYTI----------LFLVCNYAPGGNTNDEKPYQVGDNCSKCP--IGTACTDGLCN*FFIIKIKIMH 632
            +L+ HN  R  V        PPA++M  ++W    A  A+  A  C + H           +++GQN+++ +G+  +I + ++ W++EV  YS+             C G  C HYTQ++WATS ++GC + +C    Y +           +LVCNY+P GN   E PY+VG  CS CP   G +C++ +C  F  +K   +H
Sbjct:   69 ILDYHNKVRGKVF-------PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHL-----LRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTC----YNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC--FPALKTNYLH 254          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 262.307 bits (669), Expect = 1.429e-89
Identity = 111/196 (56.63%), Postives = 155/196 (79.08%), Query Frame = 3
Query:    9 NTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            N I+ I  +L  L  C GDL E++++Q+LE HN FR++VA G V +QP AA+M +++WS ++AS+AQ  ADKC+F+HD+++DR YG+Y+WVGQN+AMF+G NI+KG++LWFNEV+GY+++  +CS  +CGHYTQ++WA SKELGCG+A C YS Y + FLVCNY PGGN N E PY+ G+ CSKC  G+ C++GLC
Sbjct:    2 NFIIKITFVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQSGSNCSNGLC 197          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 262.307 bits (669), Expect = 1.567e-89
Identity = 111/196 (56.63%), Postives = 155/196 (79.08%), Query Frame = 3
Query:    9 NTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            N I+ I  +L  L  C GDL E++++Q+LE HN FR++VA G V +QP AA+M +++WS ++AS+AQ  ADKC+F+HD+++DR YG+Y+WVGQN+AMF+G NI+KG++LWFNEV+GY+++  +CS  +CGHYTQ++WA SKELGCG+A C YS Y + FLVCNY PGGN N E PY+ G+ CSKC  G+ C++GLC
Sbjct:    7 NFIIKITFVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQSGSNCSNGLC 202          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000001228.1 (SMESG000001228.1)

HSP 1 Score: 238.424 bits (607), Expect = 3.720e-80
Identity = 106/183 (57.92%), Postives = 133/183 (72.68%), Query Frame = 3
Query:   51 VCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            +C  DL E  K ++L  HN +RQ +AKG++  QPPAA+M+K+ W+ +SA KAQ  AD C FSHDS  DR+Y  ++WVGQN+AM SG+ IS GL+LWFNEV GYSY+  +CS  +CGHYTQ+IWA SKELGCG++ C +  + I FLVCNY PGGN N E PY+ G  CSKC  GT C  GLCN
Sbjct:   17 ICLSDLNEKHKEEILFEHNRYRQLIAKGMISGQPPAANMVKMTWNEESAEKAQRKADTCEFSHDSKQDRSYSHHEWVGQNIAMSSGRKISNGLKLWFNEVKGYSYSDNSCSLNTCGHYTQVIWAKSKELGCGISKCSHGRFLINFLVCNYGPGGNFNSELPYESGPACSKCISGTTCDGGLCN 199          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000000477.1 (SMESG000000477.1)

HSP 1 Score: 229.18 bits (583), Expect = 1.895e-76
Identity = 101/196 (51.53%), Postives = 140/196 (71.43%), Query Frame = 3
Query:    9 NTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLC 596
            N ++ +  +L  L  C GD+  ++ +QLL +HN +RQ+VAKG V +QP A++M K+ W+  SASKAQ  ADKC F+HD+  DR YGD++WVGQNVA F+ +NI++G ELWFN+ +G+++   ACS  +CGHYTQL+WA S E GCG+A CP+    +  LVCNY PGGN   EKPY+ G+ CS+C  G +C+ GLC
Sbjct:    2 NFLIKVAFVLVVLDFCSGDISLNEITQLLVSHNKYRQSVAKGEVPNQPKASNMQKMDWNEKSASKAQITADKCIFAHDTKDDRKYGDFEWVGQNVAKFAEENIARGAELWFNQASGFTFENSACSLKTCGHYTQLVWANSTEFGCGLAKCPFDGIDLNLLVCNYGPGGNYVGEKPYKPGETCSECKSGQSCSAGLC 197          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017377.1 (SMESG000017377.1)

HSP 1 Score: 226.098 bits (575), Expect = 2.120e-75
Identity = 99/197 (50.25%), Postives = 140/197 (71.07%), Query Frame = 3
Query:    9 NTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQPPAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMFSGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVASCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN 599
            N ++ +  +L  L  C GDL E +K+ LL  HN FR  +A+G V  QPPA +M +L+W+ +SASKAQ  ADKC F+HD++ DR YGD++WVGQNVA F+GQ+I++G++LW  +V G+++   +CS  +CGHYTQL+WA S E+GCG++ C      +  LVCNY PGGN   EKPY++G +CS+C  G +C+ GLCN
Sbjct:    2 NFLIEVAFVLVVLDFCSGDLSEKEKNLLLSLHNGFRSDIAQGEVSGQPPATNMQRLVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDIARGVDLWSIQVFGFTFADNSCSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVSEKPYKLGKSCSECKSGQSCSQGLCN 198          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR1L11.410e-3135.75GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L11.786e-3136.00GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
PI162.237e-3033.69peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.237e-3033.69peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.237e-3033.69peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vap-22.214e-2633.97Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
vap-22.220e-2633.97Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
vap-22.456e-2633.97Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
scl-54.259e-2429.86SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-102.872e-2230.05SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84834.506e-2834.01gene:FBgn0038126 transcript:FBtr0082782[more]
CG94003.526e-1128.42gene:FBgn0030562 transcript:FBtr0073920[more]
CG326791.338e-1026.74gene:FBgn0052679 transcript:FBtr0071469[more]
CG42702.763e-1033.68gene:FBgn0031407 transcript:FBtr0077754[more]
Ag5r1.031e-927.17gene:FBgn0015010 transcript:FBtr0333658[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01068499.12.227e-2835.03cysteine-rich venom protein natrin-1-like [Source:... [more]
crispld27.112e-2633.85cysteine-rich secretory protein LCCL domain contai... [more]
r3hdml1.987e-2534.43R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml1.987e-2534.43R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
glipr1a4.664e-2431.35GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.11.088e-3335.36pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
crisp2-like1.469e-2634.98cysteine-rich secretory protein 2-like [Source:NCB... [more]
ENSXETT00000010663.11.764e-2635.52pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
R3HDML4.368e-2432.11R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML4.768e-2432.11R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi168.283e-3334.24peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.513e-3234.24peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.513e-3234.24peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr1l31.063e-3133.98GLI pathogenesis-related 1 like 3 [Source:MGI Symb... [more]
Pi169.875e-3134.05peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10736|VA52_DOLMA1.140e-3139.11Venom allergen 5.01 OS=Dolichovespula maculata OX=... [more]
sp|Q2L6Z1|VAL5_VESMC6.303e-3138.55Venom allergen 5 OS=Vespula maculifrons OX=7453 PE... [more]
sp|Q6UWM5|GPRL1_HUMAN8.578e-3136.00GLIPR1-like protein 1 OS=Homo sapiens OX=9606 GN=G... [more]
sp|Q58D34|PI16_BOVIN8.731e-3133.33Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI... [more]
sp|P10737|VA53_DOLMA1.706e-3039.88Venom allergen 5.02 (Fragment) OS=Dolichovespula m... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YFQ71.026e-4545.00SCP domain-containing protein OS=Hymenolepis dimin... [more]
I1ZI853.600e-4553.13GLI pathogenesis related-1 (Fragment) OS=Schmidtea... [more]
A0A5K3ENG84.825e-4443.95Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A1C9ZZV52.749e-4242.46SCP domain-containing protein (Fragment) OS=Dugesi... [more]
A0A0R3SFR12.411e-4043.71SCP domain-containing protein OS=Hymenolepis dimin... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036030.11.662e-3237.43peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.11.685e-3237.43peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.13.046e-3237.43peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000032496.14.256e-2937.16pep primary_assembly:Astyanax_mexicanus-2.0:18:323... [more]
ENSAMXT00000042591.11.333e-2533.33GLI pathogenesis related 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.16.150e-2934.50pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP38.315e-2532.14cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.15.560e-1928.04pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP21.102e-1339.13cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP25.895e-1336.46cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY26.004e-1133.61Sterol binding protein involved in the export of a... [more]
PRY36.256e-1131.13Cell wall-associated protein involved in export of... [more]
PRY13.410e-1029.51Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486632.447e-1735.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493094.114e-1636.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493105.666e-1531.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405451.290e-1329.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488813.086e-1332.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020676.27.077e-2934.10cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000023160.27.953e-2936.76peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020674.21.037e-2834.10cysteine-rich venom protein pseudecin-like [Source... [more]
crispld23.428e-2633.00cysteine rich secretory protein LCCL domain contai... [more]
pi15a2.177e-2430.88peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055797.11.429e-8956.63SMESG000055797.1[more]
SMESG000055797.11.567e-8956.63SMESG000055797.1[more]
SMESG000001228.13.720e-8057.92SMESG000001228.1[more]
SMESG000000477.11.895e-7651.53SMESG000000477.1[more]
SMESG000017377.12.120e-7550.25SMESG000017377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002175 ID=SMED30002175|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=647bp
AAATGAATAATACAATCCTCGCAATTGTTATAATTCTAAGCAATCTCTTT
GTATGTTATGGAGATCTTTTGGAAGATCAAAAATCTCAACTTCTAGAAGC
TCACAACATTTTTAGGCAAACTGTAGCAAAAGGTCTTGTTAAAAGTCAAC
CGCCAGCAGCTGATATGTTGAAATTAATTTGGAGCACTGATTCCGCTTCT
AAAGCACAGGGGTTAGCAGATAAATGTGCATTCTCCCATGATTCCATGAG
CGATCGGGCATATGGAGATTACCAGTGGGTCGGACAAAATGTAGCAATGT
TCAGTGGACAAAATATATCAAAGGGTCTAGAGCTCTGGTTTAATGAAGTT
ACAGGATATTCTTATACAACTGGTGCTTGCTCGGGAATATCCTGTGGACA
TTATACACAATTAATATGGGCAACATCAAAGGAACTTGGTTGTGGAGTGG
CTAGTTGTCCATATTCGAGTTACACAATTTTATTTTTGGTCTGCAACTAT
GCCCCGGGTGGTAATACTAACGATGAGAAGCCATATCAAGTAGGAGATAA
TTGTTCTAAATGTCCAATTGGAACCGCTTGTACTGATGGACTTTGCAATT
AGTTTTTCATTATTAAAATAAAAATTATGCACTGCAGATCGGAAGAG
back to top

protein sequence of SMED30002175-orf-1

>SMED30002175-orf-1 ID=SMED30002175-orf-1|Name=SMED30002175-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=200bp
MNNTILAIVIILSNLFVCYGDLLEDQKSQLLEAHNIFRQTVAKGLVKSQP
PAADMLKLIWSTDSASKAQGLADKCAFSHDSMSDRAYGDYQWVGQNVAMF
SGQNISKGLELWFNEVTGYSYTTGACSGISCGHYTQLIWATSKELGCGVA
SCPYSSYTILFLVCNYAPGGNTNDEKPYQVGDNCSKCPIGTACTDGLCN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR002413V5_allergen-like
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region