Transient-receptor-potential-like protein

Overview
NameTransient-receptor-potential-like protein
Smed IDSMED30002172
Length (bp)408
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002172h1SMcG0007553 SmedASXL_003057SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30002172h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002172h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002172h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30002172h1SMcG0007553 SMED30025288smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 59.6918 bits (143), Expect = 9.980e-11
Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R VNF K   R+ + ++          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  790 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 897          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 59.6918 bits (143), Expect = 1.022e-10
Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R VNF K   R+ + ++          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  662 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 769          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 59.6918 bits (143), Expect = 1.039e-10
Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R VNF K   R+ + ++          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  717 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 824          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754])

HSP 1 Score: 53.9138 bits (128), Expect = 9.287e-9
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  714 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 788          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754])

HSP 1 Score: 53.9138 bits (128), Expect = 9.486e-9
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  659 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 733          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 65.4698 bits (158), Expect = 2.999e-13
Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402
            Y D+I  LV R+I + KK M+ DGV+EDDL EIKQDISSLR+ELR+   ++      ++  ++++IM+
Sbjct:  763 YADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMR 830          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 65.4698 bits (158), Expect = 3.152e-13
Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402
            Y D+I  LV R+I + KK M+ DGV+EDDL EIKQDISSLR+ELR+   ++      ++  ++++IM+
Sbjct:  783 YADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMR 850          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trp (gene:FBgn0003861 transcript:FBtr0085513)

HSP 1 Score: 53.1434 bits (126), Expect = 9.523e-9
Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  151 KPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336
            + KSF  +      T +  V++ LV RYI   ++     G++EDD++E++QDISSLRFEL E
Sbjct:  718 RTKSFMRKSMERAQTLHDKVMKLLVRRYITAEQRRRDDYGITEDDIIEVRQDISSLRFELLE 779          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0335144)

HSP 1 Score: 50.0618 bits (118), Expect = 9.390e-8
Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336
            YQ ++R+LV RY+   ++     GV+EDD+ EIKQDIS+ R EL E
Sbjct:  799 YQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVE 844          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945)

HSP 1 Score: 50.0618 bits (118), Expect = 1.011e-7
Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336
            YQ ++R+LV RY+   ++     GV+EDD+ EIKQDIS+ R EL E
Sbjct:  738 YQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVE 783          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946)

HSP 1 Score: 50.0618 bits (118), Expect = 1.011e-7
Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336
            YQ ++R+LV RY+   ++     GV+EDD+ EIKQDIS+ R EL E
Sbjct:  738 YQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVE 783          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471)

HSP 1 Score: 44.669 bits (104), Expect = 8.915e-6
Identity = 18/46 (39.13%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336
            Y +++RSLV RY+    +    + VSEDD+ E+K +I+++R+E+ E
Sbjct:  742 YDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLE 787          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 57.7658 bits (138), Expect = 2.652e-10
Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  318 SFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 378          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114])

HSP 1 Score: 57.7658 bits (138), Expect = 3.140e-10
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  187 QTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405
            +++ YQ +++ LV RYI KA+     D V+E +L EIKQDISSLR+EL E+   + +   K ++ L K + +D
Sbjct:  795 RSSRYQKIMKRLVKRYIIKAQNDKECDEVNEGELKEIKQDISSLRYELLEEKSHNMEELAKLVRTLEKNLSQD 867          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114])

HSP 1 Score: 57.7658 bits (138), Expect = 3.140e-10
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  187 QTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405
            +++ YQ +++ LV RYI KA+     D V+E +L EIKQDISSLR+EL E+   + +   K ++ L K + +D
Sbjct:  795 RSSRYQKIMKRLVKRYIIKAQNDKECDEVNEGELKEIKQDISSLRYELLEEKSHNMEELAKLVRTLEKNLSQD 867          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 56.9954 bits (136), Expect = 5.355e-10
Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  816 SFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 876          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc6b (transient receptor potential cation channel, subfamily C, member 6b [Source:ZFIN;Acc:ZDB-GENE-081030-19])

HSP 1 Score: 54.299 bits (129), Expect = 4.929e-9
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1
Query:   46 LKTSQRFVNFLKITYRKFRGELINDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFE-LREKAVQDDKM 360
            +  + R    L I   + + +L  D T  N+  K K  S  +  H S+   YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLRFE L EK+ Q +++
Sbjct:  699 ISLAMRLKRLLLIPLHRHKEDLKED-TELNESGKQKESSEKNSPHTSR---YQRIMKRLIKRYVIKAQTDKEGDEVNEGELKEIKQDISSLRFELLEEKSRQTEEL 800          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: TRPC3 (transient receptor potential cation channel, subfamily C, member 3 [Source:NCBI gene;Acc:100490905])

HSP 1 Score: 56.6102 bits (135), Expect = 1.053e-9
Identity = 38/107 (35.51%), Postives = 60/107 (56.07%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL---INDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    + +N  K   R+ + +    + D  S +     + +SFNS ++  Q T YQ +++ L+ RY+ +A+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  722 VYFI---LKIINLFKCRRRRLQKDTEIGMGDSKSRSTTRVFESRSFNSIIN--QPTRYQQIMKRLIKRYVLRAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 823          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 53.5286 bits (127), Expect = 1.068e-8
Identity = 32/79 (40.51%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  133 NKIAKIKP----------KSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339
            NK+  I P           + N   HP   T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+
Sbjct:  751 NKVGLINPLHVRVPISEDGNLNHISHPP--TRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 827          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 53.5286 bits (127), Expect = 1.110e-8
Identity = 32/79 (40.51%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  133 NKIAKIKP----------KSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339
            NK+  I P           + N   HP   T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+
Sbjct:  746 NKVGLINPLHVRVPISEDGNLNHISHPP--TRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 822          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 52.373 bits (124), Expect = 2.824e-8
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339
            + N   HP   T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+
Sbjct:  755 NLNHISHPP--TRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 812          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 52.373 bits (124), Expect = 2.854e-8
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339
            + N   HP   T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+
Sbjct:  764 NLNHISHP--PTRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 821          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:MGI Symbol;Acc:MGI:109526])

HSP 1 Score: 58.5362 bits (140), Expect = 1.482e-10
Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R  NF K   R+ + +L          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  779 VYFI---MRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 886          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 53.9138 bits (128), Expect = 6.626e-9
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  714 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 788          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 53.9138 bits (128), Expect = 6.769e-9
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  659 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 733          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 53.9138 bits (128), Expect = 7.141e-9
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  775 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 849          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 53.9138 bits (128), Expect = 7.280e-9
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  774 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 848          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|P34586|TRPL_CAEEL (Transient-receptor-potential-like protein OS=Caenorhabditis elegans OX=6239 GN=trp-1 PE=2 SV=3)

HSP 1 Score: 65.4698 bits (158), Expect = 3.815e-12
Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402
            Y D+I  LV R+I + KK M+ DGV+EDDL EIKQDISSLR+ELR+   ++      ++  ++++IM+
Sbjct:  763 YADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMR 830          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q13507|TRPC3_HUMAN (Short transient receptor potential channel 3 OS=Homo sapiens OX=9606 GN=TRPC3 PE=1 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 5.081e-10
Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R VNF K   R+ + ++          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  705 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 812          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9QZC1|TRPC3_MOUSE (Short transient receptor potential channel 3 OS=Mus musculus OX=10090 GN=Trpc3 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.224e-9
Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R  NF K   R+ + +L          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  705 VYFI---MRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 812          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9JMI9|TRPC3_RAT (Short transient receptor potential channel 3 OS=Rattus norvegicus OX=10116 GN=Trpc3 PE=2 SV=3)

HSP 1 Score: 58.5362 bits (140), Expect = 1.248e-9
Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 1
Query:   37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            VYF+    R  NF K   R+ + +L          +N  T SN+++   +  SFNS L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E   Q
Sbjct:  705 VYFI---MRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 812          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9HCX4|TRPC7_HUMAN (Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.760e-8
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            S+ T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L ++  K+ 
Sbjct:  775 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 849          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: K9ZTZ5 (TRPC channel (Fragment) OS=Platynereis dumerilii OX=6359 GN=TRPC PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.582e-17
Identity = 42/87 (48.28%), Postives = 59/87 (67.82%), Query Frame = 1
Query:  157 KSFNSQLHPSQT---TCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
             +FN +  P  +     YQDV+R LV+R+I + KK MRQDGV+EDDLLEIKQDISSLR+ELRE   ++      ++  L++EI++  
Sbjct:   17 PTFNGEPIPPNSVERPKYQDVMRRLVSRFIHQWKKQMRQDGVNEDDLLEIKQDISSLRYELREDRKREAARTTGHIDNLKREILRSL 103          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: V4AJE2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_153128 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.398e-16
Identity = 41/70 (58.57%), Postives = 50/70 (71.43%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            YQDV+R LV+R I + KK  RQDGV+EDDLLEIKQDISSLR+ELRE   ++  +   NM  LRK+    F
Sbjct:   45 YQDVMRRLVSRLIHQYKKQARQDGVNEDDLLEIKQDISSLRYELREDRKKEHALLTGNMDSLRKDPFGSF 114          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A2T7PNT7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06374 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.755e-16
Identity = 41/70 (58.57%), Postives = 52/70 (74.29%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408
            YQ+V+R L+ RYI + KK +RQDGV+EDDLLEIKQDISSLRFELRE   ++      NM  LR++I + F
Sbjct:  119 YQEVMRRLICRYIHQTKKQLRQDGVNEDDLLEIKQDISSLRFELREDRKREALRSTGNMDNLRRDIRQSF 188          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A1I8I4R7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.251e-16
Identity = 37/70 (52.86%), Postives = 57/70 (81.43%), Query Frame = 1
Query:  193 TCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402
            TC Q+V++ LV+RYI++ KK+MRQDGV+EDDLLEIKQDISSLRFELRE   ++ +    ++  +++++++
Sbjct:  731 TCLQEVMQRLVSRYIYQTKKAMRQDGVNEDDLLEIKQDISSLRFELREDRRREVQRSTGHLNNIKRDLIR 800          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A3S3R2L6 (Transient receptor potential ion channel subfamily C trp-1-like splice variant A OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_09012 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.317e-15
Identity = 48/128 (37.50%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   25 YGLCVYFLKTSQRFVNFLKITYRKFRGELI--NDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402
            Y + +      + F NF K T+R++R +    ++I  N K+A     + N +    Q   Y++V++ LV RYI+  KK MR DGV+EDDLLEIKQDISSLRFELRE+  ++    +  +  +++++++
Sbjct:   14 YNIIISPKSAVKAFGNF-KNTFREWRNKSKKQSNIERNEKVA-----TKNKKEKLKQLIHYKEVMKRLVCRYIYSRKKQMRADGVNEDDLLEIKQDISSLRFELREERKREAARMLTKLDSIKRDLIR 135          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748])

HSP 1 Score: 55.8398 bits (133), Expect = 1.287e-9
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = 1
Query:  127 SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            SN ++A+    SF+S L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  808 SNMRMAE--SNSFSSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 877          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc7a (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:103035292])

HSP 1 Score: 55.8398 bits (133), Expect = 1.300e-9
Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  178 HPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402
            HP++   YQ +++ L+ RY+ KA+     D ++E +L EIKQDISSLR+EL E+  Q  +     +Q L   + K
Sbjct:  829 HPTR---YQKLMKRLIKRYVLKAQTDSENDEINEGELKEIKQDISSLRYELLEEKSQATEELADLIQQLGDRLSK 900          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748])

HSP 1 Score: 55.4546 bits (132), Expect = 1.420e-9
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = 1
Query:  127 SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            SN ++A+    SF+S L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  825 SNMRMAE--SNSFSSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 894          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748])

HSP 1 Score: 55.4546 bits (132), Expect = 1.452e-9
Identity = 36/90 (40.00%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  127 SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEI 396
            SN ++A+    SF+S L+  Q T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q  +     +Q L +++
Sbjct:  761 SNMRMAE--SNSFSSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQATEELSMLIQKLSEKV 846          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754])

HSP 1 Score: 55.4546 bits (132), Expect = 1.748e-9
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  193 TCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405
            T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q        +Q L  +  K+
Sbjct:  902 TRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATAELANLIQQLSDKFGKN 972          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 54.6842 bits (130), Expect = 6.452e-10
Identity = 40/113 (35.40%), Postives = 62/113 (54.87%), Query Frame = 1
Query:   88 YRKFRGELINDITSNNKIAKIKP-------------KSFNS-QLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYL 384
            +RK +G+L  D+  +   AK KP             +S NS   HP++   YQ +++ L+ RY+ KA+     D V+E +L +IKQDISSLR+EL E+  Q+ +     +Q L
Sbjct:  680 WRKHKGKL--DVEMDMLDAKAKPNTLTQRALRSNMNRSMNSIGQHPTR---YQQIMKRLIKRYVLKAQFDKENDEVNEGELKDIKQDISSLRYELLEEKSQNAEDLAAIIQQL 787          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118])

HSP 1 Score: 57.3806 bits (137), Expect = 2.837e-10
Identity = 34/105 (32.38%), Postives = 53/105 (50.48%), Query Frame = 1
Query:   46 LKTSQRFVNFLKITYRKFRGEL----INDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            L+T    ++  K   R    EL    +N    + + +    + F  +      T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  878 LRTKCCLIHLCKANGRHHSNELEMGKLNSQAKDERFSSRPGEEFTQRKSRKHPTRYQKIMKRLIKRYVLKAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQ 982          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118])

HSP 1 Score: 57.3806 bits (137), Expect = 3.629e-10
Identity = 34/105 (32.38%), Postives = 53/105 (50.48%), Query Frame = 1
Query:   46 LKTSQRFVNFLKITYRKFRGEL----INDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            L+T    ++  K   R    EL    +N    + + +    + F  +      T YQ +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  823 LRTKCCLIHLCKANGRHHSNELEMGKLNSQAKDERFSSRPGEEFTQRKSRKHPTRYQKIMKRLIKRYVLKAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQ 927          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118])

HSP 1 Score: 56.225 bits (134), Expect = 9.273e-10
Identity = 37/107 (34.58%), Postives = 58/107 (54.21%), Query Frame = 1
Query:   46 LKTSQRFVNFLKITYRKFRGEL-INDITSNNKIAK-----IKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348
            L+T    ++  K   R    EL +  + S  K++K     + P ++ S  HPS    +  +++ L+ RY+ KA+     D V+E +L EIKQDISSLR+EL E+  Q
Sbjct:  746 LRTKCCLIHLCKANGRHHSNELEMGKLNSQAKVSKSSLILLFPLTYLSSGHPS---VFSKIMKRLIKRYVLKAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQ 849          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: TRPC6 (short transient receptor potential channel 6 [Source:NCBI gene;Acc:101172353])

HSP 1 Score: 51.9878 bits (123), Expect = 2.071e-8
Identity = 24/52 (46.15%), Postives = 35/52 (67.31%), Query Frame = 1
Query:  202 QDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDK 357
            Q  ++ L+ RYI KA+     D ++E +L EIKQDISSLR+EL E+  Q+ +
Sbjct:  726 QKTMKRLIKRYIIKAQADRESDEITEGELKEIKQDISSLRYELLEEKSQNSE 777          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: TRPC6 (short transient receptor potential channel 6 [Source:NCBI gene;Acc:101169223])

HSP 1 Score: 51.2174 bits (121), Expect = 3.958e-8
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  172 QLHPSQ-TTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405
            +L PS  +T +Q ++  LV R+I KA+        +E +L +IKQDISSLR+EL E+  ++ K   + +Q LR+ + ++
Sbjct:  725 ELKPSLISTRHQKIMSCLVKRFILKAQTDKENSEGNEAELKKIKQDISSLRYELLERRTREQKTMSELVQELREVLQEE 803          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 50.8322 bits (120), Expect = 4.388e-8
Identity = 23/44 (52.27%), Postives = 32/44 (72.73%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFEL 330
            YQ V+ +L+ RY+   +K+   +GV+EDDL EIK DIS+ RFEL
Sbjct:  760 YQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFEL 803          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 50.8322 bits (120), Expect = 4.517e-8
Identity = 23/44 (52.27%), Postives = 32/44 (72.73%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFEL 330
            YQ V+ +L+ RY+   +K+   +GV+EDDL EIK DIS+ RFEL
Sbjct:  763 YQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFEL 806          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000078533.1 (SMESG000078533.1)

HSP 1 Score: 50.0618 bits (118), Expect = 9.205e-8
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336
            +Q V++ L+ RY+ + +K+    GV+EDDL EIK DISS RFEL E
Sbjct:  771 HQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIE 816          
The following BLAST results are available for this feature:
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC39.980e-1139.13transient receptor potential cation channel subfam... [more]
TRPC31.022e-1039.13transient receptor potential cation channel subfam... [more]
TRPC31.039e-1039.13transient receptor potential cation channel subfam... [more]
TRPC79.287e-940.00transient receptor potential cation channel subfam... [more]
TRPC79.486e-940.00transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trp-12.999e-1347.06Transient-receptor-potential-like protein [Source... [more]
trp-13.152e-1347.06Transient-receptor-potential-like protein [Source... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp9.523e-941.94gene:FBgn0003861 transcript:FBtr0085513[more]
Trpgamma9.390e-850.00gene:FBgn0032593 transcript:FBtr0335144[more]
Trpgamma1.011e-750.00gene:FBgn0032593 transcript:FBtr0080945[more]
Trpgamma1.011e-750.00gene:FBgn0032593 transcript:FBtr0080946[more]
trpl8.915e-639.13gene:FBgn0005614 transcript:FBtr0088471[more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc32.652e-1050.79transient receptor potential cation channel, subfa... [more]
trpc6a3.140e-1041.10transient receptor potential cation channel, subfa... [more]
trpc6a3.140e-1041.10transient receptor potential cation channel, subfa... [more]
trpc35.355e-1050.79transient receptor potential cation channel, subfa... [more]
trpc6b4.929e-936.79transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC31.053e-935.51transient receptor potential cation channel, subfa... [more]
nup1881.068e-840.51nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1881.110e-840.51nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1882.824e-846.67nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1882.854e-846.67nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpc31.482e-1039.13transient receptor potential cation channel, subfa... [more]
Trpc76.626e-940.00transient receptor potential cation channel, subfa... [more]
Trpc76.769e-940.00transient receptor potential cation channel, subfa... [more]
Trpc77.141e-940.00transient receptor potential cation channel, subfa... [more]
Trpc77.280e-940.00transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34586|TRPL_CAEEL3.815e-1247.06Transient-receptor-potential-like protein OS=Caeno... [more]
sp|Q13507|TRPC3_HUMAN5.081e-1039.13Short transient receptor potential channel 3 OS=Ho... [more]
sp|Q9QZC1|TRPC3_MOUSE1.224e-939.13Short transient receptor potential channel 3 OS=Mu... [more]
sp|Q9JMI9|TRPC3_RAT1.248e-939.13Short transient receptor potential channel 3 OS=Ra... [more]
sp|Q9HCX4|TRPC7_HUMAN4.760e-840.00Short transient receptor potential channel 7 OS=Ho... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K9ZTZ57.582e-1748.28TRPC channel (Fragment) OS=Platynereis dumerilii O... [more]
V4AJE21.398e-1658.57Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7PNT72.755e-1658.57Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1I8I4R75.251e-1652.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S3R2L62.317e-1537.50Transient receptor potential ion channel subfamily... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc31.287e-945.95transient receptor potential cation channel subfam... [more]
trpc7a1.300e-938.67short transient receptor potential channel 7-like ... [more]
trpc31.420e-945.95transient receptor potential cation channel subfam... [more]
trpc31.452e-940.00transient receptor potential cation channel subfam... [more]
TRPC71.748e-940.85transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trpc36.452e-1035.40transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc7b2.837e-1032.38short transient receptor potential channel 7-like ... [more]
trpc7b3.629e-1032.38short transient receptor potential channel 7-like ... [more]
trpc7b9.273e-1034.58short transient receptor potential channel 7-like ... [more]
TRPC62.071e-846.15short transient receptor potential channel 6 [Sour... [more]
TRPC63.958e-836.71short transient receptor potential channel 6 [Sour... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000039904.14.388e-852.27SMESG000039904.1[more]
SMESG000039904.14.517e-852.27SMESG000039904.1[more]
SMESG000078533.19.205e-852.17SMESG000078533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002172 ID=SMED30002172|Name=Transient-receptor-potential-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=408bp
ACATTAATTAGCAGCAAGTGGATATATGGACTATGTGTATATTTTCTAAA
AACTTCCCAGAGATTTGTGAATTTCTTGAAGATTACTTACAGAAAATTCC
GAGGAGAACTTATAAATGATATTACTTCGAATAACAAAATTGCAAAAATC
AAACCAAAAAGCTTTAACTCACAGTTGCACCCATCGCAAACCACTTGCTA
TCAGGATGTTATCAGAAGTTTGGTAACTCGATATATTTTTAAAGCAAAGA
AAAGTATGAGGCAAGATGGAGTAAGTGAAGATGATCTGCTGGAAATTAAA
CAAGATATCTCCAGTTTACGATTTGAATTGCGCGAGAAAGCGGTTCAAGA
TGATAAAATGTTTATGAAAAATATGCAATATCTCAGAAAAGAAATCATGA
AAGATTTT
back to top

protein sequence of SMED30002172-orf-1

>SMED30002172-orf-1 ID=SMED30002172-orf-1|Name=SMED30002172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp
TLISSKWIYGLCVYFLKTSQRFVNFLKITYRKFRGELINDITSNNKIAKI
KPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIK
QDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
Vocabulary: INTERPRO
TermDefinition
IPR002153TRPC_channel
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
GO:0005262calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0070588calcium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 60..114
NoneNo IPR availablePANTHERPTHR10117:SF73coord: 60..114