Transient-receptor-potential-like protein
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30002172 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335]) HSP 1 Score: 59.6918 bits (143), Expect = 9.980e-11 Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R VNF K R+ + ++ +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 790 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 897
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335]) HSP 1 Score: 59.6918 bits (143), Expect = 1.022e-10 Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R VNF K R+ + ++ +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 662 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 769
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335]) HSP 1 Score: 59.6918 bits (143), Expect = 1.039e-10 Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R VNF K R+ + ++ +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 717 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 824
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754]) HSP 1 Score: 53.9138 bits (128), Expect = 9.287e-9 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 714 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 788
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754]) HSP 1 Score: 53.9138 bits (128), Expect = 9.486e-9 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 659 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 733
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586]) HSP 1 Score: 65.4698 bits (158), Expect = 2.999e-13 Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402 Y D+I LV R+I + KK M+ DGV+EDDL EIKQDISSLR+ELR+ ++ ++ ++++IM+ Sbjct: 763 YADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMR 830
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586]) HSP 1 Score: 65.4698 bits (158), Expect = 3.152e-13 Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402 Y D+I LV R+I + KK M+ DGV+EDDL EIKQDISSLR+ELR+ ++ ++ ++++IM+ Sbjct: 783 YADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMR 850
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trp (gene:FBgn0003861 transcript:FBtr0085513) HSP 1 Score: 53.1434 bits (126), Expect = 9.523e-9 Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 1 Query: 151 KPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336 + KSF + T + V++ LV RYI ++ G++EDD++E++QDISSLRFEL E Sbjct: 718 RTKSFMRKSMERAQTLHDKVMKLLVRRYITAEQRRRDDYGITEDDIIEVRQDISSLRFELLE 779
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0335144) HSP 1 Score: 50.0618 bits (118), Expect = 9.390e-8 Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336 YQ ++R+LV RY+ ++ GV+EDD+ EIKQDIS+ R EL E Sbjct: 799 YQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVE 844
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945) HSP 1 Score: 50.0618 bits (118), Expect = 1.011e-7 Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336 YQ ++R+LV RY+ ++ GV+EDD+ EIKQDIS+ R EL E Sbjct: 738 YQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVE 783
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946) HSP 1 Score: 50.0618 bits (118), Expect = 1.011e-7 Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336 YQ ++R+LV RY+ ++ GV+EDD+ EIKQDIS+ R EL E Sbjct: 738 YQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVE 783
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471) HSP 1 Score: 44.669 bits (104), Expect = 8.915e-6 Identity = 18/46 (39.13%), Postives = 32/46 (69.57%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336 Y +++RSLV RY+ + + VSEDD+ E+K +I+++R+E+ E Sbjct: 742 YDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLE 787
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1]) HSP 1 Score: 57.7658 bits (138), Expect = 2.652e-10 Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 318 SFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 378
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114]) HSP 1 Score: 57.7658 bits (138), Expect = 3.140e-10 Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 1 Query: 187 QTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405 +++ YQ +++ LV RYI KA+ D V+E +L EIKQDISSLR+EL E+ + + K ++ L K + +D Sbjct: 795 RSSRYQKIMKRLVKRYIIKAQNDKECDEVNEGELKEIKQDISSLRYELLEEKSHNMEELAKLVRTLEKNLSQD 867
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114]) HSP 1 Score: 57.7658 bits (138), Expect = 3.140e-10 Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 1 Query: 187 QTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405 +++ YQ +++ LV RYI KA+ D V+E +L EIKQDISSLR+EL E+ + + K ++ L K + +D Sbjct: 795 RSSRYQKIMKRLVKRYIIKAQNDKECDEVNEGELKEIKQDISSLRYELLEEKSHNMEELAKLVRTLEKNLSQD 867
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1]) HSP 1 Score: 56.9954 bits (136), Expect = 5.355e-10 Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 816 SFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 876
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc6b (transient receptor potential cation channel, subfamily C, member 6b [Source:ZFIN;Acc:ZDB-GENE-081030-19]) HSP 1 Score: 54.299 bits (129), Expect = 4.929e-9 Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1 Query: 46 LKTSQRFVNFLKITYRKFRGELINDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFE-LREKAVQDDKM 360 + + R L I + + +L D T N+ K K S + H S+ YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLRFE L EK+ Q +++ Sbjct: 699 ISLAMRLKRLLLIPLHRHKEDLKED-TELNESGKQKESSEKNSPHTSR---YQRIMKRLIKRYVIKAQTDKEGDEVNEGELKEIKQDISSLRFELLEEKSRQTEEL 800
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: TRPC3 (transient receptor potential cation channel, subfamily C, member 3 [Source:NCBI gene;Acc:100490905]) HSP 1 Score: 56.6102 bits (135), Expect = 1.053e-9 Identity = 38/107 (35.51%), Postives = 60/107 (56.07%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL---INDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ + +N K R+ + + + D S + + +SFNS ++ Q T YQ +++ L+ RY+ +A+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 722 VYFI---LKIINLFKCRRRRLQKDTEIGMGDSKSRSTTRVFESRSFNSIIN--QPTRYQQIMKRLIKRYVLRAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 823
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085]) HSP 1 Score: 53.5286 bits (127), Expect = 1.068e-8 Identity = 32/79 (40.51%), Postives = 44/79 (55.70%), Query Frame = 1 Query: 133 NKIAKIKP----------KSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339 NK+ I P + N HP T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Sbjct: 751 NKVGLINPLHVRVPISEDGNLNHISHPP--TRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 827
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085]) HSP 1 Score: 53.5286 bits (127), Expect = 1.110e-8 Identity = 32/79 (40.51%), Postives = 44/79 (55.70%), Query Frame = 1 Query: 133 NKIAKIKP----------KSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339 NK+ I P + N HP T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Sbjct: 746 NKVGLINPLHVRVPISEDGNLNHISHPP--TRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 822
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085]) HSP 1 Score: 52.373 bits (124), Expect = 2.824e-8 Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 1 Query: 160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339 + N HP T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Sbjct: 755 NLNHISHPP--TRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 812
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085]) HSP 1 Score: 52.373 bits (124), Expect = 2.854e-8 Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 1 Query: 160 SFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREK 339 + N HP T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Sbjct: 764 NLNHISHP--PTRYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEE 821
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:MGI Symbol;Acc:MGI:109526]) HSP 1 Score: 58.5362 bits (140), Expect = 1.482e-10 Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R NF K R+ + +L +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 779 VYFI---MRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 886
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470]) HSP 1 Score: 53.9138 bits (128), Expect = 6.626e-9 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 714 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 788
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470]) HSP 1 Score: 53.9138 bits (128), Expect = 6.769e-9 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 659 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 733
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470]) HSP 1 Score: 53.9138 bits (128), Expect = 7.141e-9 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 775 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 849
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470]) HSP 1 Score: 53.9138 bits (128), Expect = 7.280e-9 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 774 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 848
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|P34586|TRPL_CAEEL (Transient-receptor-potential-like protein OS=Caenorhabditis elegans OX=6239 GN=trp-1 PE=2 SV=3) HSP 1 Score: 65.4698 bits (158), Expect = 3.815e-12 Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402 Y D+I LV R+I + KK M+ DGV+EDDL EIKQDISSLR+ELR+ ++ ++ ++++IM+ Sbjct: 763 YADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMR 830
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q13507|TRPC3_HUMAN (Short transient receptor potential channel 3 OS=Homo sapiens OX=9606 GN=TRPC3 PE=1 SV=3) HSP 1 Score: 59.6918 bits (143), Expect = 5.081e-10 Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R VNF K R+ + ++ +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 705 VYFI---MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 812
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9QZC1|TRPC3_MOUSE (Short transient receptor potential channel 3 OS=Mus musculus OX=10090 GN=Trpc3 PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 1.224e-9 Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R NF K R+ + +L +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 705 VYFI---MRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 812
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9JMI9|TRPC3_RAT (Short transient receptor potential channel 3 OS=Rattus norvegicus OX=10116 GN=Trpc3 PE=2 SV=3) HSP 1 Score: 58.5362 bits (140), Expect = 1.248e-9 Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 1 Query: 37 VYFLKTSQRFVNFLKITYRKFRGEL----------INDIT-SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 VYF+ R NF K R+ + +L +N T SN+++ + SFNS L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E Q Sbjct: 705 VYFI---MRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRV--FESHSFNSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQ 812
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9HCX4|TRPC7_HUMAN (Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 4.760e-8 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 184 SQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 S+ T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L ++ K+ Sbjct: 775 SKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNL 849
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: K9ZTZ5 (TRPC channel (Fragment) OS=Platynereis dumerilii OX=6359 GN=TRPC PE=2 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 7.582e-17 Identity = 42/87 (48.28%), Postives = 59/87 (67.82%), Query Frame = 1 Query: 157 KSFNSQLHPSQT---TCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 +FN + P + YQDV+R LV+R+I + KK MRQDGV+EDDLLEIKQDISSLR+ELRE ++ ++ L++EI++ Sbjct: 17 PTFNGEPIPPNSVERPKYQDVMRRLVSRFIHQWKKQMRQDGVNEDDLLEIKQDISSLRYELREDRKREAARTTGHIDNLKREILRSL 103
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: V4AJE2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_153128 PE=4 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.398e-16 Identity = 41/70 (58.57%), Postives = 50/70 (71.43%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 YQDV+R LV+R I + KK RQDGV+EDDLLEIKQDISSLR+ELRE ++ + NM LRK+ F Sbjct: 45 YQDVMRRLVSRLIHQYKKQARQDGVNEDDLLEIKQDISSLRYELREDRKKEHALLTGNMDSLRKDPFGSF 114
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A2T7PNT7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06374 PE=4 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 2.755e-16 Identity = 41/70 (58.57%), Postives = 52/70 (74.29%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKDF 408 YQ+V+R L+ RYI + KK +RQDGV+EDDLLEIKQDISSLRFELRE ++ NM LR++I + F Sbjct: 119 YQEVMRRLICRYIHQTKKQLRQDGVNEDDLLEIKQDISSLRFELREDRKREALRSTGNMDNLRRDIRQSF 188
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A1I8I4R7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 5.251e-16 Identity = 37/70 (52.86%), Postives = 57/70 (81.43%), Query Frame = 1 Query: 193 TCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402 TC Q+V++ LV+RYI++ KK+MRQDGV+EDDLLEIKQDISSLRFELRE ++ + ++ +++++++ Sbjct: 731 TCLQEVMQRLVSRYIYQTKKAMRQDGVNEDDLLEIKQDISSLRFELREDRRREVQRSTGHLNNIKRDLIR 800
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A3S3R2L6 (Transient receptor potential ion channel subfamily C trp-1-like splice variant A OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_09012 PE=4 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 2.317e-15 Identity = 48/128 (37.50%), Postives = 78/128 (60.94%), Query Frame = 1 Query: 25 YGLCVYFLKTSQRFVNFLKITYRKFRGELI--NDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402 Y + + + F NF K T+R++R + ++I N K+A + N + Q Y++V++ LV RYI+ KK MR DGV+EDDLLEIKQDISSLRFELRE+ ++ + + +++++++ Sbjct: 14 YNIIISPKSAVKAFGNF-KNTFREWRNKSKKQSNIERNEKVA-----TKNKKEKLKQLIHYKEVMKRLVCRYIYSRKKQMRADGVNEDDLLEIKQDISSLRFELREERKREAARMLTKLDSIKRDLIR 135
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748]) HSP 1 Score: 55.8398 bits (133), Expect = 1.287e-9 Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = 1 Query: 127 SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 SN ++A+ SF+S L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 808 SNMRMAE--SNSFSSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 877
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc7a (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:103035292]) HSP 1 Score: 55.8398 bits (133), Expect = 1.300e-9 Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 178 HPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMK 402 HP++ YQ +++ L+ RY+ KA+ D ++E +L EIKQDISSLR+EL E+ Q + +Q L + K Sbjct: 829 HPTR---YQKLMKRLIKRYVLKAQTDSENDEINEGELKEIKQDISSLRYELLEEKSQATEELADLIQQLGDRLSK 900
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748]) HSP 1 Score: 55.4546 bits (132), Expect = 1.420e-9 Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = 1 Query: 127 SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 SN ++A+ SF+S L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 825 SNMRMAE--SNSFSSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQ 894
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748]) HSP 1 Score: 55.4546 bits (132), Expect = 1.452e-9 Identity = 36/90 (40.00%), Postives = 56/90 (62.22%), Query Frame = 1 Query: 127 SNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEI 396 SN ++A+ SF+S L+ Q T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q + +Q L +++ Sbjct: 761 SNMRMAE--SNSFSSILN--QPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEEKSQATEELSMLIQKLSEKV 846
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754]) HSP 1 Score: 55.4546 bits (132), Expect = 1.748e-9 Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1 Query: 193 TCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405 T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q +Q L + K+ Sbjct: 902 TRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATAELANLIQQLSDKFGKN 972
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1]) HSP 1 Score: 54.6842 bits (130), Expect = 6.452e-10 Identity = 40/113 (35.40%), Postives = 62/113 (54.87%), Query Frame = 1 Query: 88 YRKFRGELINDITSNNKIAKIKP-------------KSFNS-QLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYL 384 +RK +G+L D+ + AK KP +S NS HP++ YQ +++ L+ RY+ KA+ D V+E +L +IKQDISSLR+EL E+ Q+ + +Q L Sbjct: 680 WRKHKGKL--DVEMDMLDAKAKPNTLTQRALRSNMNRSMNSIGQHPTR---YQQIMKRLIKRYVLKAQFDKENDEVNEGELKDIKQDISSLRYELLEEKSQNAEDLAAIIQQL 787
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118]) HSP 1 Score: 57.3806 bits (137), Expect = 2.837e-10 Identity = 34/105 (32.38%), Postives = 53/105 (50.48%), Query Frame = 1 Query: 46 LKTSQRFVNFLKITYRKFRGEL----INDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 L+T ++ K R EL +N + + + + F + T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 878 LRTKCCLIHLCKANGRHHSNELEMGKLNSQAKDERFSSRPGEEFTQRKSRKHPTRYQKIMKRLIKRYVLKAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQ 982
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118]) HSP 1 Score: 57.3806 bits (137), Expect = 3.629e-10 Identity = 34/105 (32.38%), Postives = 53/105 (50.48%), Query Frame = 1 Query: 46 LKTSQRFVNFLKITYRKFRGEL----INDITSNNKIAKIKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 L+T ++ K R EL +N + + + + F + T YQ +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 823 LRTKCCLIHLCKANGRHHSNELEMGKLNSQAKDERFSSRPGEEFTQRKSRKHPTRYQKIMKRLIKRYVLKAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQ 927
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118]) HSP 1 Score: 56.225 bits (134), Expect = 9.273e-10 Identity = 37/107 (34.58%), Postives = 58/107 (54.21%), Query Frame = 1 Query: 46 LKTSQRFVNFLKITYRKFRGEL-INDITSNNKIAK-----IKPKSFNSQLHPSQTTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQ 348 L+T ++ K R EL + + S K++K + P ++ S HPS + +++ L+ RY+ KA+ D V+E +L EIKQDISSLR+EL E+ Q Sbjct: 746 LRTKCCLIHLCKANGRHHSNELEMGKLNSQAKVSKSSLILLFPLTYLSSGHPS---VFSKIMKRLIKRYVLKAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQ 849
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: TRPC6 (short transient receptor potential channel 6 [Source:NCBI gene;Acc:101172353]) HSP 1 Score: 51.9878 bits (123), Expect = 2.071e-8 Identity = 24/52 (46.15%), Postives = 35/52 (67.31%), Query Frame = 1 Query: 202 QDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDK 357 Q ++ L+ RYI KA+ D ++E +L EIKQDISSLR+EL E+ Q+ + Sbjct: 726 QKTMKRLIKRYIIKAQADRESDEITEGELKEIKQDISSLRYELLEEKSQNSE 777
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: TRPC6 (short transient receptor potential channel 6 [Source:NCBI gene;Acc:101169223]) HSP 1 Score: 51.2174 bits (121), Expect = 3.958e-8 Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 1 Query: 172 QLHPSQ-TTCYQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELREKAVQDDKMFMKNMQYLRKEIMKD 405 +L PS +T +Q ++ LV R+I KA+ +E +L +IKQDISSLR+EL E+ ++ K + +Q LR+ + ++ Sbjct: 725 ELKPSLISTRHQKIMSCLVKRFILKAQTDKENSEGNEAELKKIKQDISSLRYELLERRTREQKTMSELVQELREVLQEE 803
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1) HSP 1 Score: 50.8322 bits (120), Expect = 4.388e-8 Identity = 23/44 (52.27%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFEL 330 YQ V+ +L+ RY+ +K+ +GV+EDDL EIK DIS+ RFEL Sbjct: 760 YQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFEL 803
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1) HSP 1 Score: 50.8322 bits (120), Expect = 4.517e-8 Identity = 23/44 (52.27%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFEL 330 YQ V+ +L+ RY+ +K+ +GV+EDDL EIK DIS+ RFEL Sbjct: 763 YQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFEL 806
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000078533.1 (SMESG000078533.1) HSP 1 Score: 50.0618 bits (118), Expect = 9.205e-8 Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 199 YQDVIRSLVTRYIFKAKKSMRQDGVSEDDLLEIKQDISSLRFELRE 336 +Q V++ L+ RY+ + +K+ GV+EDDL EIK DISS RFEL E Sbjct: 771 HQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIE 816 The following BLAST results are available for this feature:
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 2
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 1
BLAST of Transient-receptor-potential-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 5
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30002172 ID=SMED30002172|Name=Transient-receptor-potential-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=408bpback to top protein sequence of SMED30002172-orf-1 >SMED30002172-orf-1 ID=SMED30002172-orf-1|Name=SMED30002172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp TLISSKWIYGLCVYFLKTSQRFVNFLKITYRKFRGELINDITSNNKIAKIback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|