Spondin-1

Overview
NameSpondin-1
Smed IDSMED30002168
Length (bp)2693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spondin-1 (SMED30002168) t-SNE clustered cells

Violin plots show distribution of expression levels for Spondin-1 (SMED30002168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spondin-1 (SMED30002168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spondin-1 (SMED30002168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002168SMESG000039905.1 SmedASXL_015093SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30002168SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002168SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30002168SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002168SMESG000039905.1 dd_Smed_v6_8655_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30002168SMESG000039905.1 OX_Smed_1.0.01644ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30002168SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON1 (spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252])

HSP 1 Score: 154.836 bits (390), Expect = 5.094e-38
Identity = 146/515 (28.35%), Postives = 224/515 (43.50%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            A  TR   YT            Y P  +Y +T+S    +     T+     L  N   + EE       +AG   F +    +T++   CP  A  +    +   +  +WIAP     C+ +   +    +I        +  +CEQ              ST   +  K  P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   A    N R   SA   V+ T+HL+SFL  + PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S     K   +++LK + +  +    T + + C     +     TC+   W  WSPC+ +C   G+  RER
Sbjct:   50 AQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTL---IALRENREGDKEE------DHAG--TFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQD-------------STFDGVTDK--PILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEE-------KDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGM-GMRSRER 526          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 93.2041 bits (230), Expect = 7.699e-20
Identity = 62/188 (32.98%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  668 CNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDA-SSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWP 1219
            C+  + A Y +T   KW+     K +P    + P    +  LGA+HS++++++      + G+      G    L K+   AG  + +V    S  A  S T + SA + V     LVSF+ R+ PSPDW  G+   DLC+G  +W+E+  + LYP+DAG  SG T+ + N  T  Q  +  ITSS P
Sbjct:   35 CSARALAKYSITFTGKWSQTAFPKQYPL---FRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGD-RWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP 218          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 93.2041 bits (230), Expect = 7.699e-20
Identity = 62/188 (32.98%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  668 CNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDA-SSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWP 1219
            C+  + A Y +T   KW+     K +P    + P    +  LGA+HS++++++      + G+      G    L K+   AG  + +V    S  A  S T + SA + V     LVSF+ R+ PSPDW  G+   DLC+G  +W+E+  + LYP+DAG  SG T+ + N  T  Q  +  ITSS P
Sbjct:   35 CSARALAKYSITFTGKWSQTAFPKQYPL---FRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGD-RWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP 218          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 93.2041 bits (230), Expect = 7.699e-20
Identity = 62/188 (32.98%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  668 CNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDA-SSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWP 1219
            C+  + A Y +T   KW+     K +P    + P    +  LGA+HS++++++      + G+      G    L K+   AG  + +V    S  A  S T + SA + V     LVSF+ R+ PSPDW  G+   DLC+G  +W+E+  + LYP+DAG  SG T+ + N  T  Q  +  ITSS P
Sbjct:   35 CSARALAKYSITFTGKWSQTAFPKQYPL---FRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGD-RWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP 218          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPINT1 (serine peptidase inhibitor, Kunitz type 1 [Source:HGNC Symbol;Acc:HGNC:11246])

HSP 1 Score: 74.3294 bits (181), Expect = 4.515e-14
Identity = 45/123 (36.59%), Postives = 63/123 (51.22%), Query Frame = 2
Query: 1823 RFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPET----------YPNRCG--VSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            R+YYD +   C +F+Y GC G  NN+   EECIL CR     + +RR   P+T          +P+  G  V +     C  + S  RWYY+  ++ C RF +GGC GN NNF  + +C   C
Sbjct:   83 RWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGVQGPSMERRH--PDTSGFDELQRIHFPSDKGHCVDLPDTGLC--KESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESC 201          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: spon-1 (SPONdin (Extracellular matrix glycoprotein) family [Source:UniProtKB/TrEMBL;Acc:Q19305])

HSP 1 Score: 147.902 bits (372), Expect = 2.708e-36
Identity = 163/665 (24.51%), Postives = 275/665 (41.35%), Query Frame = 2
Query:  212 SYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEYCPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTR-QTPICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLTNTES--CSSK---CSTVISFET-CSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCK--PDVICKEYVYPGDS-CSWSSP------SQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCL 2158
             ++P + Y +++    +    + T+K     V +   E +  S   W    +VV     A  +  C Q             V   W AP++ + C+     +     I  ++ E  +  +C QK  ++              +K   DP   C     A Y +     W+   H KD+P  +  +   T  LG+SHS+ ++++ +GG++ +G+ ++   G+  + + +     + + +++  + L          +  VVN   H VS      PSPDWC GLS  +LC   C W E+    L P+DAG  SG TY++ NE T  + PI  IT+     +PF   N K   I  +   +++  N   ++ C S + IL+ EA+ N   +S  +   D+ R C++++W  WS CS +CGKG + R R  +     Q        TE   C++K   C    +F + C    WG W  C+  C   G+  R R F+N   K         +  +      + C   PD +CK   +   S CS S        ++ F+Y      C             N    + C++    +  E +       +    +C      G F        R++Y++   +C RF F GC+GN N F T+ EC+ +CL
Sbjct:   62 GFVPGEIYKVSI----RGWRTQYTVKTFRGFVVSSLFE-DNTSAGSW----QVVKGHGDARISPGCRQSGVSHANLKSKTSVHMMWKAPEVSSGCVVFRASVIETKYIWFTEAEGLTVKLCIQKGTQI--------------LKPVDDPSATCCACDIAQYDLEFTGIWSKNTHPKDYPTLEHLT-HFTDMLGSSHSSNYSLWTIGGISTDGMKEIAEWGNTYKAEAEAKAKASEVRSLMKVKGLWFPDVQGTTKSQFVVNKYHHFVSLATMFGPSPDWCVGLSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREPIHWITTKLNPLSPF--YNSKSDTIPTLAKVILRRKNVTSSE-CKS-DDILKAEAH-NITNTSEDEEYKDR-RECMMTQWEPWSLCSATCGKGIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAKINECENSEAFSSKCQVSSWGSWGECSVQCGH-GMRSRNRTFLNPATKSGDCSVDLERKDICVGENGDDCNVTPDPLCKTTAWSDWSPCSASCDEGVRVRTRLFFYSEHEKRCMHV----------NLQEKDTCVMQSCRRFIEINSEEICQEDKQAGQCA-----GNF-------PRYWYNHEKTQCERFIFTGCKGNRNQFETEEECKQICL 673          

HSP 2 Score: 62.7734 bits (151), Expect = 1.125e-9
Identity = 39/121 (32.23%), Postives = 59/121 (48.76%), Query Frame = 2
Query: 1586 CSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASER----CKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRP 1936
            C    W  WSPC+A+C + G+  R R+F   + +  CM  + ++    C + S R       + IC+E    G  C+ + P  R++Y+     C  FI+ GC G  N F T EEC  +C P
Sbjct:  559 CKTTAWSDWSPCSASCDE-GVRVRTRLFFYSEHEKRCMHVN-LQEKDTCVMQSCRRFIEINSEEICQEDKQAGQ-CAGNFP--RYWYNHEKTQCERFIFTGCKGNRNQFETEEECKQICLP 674          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: E01G6.1 (pep chromosome:WBcel235:X:12260881:12266537:1 gene:WBGene00008449.1 transcript:E01G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E01G6.1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.554e-11
Identity = 46/165 (27.88%), Postives = 67/165 (40.61%), Query Frame = 2
Query: 1757 PDVICKEYVYPGDSCSWSSPS-QRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCR-----------------------------PKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLR 2161
            P++ C E V  G  C     + QRFY++ S+  C  F Y GC G  NNF T ++C   C                              P   E +   +  P +  N C  +M+ G  C   +  + W+YD   K+C +F + GC G  N F TK  C   C++
Sbjct:  434 PELTCNEMVSAGTPCFGRGLTIQRFYFNPSTQKCQPFHYYGCSGNGNNFETVDQCQNFCLHSADSACDGLVPLKNPNSELQRCSEEDPCPAGYECNDSSYCCPSSE-NACNANMSRGNGCKGSTQRSMWFYDKSKKKCSQFVYNGCGGTPNRFTTKVACTESCVQ 597          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: Y55F3BR.2 (pep chromosome:WBcel235:IV:862099:874724:1 gene:WBGene00021939.1 transcript:Y55F3BR.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3BR.2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.788e-11
Identity = 58/225 (25.78%), Postives = 93/225 (41.33%), Query Frame = 2
Query: 1592 FRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERC--KPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCR-----PKLKET------------------------------DQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            F  +   + C   C++    H   +         C + ++  ++  CA+  + C   P  +C E +  GD C  S   ++F+Y+  + TC +F+Y GC G  N F++  EC   C+     PK  +                               D   +    +    C + +  GI C S  SS R+YY+N  KEC  + F GC GN+NNF +  +CQN C
Sbjct:  190 FNNFQNQADCQLFCARLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCPTPQTLCTEPLRVGD-CKQSV--RQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYCKNINAEPKCPQGRAYVDFSGKFMQCGEGLGGTACPANYECTFDGLVYGCCPSKAYTCSLQVNKGIGCGS-GSSYRYYYNNQAKECQSYLFLGCDGNSNNFPSIEKCQNYC 410          

HSP 2 Score: 53.9138 bits (128), Expect = 5.903e-7
Identity = 37/137 (27.01%), Postives = 56/137 (40.88%), Query Frame = 2
Query: 1817 SQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCG----------VSMTWGIFC--------------DSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            S R+YY+ + G C+ F + G  G  NNF    +C L C  +L+             P RC            +M   + C              D + S  +++Y+   K C  F + GC+GN N F +  ECQ+ C
Sbjct:  166 STRYYYNPTDGQCHPFTFNGFLGNFNNFQNQADCQLFCA-RLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCPTPQTLCTEPLRVGDCKQSVRQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYC 301          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: Y55F3BR.2 (pep chromosome:WBcel235:IV:857327:874724:1 gene:WBGene00021939.1 transcript:Y55F3BR.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3BR.2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.961e-11
Identity = 58/225 (25.78%), Postives = 93/225 (41.33%), Query Frame = 2
Query: 1592 FRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERC--KPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCR-----PKLKET------------------------------DQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            F  +   + C   C++    H   +         C + ++  ++  CA+  + C   P  +C E +  GD C  S   ++F+Y+  + TC +F+Y GC G  N F++  EC   C+     PK  +                               D   +    +    C + +  GI C S  SS R+YY+N  KEC  + F GC GN+NNF +  +CQN C
Sbjct:  483 FNNFQNQADCQLFCARLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCPTPQTLCTEPLRVGD-CKQSV--RQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYCKNINAEPKCPQGRAYVDFSGKFMQCGEGLGGTACPANYECTFDGLVYGCCPSKAYTCSLQVNKGIGCGS-GSSYRYYYNNQAKECQSYLFLGCDGNSNNFPSIEKCQNYC 703          

HSP 2 Score: 54.299 bits (129), Expect = 4.752e-7
Identity = 37/137 (27.01%), Postives = 56/137 (40.88%), Query Frame = 2
Query: 1817 SQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCG----------VSMTWGIFC--------------DSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            S R+YY+ + G C+ F + G  G  NNF    +C L C  +L+             P RC            +M   + C              D + S  +++Y+   K C  F + GC+GN N F +  ECQ+ C
Sbjct:  459 STRYYYNPTDGQCHPFTFNGFLGNFNNFQNQADCQLFCA-RLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCPTPQTLCTEPLRVGDCKQSVRQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYC 594          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: Y55F3BR.2 (pep chromosome:WBcel235:IV:858930:874724:1 gene:WBGene00021939.1 transcript:Y55F3BR.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3BR.2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.961e-11
Identity = 58/225 (25.78%), Postives = 93/225 (41.33%), Query Frame = 2
Query: 1592 FRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERC--KPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCR-----PKLKET------------------------------DQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            F  +   + C   C++    H   +         C + ++  ++  CA+  + C   P  +C E +  GD C  S   ++F+Y+  + TC +F+Y GC G  N F++  EC   C+     PK  +                               D   +    +    C + +  GI C S  SS R+YY+N  KEC  + F GC GN+NNF +  +CQN C
Sbjct:  483 FNNFQNQADCQLFCARLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCPTPQTLCTEPLRVGD-CKQSV--RQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYCKNINAEPKCPQGRAYVDFSGKFMQCGEGLGGTACPANYECTFDGLVYGCCPSKAYTCSLQVNKGIGCGS-GSSYRYYYNNQAKECQSYLFLGCDGNSNNFPSIEKCQNYC 703          

HSP 2 Score: 54.299 bits (129), Expect = 4.752e-7
Identity = 37/137 (27.01%), Postives = 56/137 (40.88%), Query Frame = 2
Query: 1817 SQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCG----------VSMTWGIFC--------------DSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            S R+YY+ + G C+ F + G  G  NNF    +C L C  +L+             P RC            +M   + C              D + S  +++Y+   K C  F + GC+GN N F +  ECQ+ C
Sbjct:  459 STRYYYNPTDGQCHPFTFNGFLGNFNNFQNQADCQLFCA-RLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCPTPQTLCTEPLRVGDCKQSVRQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYC 594          
BLAST of Spondin-1 vs. Ensembl Fly
Match: fat-spondin (gene:FBgn0026721 transcript:FBtr0086975)

HSP 1 Score: 133.265 bits (334), Expect = 1.514e-31
Identity = 160/700 (22.86%), Postives = 270/700 (38.57%), Query Frame = 2
Query:  212 SYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEYCPQRA-YVQYLYTQPQ-HVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQY---LGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP--ICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQE---YNKN-DNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKG--KSEQCIES--------------------SLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERC-KPDVICKEYVYPGDSCSWSSPSQRFYYDFS--SGTC--------------NAFIYKGCYGGLNNFHTYEECI--LLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
             Y+P KTY++   L     H K+     + + +  HT          +  G   F +   S T++  +    V      P+  V   W+AP+  + C+ ++ ++        +     S  ICE+K         D  A+            K+C     A Y    E  W+   H KD+P    ++  +T +   +GASH + F+ +    +A  G   +   GS   L+ +    G  + T+I A  L   +     S+   V+     VS ++   PSPDW  G+S  DLC   C W+E     L+PWDAG  SG +Y++ N +T Q P  +  IT+ +P+D      N K + +  +    ++     ++N D+++  ++   + D+A + + ++     +      C +S        S            K  +     E C+ +                    +L N++S     S       C    W  WS C+A+C   GI  R R F+N   +  C   + ++ +        +C +PD   ++   P   C  S      + D+S  S TC              N    + C   +   H  +EC+  + C    ++        P+  P R G  M             R+ YD  N+ CY F +GGCRGN NNF T+ +C N C
Sbjct:   54 GYVPGKTYNLL--LLGSRTHLKVQHFTHFTITAEAHTGARRPQAASPRRVGR--FQLFSDSLTQFNDRCVNTVSEADDLPKTEVQVMWVAPESGSGCVSLSAMVYEGPRAWFADDGNLSTVICERK--------PDAAAAQ-----------KECCACDEAKYSFVFEGIWSNETHPKDYP----FAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAEWGSPAALETELRANGPKLRTLIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSMFGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSET-QPPERMYRITTMYPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTRAECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAAIPECADGPAQSKDRDDDEGENLANSQSLVG--SNGEGAGLCKTSPWSVWSECSASCG-IGITMRTRTFVNHLGRKRCPHITIVEKN--------KCMRPDCTYEQVELPDPQCPTSQ-----WSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRM-ELHQQKECVNPIDCHINAEQAKDICVQAPDPGPCR-GTYM-------------RYAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTC 694          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG17739 (gene:FBgn0033710 transcript:FBtr0087893)

HSP 1 Score: 132.109 bits (331), Expect = 4.411e-31
Identity = 84/294 (28.57%), Postives = 146/294 (49.66%), Query Frame = 2
Query:  452 HVTFYWIAPKIPN---FCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP---ICPITSSWPKD--NPFTVMNG-KIKNIGVVTFQLIQEYNKN 1306
             V  +W+AP  P      +R TV+   +    +  F  +   +CE++ + +D   +              DP   C+    A Y +T E KW+   H KD+P  + +  + +  +GASH+ ++  +  G +A+EG+ +V  +GS   L+ +       I T+I AR +   + T K  A+  V++  HL+S ++ + PSPDW  G+S  +LC  +C W E  + +LYPWDAG  SG +Y++ ++   Q P   +  I S++P D  +PF    G ++K +  +     + Y KN
Sbjct:  122 RVDVFWVAPSSPGQGCILLRATVMQHRDVWFMDDGFLTKR--MCEEEVDDIDTQPS------------IVDPCCACD---EAKYELTFEGKWSRHTHPKDFPA-NSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLESELKDQSEHIRTIIKARGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQP--QVPPDVVRRIKSNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYEKN 395          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30203 (gene:FBgn0050203 transcript:FBtr0273303)

HSP 1 Score: 121.709 bits (304), Expect = 8.914e-28
Identity = 78/273 (28.57%), Postives = 145/273 (53.11%), Query Frame = 2
Query:  452 HVTFYWIAPKIPN-FCIRITV-ILKMNDL--ISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYK-AGNG-IMTVILARSLDASSKTNKRS-ALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP---ICPITSSWPKD--NPF 1234
            ++   WIAP+ P+  C+ I   +++  D+  + +    +R   IC ++ ++++ +               T P++ C     A Y + +E KW    HWKD+P +D +  ++ + +GASHS+ +  +  GG A++G+ ++  +G+   L+ +  +   NG + T+I A  +    KT   + A   ++   H +S  A++ PSPDW  G++  +LC  +C W E+ +++LYPWD G  SG +Y++ +E   Q P   +  ITSS+P D  +PF
Sbjct:  119 YIAVSWIAPRNPDSGCVLIKAGVVQHRDVWFLDDGFLTKR---ICPEEIDELNSL---------------TPPLETCCACDEAKYEIVLERKWARNTHWKDFPSED-WRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEP--QVPPDVVRRITSSYPSDHRSPF 370          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (gene:FBgn0050046 transcript:FBtr0087895)

HSP 1 Score: 114.005 bits (284), Expect = 1.608e-25
Identity = 79/293 (26.96%), Postives = 143/293 (48.81%), Query Frame = 2
Query:  452 HVTFYWIAPKIP-NFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYK--AGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP---ICPITSSWPKD--NPFTVMNG-KIKNIGVVTFQLIQEYNK 1303
            H+   W+AP  P + C+ I   ++ +  +        +  ICE+          D   S   A      P   C+    A Y +  E  W+   H KD+P + G+  +  + LGA+HS+++  +  G +A+  + +   + S   L+++F        I T+I AR     + ++K  A + V+   H+VSF +++ PSPDW  G++  +LC  +C W E+ +++LYPWD G  SG TY + ++   Q P   I  + S +P D  +PF  ++G  +K + ++T +  + Y +
Sbjct:  126 HMHLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEV--------TDDVESQPTAPAAVDVPCCACD---EARYELIFEGVWSRNLHPKDFPTR-GWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQP--QVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYER 404          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (gene:FBgn0050046 transcript:FBtr0339627)

HSP 1 Score: 114.005 bits (284), Expect = 1.608e-25
Identity = 79/293 (26.96%), Postives = 143/293 (48.81%), Query Frame = 2
Query:  452 HVTFYWIAPKIP-NFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYK--AGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP---ICPITSSWPKD--NPFTVMNG-KIKNIGVVTFQLIQEYNK 1303
            H+   W+AP  P + C+ I   ++ +  +        +  ICE+          D   S   A      P   C+    A Y +  E  W+   H KD+P + G+  +  + LGA+HS+++  +  G +A+  + +   + S   L+++F        I T+I AR     + ++K  A + V+   H+VSF +++ PSPDW  G++  +LC  +C W E+ +++LYPWD G  SG TY + ++   Q P   I  + S +P D  +PF  ++G  +K + ++T +  + Y +
Sbjct:  126 HMHLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEV--------TDDVESQPTAPAAVDVPCCACD---EARYELIFEGVWSRNLHPKDFPTR-GWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQP--QVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYER 404          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 152.91 bits (385), Expect = 1.191e-37
Identity = 143/534 (26.78%), Postives = 227/534 (42.51%), Query Frame = 2
Query:  113 GFCDIQFPKSYVA---FSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLI---SESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYR-KLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            GFC I   ++  A       F L    E E      +Y P  TY +++  +  +     T+  +           E +S  D+       F +   S T++   CP  A  + +  +   +  +W AP   + C+ +   +    +I    E    +R   +CE+          D  A T         P ++C    TA YR+T    W+   H KD+P +  +    +  +GASH+  + ++  GG A+EGV QV   GS  +++++  + G+ +MTVI  ++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W +K +  L PWDAG  SG +Y + N+ +  Q  I P+TS     +PF     G +  +G V  + I    +  N   ++I+ I+ D A +        K   D T    +       S   S    +  R R ++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER
Sbjct:   38 GFCRILRTQARSARRDGQNEFRLKVEGEPE------TYQPGSTYRVSLYASSPSYFRGFTLIAL-------KEGREGVSPDDYAG----TFKLIDESDTQFMTNCPP-AVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKR---LCEK----------DPVAITE-------KPAQECCACGTAKYRVTFYGNWSEKLHPKDYPRRANH---WSALIGASHTRSYVLWEYGGFASEGVKQVSEYGSPVKMEEEIRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEE-------KEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRER 522          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 152.91 bits (385), Expect = 1.273e-37
Identity = 143/534 (26.78%), Postives = 227/534 (42.51%), Query Frame = 2
Query:  113 GFCDIQFPKSYVA---FSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLI---SESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYR-KLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            GFC I   ++  A       F L    E E      +Y P  TY +++  +  +     T+  +           E +S  D+       F +   S T++   CP  A  + +  +   +  +W AP   + C+ +   +    +I    E    +R   +CE+          D  A T         P ++C    TA YR+T    W+   H KD+P +  +    +  +GASH+  + ++  GG A+EGV QV   GS  +++++  + G+ +MTVI  ++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W +K +  L PWDAG  SG +Y + N+ +  Q  I P+TS     +PF     G +  +G V  + I    +  N   ++I+ I+ D A +        K   D T    +       S   S    +  R R ++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER
Sbjct:   38 GFCRILRTQARSARRDGQNEFRLKVEGEPE------TYQPGSTYRVSLYASSPSYFRGFTLIAL-------KEGREGVSPDDYAG----TFKLIDESDTQFMTNCPP-AVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKR---LCEK----------DPVAITE-------KPAQECCACGTAKYRVTFYGNWSEKLHPKDYPRRANH---WSALIGASHTRSYVLWEYGGFASEGVKQVSEYGSPVKMEEEIRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEE-------KEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRER 522          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 152.525 bits (384), Expect = 1.491e-37
Identity = 143/534 (26.78%), Postives = 227/534 (42.51%), Query Frame = 2
Query:  113 GFCDIQFPKSYVA---FSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLI---SESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYR-KLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            GFC I   ++  A       F L    E E      +Y P  TY +++  +  +     T+  +           E +S  D+       F +   S T++   CP  A  + +  +   +  +W AP   + C+ +   +    +I    E    +R   +CE+          D  A T         P ++C    TA YR+T    W+   H KD+P +  +    +  +GASH+  + ++  GG A+EGV QV   GS  +++++  + G+ +MTVI  ++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W +K +  L PWDAG  SG +Y + N+ +  Q  I P+TS     +PF     G +  +G V  + I    +  N   ++I+ I+ D A +        K   D T    +       S   S    +  R R ++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER
Sbjct:   38 GFCRILRTQARSARRDGQNEFRLKVEGEPE------TYQPGSTYRVSLYASSPSYFRGFTLIAL-------KEGREGVSPDDYAG----TFKLIDESDTQFMTNCPP-AVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKR---LCEK----------DPVAITE-------KPAQECCACGTAKYRVTFYGNWSEKLHPKDYPRRANH---WSALIGASHTRSYVLWEYGGFASEGVKQVAEYGSPVKMEEEIRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEE-------KEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRER 522          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 149.828 bits (377), Expect = 1.005e-36
Identity = 126/445 (28.31%), Postives = 198/445 (44.49%), Query Frame = 2
Query:  371 VFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLI---SESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYR-KLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
             F +   S T++   CP  A  + +  +   +  +W AP   + C+ +   +    +I    E    +R   +CE+          D  A T         P ++C    TA YR+T    W+   H KD+P +  +    +  +GASH+  + ++  GG A+EGV QV   GS  +++++  + G+ +MTVI  ++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W +K +  L PWDAG  SG +Y + N+ +  Q  I P+TS     +PF     G +  +G V  + I    +  N   ++I+ I+ D A +        K   D T    +       S   S    +  R R ++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER
Sbjct:   73 TFKLIDESDTQFMTNCPP-AVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKR---LCEK----------DPVAITE-------KPAQECCACGTAKYRVTFYGNWSEKLHPKDYPRRANH---WSALIGASHTRSYVLWEYGGFASEGVKQVSEYGSPVKMEEEIRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEE-------KEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRER 485          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 149.828 bits (377), Expect = 1.043e-36
Identity = 152/551 (27.59%), Postives = 240/551 (43.56%), Query Frame = 2
Query:   77 FFILKF----DFAECF-----GFCDIQFPKSYVA---FSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
             FIL F    D AE       GFC I   ++  A       F L    E E      +Y P  TY +++  +  +     T+  +           E +S  D+       F +   S T++   CP  A  + +  +   +  +W AP   + C+ +   +    +I        +  +CE+           +  +  C     T+ VK C  G TA YR+T    W+   H KD+P +  +    +  +GASH+  + ++  GG A+EGV QV   GS  +++++  + G+ +MTVI  ++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W +K +  L PWDAG  SG +Y + N+ +  Q  I P+TS     +PF     G +  +G V  + I    +  N   ++I+ I+ D A +        K   +    C+ S WS WS+CS S     +   +++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER
Sbjct:    2 VFILTFLGLQDTAERHSRSEGGFCRILRTQARSARRDGQNEFRLKVEGEPE------TYQPGSTYRVSLYASSPSYFRGFTLIAL-------KEGREGVSPDDYAG----TFKLIDESDTQFMTNCPP-AVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKRLCEK-----------ESLNEHC-----TNKVKCCACG-TAKYRVTFYGNWSEKLHPKDYPRRANH---WSALIGASHTRSYVLWEYGGFASEGVKQVAEYGSPVKMEEEIRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEE-------KEEDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRER 506          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 151.369 bits (381), Expect = 5.831e-37
Identity = 127/443 (28.67%), Postives = 202/443 (45.60%), Query Frame = 2
Query:  452 HVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKP 1759
             +   W AP I + C+ +   +    +I        +  +CE  R  +                    P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS E+ ++  GG A++GV QV   GS  +++++  + G+ ++TVI A++   A    N R   SA   V+ ++HL+SFLA + PSPDW  GLS  DLC   C W +K I  L PWDAG  SG TY + N+ +  Q  I P+TS     +PF     G I  +  V  + I       N   ++++ I+ D   +        K   D    C+ S WS WS+CS +     K   +++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER ++ +  +   M     + + +C + +E C+P
Sbjct:  134 RIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPDRLGL--------------TGGNEKPIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIARKGDQCNIVPDNVDDIVPDLVTEE-------KEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDEASTCMMSEWITWSPCSASCGM-GMRSRER-YVKQFPEDGSMCKVPTEETEKC-IVNEECEP 549          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 149.828 bits (377), Expect = 1.340e-36
Identity = 145/526 (27.57%), Postives = 229/526 (43.54%), Query Frame = 2
Query:  215 YIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESC-SSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKP 1759
            Y P  TY +T+     A     T+  +         E          +AG   F +     T++   CP  A  +    +   +   W AP I + C+ +   +    +I        +  +CE   N+                     P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS E+ ++  GG A++GV QV   GS  +++++  + G+ ++TVI A++   A    N R   SA   V+ ++HL+SFLA + PSPDW  GLS  DLC   C W +K I  L PWDAG  SG TY + N+ +  Q  I P+TS     +PF     G I  +  V  + I       N   ++++ I+ D   +        K   D    C+ S WS WS+CS +     K   +++LK + +  +    T + E C    CS   S  TC    W  WSPC+A+C   G+  RER ++ +  +   M     + + +C + +E C+P
Sbjct:   67 YKPGNTYRVTLLAASPAYFRGFTLIALKEGKEGEKEE---------DHAG--TFQIIDDEDTQFMSNCPV-AVTESTPRRRTRIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPGGNE--------------------KPIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIARKGDQCNIVPDNVDDIVPDLVTEE-------KEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDAS--TCMMSEWITWSPCSASCGM-GMRSRER-YVKQFPEDGSMCKVPTEETEKC-IVNEECEP 545          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 150.214 bits (378), Expect = 1.367e-36
Identity = 118/375 (31.47%), Postives = 184/375 (49.07%), Query Frame = 2
Query:  656 PVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKP 1759
            P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS E+ ++  GG A++GV QV   GS  +++++  + G+ ++TVI A++   A    N R   SA   V+ ++HL+SFLA + PSPDW  GLS  DLC   C W +K I  L PWDAG  SG TY + N+ +  Q  I P+TS     +PF     G I  +  V  + I       N   ++++ I+ D   +        K   D    C+ S WS WS+CS +     K   +++LK + +  +    T + E C     +     TC    W  WSPC+A+C   G+  RER ++ +  +   M     + + +C + +E C+P
Sbjct:  191 PIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIARKGDQCNIVPDNVDDIVPDLVTEE-------KEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDEASTCMMSEWITWSPCSASCGM-GMRSRER-YVKQFPEDGSMCKVPTEETEKC-IVNEECEP 552          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 149.828 bits (377), Expect = 1.490e-36
Identity = 130/444 (29.28%), Postives = 204/444 (45.95%), Query Frame = 2
Query:  452 HVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESC-SSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKP 1759
             +   W AP I + C+ +   +    +I        +  +CE   N+                     P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS E+ ++  GG A++GV QV   GS  +++++  + G+ ++TVI A++   A    N R   SA   V+ ++HL+SFLA + PSPDW  GLS  DLC   C W +K I  L PWDAG  SG TY + N+ +  Q  I P+TS     +PF     G I  +  V  + I       N   ++++ I+ D   +        K   D    C+ S WS WS+CS +     K   +++LK + +  +    T + E C    CS   S  TC    W  WSPC+A+C   G+  RER ++ +  +   M     + + +C + +E C+P
Sbjct:  121 RIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPGGNE--------------------KPIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIARKGDQCNIVPDNVDDIVPDLVTEE-------KEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDAS--TCMMSEWITWSPCSASCGM-GMRSRER-YVKQFPEDGSMCKVPTEETEKC-IVNEECEP 529          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 149.058 bits (375), Expect = 3.204e-36
Identity = 121/376 (32.18%), Postives = 186/376 (49.47%), Query Frame = 2
Query:  656 PVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESC-SSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKP 1759
            P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS E+ ++  GG A++GV QV   GS  +++++  + G+ ++TVI A++   A    N R   SA   V+ ++HL+SFLA + PSPDW  GLS  DLC   C W +K I  L PWDAG  SG TY + N+ +  Q  I P+TS     +PF     G I  +  V  + I       N   ++++ I+ D   +        K   D    C+ S WS WS+CS +     K   +++LK + +  +    T + E C    CS   S  TC    W  WSPC+A+C   G+  RER ++ +  +   M     + + +C + +E C+P
Sbjct:  191 PIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIARKGDQCNIVPDNVDDIVPDLVTEE-------KEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDAS--TCMMSEWITWSPCSASCGM-GMRSRER-YVKQFPEDGSMCKVPTEETEKC-IVNEECEP 551          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon1 (spondin 1, (f-spondin) extracellular matrix protein [Source:MGI Symbol;Acc:MGI:2385287])

HSP 1 Score: 155.606 bits (392), Expect = 1.915e-38
Identity = 145/516 (28.10%), Postives = 224/516 (43.41%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTD-PVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            A  TR   YT            Y P  +Y +T+S    +     T+     L  N   + EE       +AG   F +    +T++   CP  A  +    +   +  +WIAP     C+ +   +    +I        +  +CEQ                   +   TD P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   A    N R   SA   V+ T+HL+SFL  + PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S  +  K   +++LK + +  +    T + + C     +     TC+   W  WSPC+ +C   G+  RER
Sbjct:   50 AQGTRREGYTEFSLRVEGDPDFYKPGSSYRVTLSAAPPSYFRGFTL---IALKENQEGDKEE------DHAG--TFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDPT----------------LDGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEE-------KDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGM-GMRSRER 526          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon2 (spondin 2, extracellular matrix protein [Source:MGI Symbol;Acc:MGI:1923724])

HSP 1 Score: 90.1225 bits (222), Expect = 6.949e-19
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 2
Query:  668 CNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDA-SSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPFTVMNGKIKN---IGVVTFQLIQEYNK 1303
            C     A Y +T   KW+     K +P    + P    +  LGA+HS++++++      + G+      G    L K+   AG  + +V    S  A  S T + S  + V+    LVSF+ R+ PSPDW  G+   DLC G  +W+E+ ++ LYP DAG  SG T+ + N  T  Q  +  IT+S P     +    ++K+   I  VTF  +Q+  +
Sbjct:   34 CTARPLARYSITFIGKWSQTAFPKQYPL---FRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCEGG-RWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYPRLKSLPPIAKVTFVRLQQSPR 248          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 70.4774 bits (171), Expect = 5.846e-13
Identity = 39/110 (35.45%), Postives = 58/110 (52.73%), Query Frame = 2
Query: 1826 FYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            ++++  +  C  FIY GC G  N F T EEC   C P  ++T  +  +  E  P+ C +    G+    +    R+ Y+N  K+C RF +GGC GN NNF T  EC+ +C
Sbjct:   66 YFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAER-PDFCFLEEDPGL---CRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 70.4774 bits (171), Expect = 5.846e-13
Identity = 39/110 (35.45%), Postives = 58/110 (52.73%), Query Frame = 2
Query: 1826 FYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            ++++  +  C  FIY GC G  N F T EEC   C P  ++T  +  +  E  P+ C +    G+    +    R+ Y+N  K+C RF +GGC GN NNF T  EC+ +C
Sbjct:   66 YFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAER-PDFCFLEEDPGL---CRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 70.4774 bits (171), Expect = 5.846e-13
Identity = 39/110 (35.45%), Postives = 58/110 (52.73%), Query Frame = 2
Query: 1826 FYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            ++++  +  C  FIY GC G  N F T EEC   C P  ++T  +  +  E  P+ C +    G+    +    R+ Y+N  K+C RF +GGC GN NNF T  EC+ +C
Sbjct:   66 YFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAER-PDFCFLEEDPGL---CRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q8VCC9|SPON1_MOUSE (Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.339e-37
Identity = 145/516 (28.10%), Postives = 224/516 (43.41%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTD-PVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            A  TR   YT            Y P  +Y +T+S    +     T+     L  N   + EE       +AG   F +    +T++   CP  A  +    +   +  +WIAP     C+ +   +    +I        +  +CEQ                   +   TD P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   A    N R   SA   V+ T+HL+SFL  + PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S  +  K   +++LK + +  +    T + + C     +     TC+   W  WSPC+ +C   G+  RER
Sbjct:   50 AQGTRREGYTEFSLRVEGDPDFYKPGSSYRVTLSAAPPSYFRGFTL---IALKENQEGDKEE------DHAG--TFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDPT----------------LDGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEE-------KDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGM-GMRSRER 526          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|P35446|SPON1_RAT (Spondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.340e-37
Identity = 145/516 (28.10%), Postives = 224/516 (43.41%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTD-PVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDAS-SKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            A  TR   YT            Y P  +Y +T+S    +     T+     L  N   + EE       +AG   F +    +T++   CP  A  +    +   +  +WIAP     C+ +   +    +I        +  +CEQ                   +   TD P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   S    N R   SA   V+ T+HL+SFL  + PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S  +  K   +++LK + +  +    T + + C     +     TC+   W  WSPC+ +C   G+  RER
Sbjct:   50 AQGTRREGYTEFSLRVEGDPDFYKPGSSYRVTLSAAPPSYFRGFTL---IALKENREGDKEE------DHAG--TFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDPT----------------LDGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPSWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEE-------KDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGM-GMRSRER 526          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q9HCB6|SPON1_HUMAN (Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 2.446e-37
Identity = 146/515 (28.35%), Postives = 224/515 (43.50%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            A  TR   YT            Y P  +Y +T+S    +     T+     L  N   + EE       +AG   F +    +T++   CP  A  +    +   +  +WIAP     C+ +   +    +I        +  +CEQ              ST   +  K  P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   A    N R   SA   V+ T+HL+SFL  + PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S     K   +++LK + +  +    T + + C     +     TC+   W  WSPC+ +C   G+  RER
Sbjct:   50 AQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTL---IALRENREGDKEE------DHAG--TFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQD-------------STFDGVTDK--PILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEE-------KDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGM-GMRSRER 526          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q9GLX9|SPON1_BOVIN (Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.986e-37
Identity = 141/493 (28.60%), Postives = 218/493 (44.22%), Query Frame = 2
Query:  215 YIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            Y P  +Y +T+S    +     T+     L  N   + EE       +AG   F +    +T++   CP  A  +    +   +  +WIAP     C+ +   +    +I        +  +CEQ              ST   +  K  P+  C    TA YR+T    W+   H KD+P +  +   I   +G SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   A    N R   SA   V+ T+HL+SFL  + PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S     K   +++LK + +  +    T + + C     +     TC+   W  WSPC+ +C   G   RER
Sbjct:   72 YKPGTSYRVTLSAAPPSYFRGFTL---IALKENREGDKEE------DHAG--TFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQD-------------STFDGVTDK--PILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI---IGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEE-------KDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCG-TGTRSRER 526          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q9W770|SPON1_CHICK (Spondin-1 OS=Gallus gallus OX=9031 GN=SPON1 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.954e-36
Identity = 141/493 (28.60%), Postives = 215/493 (43.61%), Query Frame = 2
Query:  215 YIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            Y P  +Y +T+S    A     T+             ++E  E D +      F +    +T++   CP  A  +    +   +  +W AP     C+ +   +    +I        +  ICEQ              S S  +  K  P   C    TA YR+T    W+   H KD+P +  +   I   +G+SHS  + ++  GG A+EGV QV   GS  +++++  +  + ++TVI A++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W +K +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G IK +  V  + I    +  N   ++I+ I+ D A +        K   D    C+ S WS WS+CS S  +  K   +++LK + +  +    T + + C     +     TC    W  WSPC+ +C   G   RER
Sbjct:   67 YKPGNSYRVTLSAATPAYFRGFTL-----------IALKEGKEGDKEEDHAGTFQIIDEEETQFMSNCPV-AVTESTPRRRTRIQVFWTAPPTGTGCVILKASIVQKRIIYFQDEGSLTKRICEQD-------------SASEGVTDK--PTLDCCACGTAKYRLTFYGNWSEKTHPKDFPRRTNHWSAI---IGSSHSKNYILWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRHRHLMSFLTMLGPSPDWNVGLSAEDLCTKDCGWVQKVVQDLIPWDAGTDSGVTYESPNKPTVPQEKIRPLTSLDHPQSPFYDPEGGSIKLVARVVLERIARKGEQCNFVPDNIDDIVADLAPEE-------KEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCMMSDWITWSPCSVSCGM-GTRSRER 521          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A3P7E8N4 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS2095 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.661e-52
Identity = 188/633 (29.70%), Postives = 245/633 (38.70%), Query Frame = 2
Query:  581 KRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFY------KAGNGIMTVILARSLDAS---------------SKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQT--PICPITSSWPKDNPFT--------------------------------VMNGKIKNIGVVTFQLIQEYNKNDNQYCNS-INSILQDEAYQNEPKSSALK--------------SNPD----KTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKG-KSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCS-QKGIIHRERVFINEQEKHECMQY---------SEMKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRR--------FNTPETYPN-------------RCGVSMTWGIFCD-SQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCL 2158
            + N  D +Q          ++    P   C  G TA YR+T +  WN   H +DWP K+      T  +GASHS  F IY +G  A+ GV  VC  G  T L++         +   G+ T   + + D S               +   +R+ L  VN T  L S L  L PSPDWCTG+S   LC   C W     ++L+PWDAG+  G TY+ K    ++   PI  I   W   NPF                                 +M+G I   G      ++   K D  +  S    I+  +      KS                  S+P      T  C+ SEWS WS+CS +CG G KTR R+L+   K E C    L   ESC  +  T      CSF  W  WSPCNATC  Q G+  R R     +E  +C            S MK    C +  E C+P  IC E    G  C      +RFYY      C  F Y GC GG N F T EEC  LC P ++     R        F T +  P+              C   +  G  CD  +   N WYY      C  F + GC G  N +   T C   C+
Sbjct:  231 RNNPADPIQTPNVDPMELRLRDSIQPKDCCACG-TATYRLTFQGLWNRTTHPQDWPTKNPNLLHWTNLIGASHSPSFQIYAIGQTASAGVQSVCAYGDTTVLREALALAAAKSEGAAGVPTGSQSATTDVSPLRALISTPGMWGEEALMEQRTTLFSVNRTHPLFSLLTMLGPSPDWCTGISGQSLCKADCTWVRNMTLYLHPWDAGIREGNTYMPKESDRKEIPDPIRYIDEKWMPGNPFRDKKPIARVEIERELPKHDWECTNKDADGVHLFLMSGGIHVTGKKASDGMESDKKKDQMHAASATQQIVTGKGRGKSSKSVGFGGPGASGTLGTNNPLSDPSLAQMATFLCITSEWSAWSACSVTCGVGTKTRTRQLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSFLPWTLWSPCNATCDRQVGVRSRTRALARPEEAKQCEHLWKGRVGGMESVMKEVEVCRIPPEACEPATICGEGPKQGYPC--GKKVRRFYYSAIDHECLEFEYLGCKGGRNMFETKEECEKLCIPAVEALPGWRRERMGLLQFKTSQLAPSAGDTGEEELKQDPACHYEVNTGYECDPPKELGNYWYYCTRTNRCRDFFYLGCGGTPNRWANHTACMAACM 860          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A0R3WMX0 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 4.014e-52
Identity = 188/633 (29.70%), Postives = 245/633 (38.70%), Query Frame = 2
Query:  581 KRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFY------KAGNGIMTVILARSLDAS---------------SKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQT--PICPITSSWPKDNPFT--------------------------------VMNGKIKNIGVVTFQLIQEYNKNDNQYCNS-INSILQDEAYQNEPKSSALK--------------SNPD----KTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKG-KSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCS-QKGIIHRERVFINEQEKHECMQY---------SEMKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRR--------FNTPETYPN-------------RCGVSMTWGIFCD-SQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCL 2158
            + N  D +Q          ++    P   C  G TA YR+T +  WN   H +DWP K+      T  +GASHS  F IY +G  A+ GV  VC  G  T L++         +   G+ T   + + D S               +   +R+ L  VN T  L S L  L PSPDWCTG+S   LC   C W     ++L+PWDAG+  G TY+ K    ++   PI  I   W   NPF                                 +M+G I   G      ++   K D  +  S    I+  +      KS                  S+P      T  C+ SEWS WS+CS +CG G KTR R+L+   K E C    L   ESC  +  T      CSF  W  WSPCNATC  Q G+  R R     +E  +C            S MK    C +  E C+P  IC E    G  C      +RFYY      C  F Y GC GG N F T EEC  LC P ++     R        F T +  P+              C   +  G  CD  +   N WYY      C  F + GC G  N +   T C   C+
Sbjct:  231 RNNPADPIQTPNVDPMELRLRDSIQPKDCCACG-TATYRLTFQGLWNRTTHPQDWPTKNPNLLHWTNLIGASHSPSFQIYAIGQTASAGVQSVCAYGDTTVLREALALAAAKSEGAAGVPTGSQSATTDVSPLRALISTPGMWGEEALMEQRTTLFSVNRTHPLFSLLTMLGPSPDWCTGISGQSLCKADCTWVRNMTLYLHPWDAGIREGNTYMPKESDRKEIPDPIRYIDEKWMPGNPFRDKKPIARVEIERELPKHDWECTNKDADGVHLFLMSGGIHVTGKKASDGMESDKKKDQMHAASATQQIVTGKGRGKSSKSVGFGGPGASGTLGTNNPLSDPSLAQMATFLCITSEWSAWSACSVTCGVGTKTRTRQLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSFLPWTLWSPCNATCDRQVGVRSRTRALARPEEAKQCEHLWKGRVGGMESVMKEVEVCRIPPEACEPATICGEGPKQGYPC--GKKVRRFYYSAIDHECLEFEYLGCKGGRNMFETKEECEKLCIPAVEALPGWRRERMGLLQFKTSQLAPSAGDTGEEELKQDPACHYEVNTGYECDPPKELGNYWYYCTRTNRCRDFFYLGCGGTPNRWANHTACMAACM 860          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A0R3U498 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1462 PE=4 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 7.653e-52
Identity = 202/699 (28.90%), Postives = 276/699 (39.48%), Query Frame = 2
Query:  443 QPQHVTFYWIAPKI-PNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAM--------KQKTDPV----------KQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGN------GIMTVILARSLDAS---------------SKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP--ICPITSSWPKDNPF----TVMNGKIKNI--------------GVVTFQLIQEY----NKND-------------NQYCNSINSILQDE------AYQNEPKSSALKSN-----PD----KTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGK-SEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATC-SQKGIIHRERVFINEQEKHECMQYSE-----------MKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLK---------------ETDQRRFNTPETYPNR------CGVSMTWGIFCD-SQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCL 2158
            Q  HV   W  P    + C+ I  ++K +  + + +  + +  +C  +   M+ + ++   S             +   DPV          K C    TA Y++T +  WN   H +DWP K       T  +GASH+  F IY +G  A+ GV  VC  G  T L++    A +      G+ T   + + D S               +   +RS L  VN T  LVS L  L PSPDWCTG+S   LC   C W     +HLYPWDAG+  G TY+ K    R+ P  I  I  SW   NPF     V   KI+ +              GV  F++         KND              Q C +I +  Q         +     S  + SN     P      T  C+  EWS WS+CS +CG G KTR R+L+  K  E C    L   ESC  +  T      CS   W  WSPC  TC S +G   R+R     +E  +C    E           M    EC + SE C+P  IC E    G  C      +RFYY      C  F Y GC GG N F T ++C  LC P ++               +T Q   ++P+   +       C   +  G  CD  +   N WY+ +    C  F + GC G  N F   T C   C+
Sbjct:  185 QLPHVVAIWRTPSTNTSNCVTIHAMVKSSTSVLK-EVGDLTKTLCPSEMRPMEPVLSENRGSVDADAIDPSREFDRPAPDPVEMRPRDSMQPKDCCACGTATYKLTFQGVWNSTTHPQDWPYKHPNLLHWTNLIGASHAPSFQIYAIGQTASAGVQSVCAYGDTTILREALSLAASKAEGAAGVPTGSQSATTDVSPLRSLITTPGMWGEETLMEERSTLFSVNRTHPLVSMLTMLGPSPDWCTGISGQSLCKADCTWVNNLTLHLYPWDAGIREGNTYMPKESDRREIPDPIRYIDESWMPGNPFRERKPVAVVKIQRVRPKYDWACTNTDEDGVQLFKMGGGIYVTGKKNDKESDESSLKEKAREQRCTTITAGKQKGKRTKSVGFGGPGASGTIGSNNPLSDPSLAQMATFLCITDEWSAWSACSVTCGVGTKTRTRRLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSLLPWTLWSPCTGTCDSPRGHRSRKRALARPEEAAQCGHLWEGRNQEGREQGIMSEVEECQVPSETCEPATICGEGPKQGYPCG--PKLRRFYYSAIDHECLEFEYLGCKGGRNMFETKQDCEKLCIPAVEALPAWRRERMGLLQFKTSQLTSSSPDDLEDSLKRDPVCYYEVNTGYECDPPKELGNYWYFCSRTNRCRDFFYLGCGGTPNRFANHTACMAACM 880          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A3R7C1T5 (Spondin-1 OS=Clonorchis sinensis OX=79923 GN=SPON1 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.122e-48
Identity = 99/228 (43.42%), Postives = 140/228 (61.40%), Query Frame = 2
Query:  623 STSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWP----GKDG--YSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFY-KAGNGIMTVILARSLDASSKTNKR--SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETY--LNKNEKTRQT-PICPITSSWPKDNPFTVMNGKIKNIGV 1270
            S SCA+++   PV++C   +TA+YRM I++ W    HW+DWP     +DG   SP  ++ LG SHS  ++++H+GG A+  V  +C      +L+ +F  +AG  IMTVI  R +D+S+   +R  SAL  VN+T HL+SFL RL PSPDWCTGLSR D+C  +C W  +    L PWDAGV SG TY  +  +E+ RQ  P+CPIT     + PFTV+   +   G+
Sbjct:  300 SGSCAVQEIQKPVRRCCACNTAIYRMIIQSDWQQQQHWRDWPTAGVNRDGITVSPHFSEILGVSHSPLYDLFHVGGYASPAVDALCTTSDVAKLENEFKNQAGENIMTVIRTRGIDSSAPPEQRIRSALFAVNSTHHLISFLTRLVPSPDWCTGLSRVDICLANCSWPLQMRFRLEPWDAGVMSGNTYVPVEPSERLRQPKPMCPITPDLRANTPFTVVTDYVSPPGI 527          

HSP 2 Score: 73.1738 bits (178), Expect = 2.539e-9
Identity = 61/218 (27.98%), Postives = 90/218 (41.28%), Query Frame = 2
Query: 1571 ISFETCSFRLWGQWSPC-NATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASE-RCKPDVICKE-YVYPGDS----CSWSSPSQRFYYDFSSGTCNAFIYK------------GCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREK 2167
            IS E C    WG WS C NATC++ G+I+R R F +   K  C  Y  +     C   +  +C P+++ K  Y  P  +        + + R+YY  S   C  F Y                   N F     C  LC+ + +++  R  +  +   N C         C    +  RWY+D I K+C +F  G C    N F T+ ECQ  C+ E+
Sbjct:  721 ISAEACQSLPWGSWSACINATCTKPGLIYRWREFPDLATKEACESYPLVNELDTCWPPTNLQCDPELLRKACYEEPPSANRLCLRPENTTVRYYYHPSQKECKTFDYSPQCHIRALVSDHAIAYTRNQFPDLASCERLCKFEKQQSRSRWSSRYKRASNPCNNPPYPNSQCGPSETVARWYFDQIKKQCLQFSKGECGSGMNRFATENECQATCVPEQ 938          
BLAST of Spondin-1 vs. TrEMBL
Match: H2KTV5 (Spondin-1 OS=Clonorchis sinensis OX=79923 GN=CLF_106333 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.409e-48
Identity = 99/228 (43.42%), Postives = 140/228 (61.40%), Query Frame = 2
Query:  623 STSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWP----GKDG--YSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFY-KAGNGIMTVILARSLDASSKTNKR--SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETY--LNKNEKTRQT-PICPITSSWPKDNPFTVMNGKIKNIGV 1270
            S SCA+++   PV++C   +TA+YRM I++ W    HW+DWP     +DG   SP  ++ LG SHS  ++++H+GG A+  V  +C      +L+ +F  +AG  IMTVI  R +D+S+   +R  SAL  VN+T HL+SFL RL PSPDWCTGLSR D+C  +C W  +    L PWDAGV SG TY  +  +E+ RQ  P+CPIT     + PFTV+   +   G+
Sbjct:  297 SGSCAVQEIQKPVRRCCACNTAIYRMIIQSDWQQQQHWRDWPTAGVNRDGITVSPHFSEILGVSHSPLYDLFHVGGYASPAVDALCTTSDVAKLENEFKNQAGENIMTVIRTRGIDSSAPPEQRIRSALFAVNSTHHLISFLTRLVPSPDWCTGLSRVDICLANCSWPLQMRFRLEPWDAGVMSGNTYVPVEPSERLRQPKPMCPITPDLRANTPFTVVTDYVSPPGI 524          

HSP 2 Score: 68.1662 bits (165), Expect = 8.246e-8
Identity = 59/211 (27.96%), Postives = 86/211 (40.76%), Query Frame = 2
Query: 1571 ISFETCSFRLWGQWSPC-NATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASE-RCKPDVICKE-YVYPGDS----CSWSSPSQRFYYDFSSGTCNAFIYK------------GCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQ 2146
            IS E C    WG WS C NATC++ G+I+R R F +   K  C  Y  +     C   +  +C P+++ K  Y  P  +        + + R+YY  S   C  F Y                   N F     C  LC+ + +++  R  +  +   N C         C    +  RWY+D I K+C +F  G C    N F T+ ECQ
Sbjct:  718 ISAEACQSLPWGSWSACINATCTKPGLIYRWREFPDLATKEACESYPLVNELDTCWPPTNLQCDPELLRKACYEEPPSANRLCLRPENTTVRYYYHPSQKECKTFDYSPQCHIRALVSDHAIAYTRNQFPDLASCERLCKFEKQQSRSRWSSRYKRASNPCNNPPYPNSQCGPSETVARWYFDQIKKQCLQFSKGECGSGMNRFATENECQ 928          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 145.206 bits (365), Expect = 2.558e-35
Identity = 132/494 (26.72%), Postives = 220/494 (44.53%), Query Frame = 2
Query:  212 SYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTR-QTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            +Y P  TY +++  +  +     T+  +           E +S  D+  AG   F +    +T++   CP  A  + +  +   +  +W AP   + C+ +   +    +I        +  +CE +++    +                 P++ C    TA YR+T    W+   H KD+P +  +    +  +GASHS  + ++  GG A+EGV QV   GS  +++++  + G+ +MTVI  ++   A    N R   SA   V+   HL+SFL  L PSPDW  G+S  +LC   C W ++ +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF +   G I  +  V  + I        + CN++   + D      P+ +   + P+    C+ S WS WS+CS S     +   +++LK + +  +    T + E C           TC    W  WSPC+A+C   G+  RER
Sbjct:   61 TYQPGSTYRVSLYASSPSYFRGFTLIAL-------KEGREGVSPDDY--AGN--FKIIDEEETQFMTSCPP-AVTESIPRRRTRIQVFWTAPPSGSGCVILKASIVQRRIIFFQDEGSLTRRLCEVQKSIFGGI--------------TLKPLQDCCACGTAKYRVTFYGNWSEKVHPKDYPRRANH---WSALIGASHSRNYVLWEYGGYASEGVRQVAELGSPVKMEEEIRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRAHHLMSFLTMLGPSPDWNVGISGENLCTQECGWVQRLVKDLLPWDAGTDSGVTYESPNKPTNPQERIRPLTSLDHPQSPFYSPHGGPITPLARVVVERI----ARKGEQCNTVPDTVDDIVADIPPEDTEEDNTPET---CIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDATVPCLHTQDFEPCMGPGCREEEPSTCMLSEWISWSPCSASCGM-GMRSRER 517          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon1a (spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9])

HSP 1 Score: 108.227 bits (269), Expect = 1.035e-23
Identity = 128/492 (26.02%), Postives = 206/492 (41.87%), Query Frame = 2
Query:  215 YIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            Y P  TY +T+   + A     T+     L    + E EE        AG   F +     T++   CP  A  +    +   +  +W AP   + CI +   +    +IS       +  +CE++               S   +    P+  C    TA YR+T    W+   H KD+P +  +   I   +G+SHS  + ++  GG A++GV QV   GS  +++++  + G+ ++TVI  ++   A    N R   SA   V+ ++HL+SFL  L PSPDW  GL    +  G C W         PW++ + S        EK R     P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS S  +  K   +++LK + +  +    T + E C     +     TC    W  WSPC+ +C   G+  RER
Sbjct:   78 YQPASTYRVTLYATNPAYFRGFTL---IALKEGRNGEKEE------DYAGN--FQIIDEEDTQFMTNCPP-AVTESTPRRRTRIQVFWTAPPSGSGCILLKASIVQRKIISFQDEGSLTKRMCEKE---------------SLYGESTDKPLLDCCACGTAKYRVTFYGNWSEKLHPKDYPRRANHWSAI---IGSSHSKNYVLWEYGGYASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKMKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLTMLGPSPDWNVGLLSSPV--GRCGW---------PWNS-ICSPNKPTVPQEKIR-----PLTSLDHPQSPFYDPEGGAITQVARVVVERIARKGEQCNIVPDNVDDIVADIAQEE-------KEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDATTCMMSEWITWSPCSVSCGL-GMRSRER 514          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 92.8189 bits (229), Expect = 7.527e-20
Identity = 68/203 (33.50%), Postives = 98/203 (48.28%), Query Frame = 2
Query:  632 CAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS----LDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKN-EKTRQTPICPITSSWP 1219
            C M    D V  C+  STA Y +T   KW+     K +P    Y P    +  +G +HS++++I+     A+ GV +    G    L K+   AG  I +V    S    LD +S+T        V A    +SF+ RL PSPDW  G+   +LC G   W+E   + L+P+DAG  SG T+ + N E   Q  +  ITSS+P
Sbjct:   41 CTMPVSVDSV--CSAPSTAKYSLTFTGKWSQTAFPKQYPV---YRPPAQWSPLIGVTHSSDYHIWQKNEYASNGVREFSEKGEAWTLIKEVEAAGERIQSVYGLFSTPAVLDGTSQTTTE---FEVYARHSFLSFIMRLVPSPDWFVGVDSLNLCEGD-HWKENISLDLFPYDAGTDSGFTFSSPNFETIPQDKVMQITSSFP 234          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: wfikkn1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:NCBI gene;Acc:103037683])

HSP 1 Score: 80.8777 bits (198), Expect = 2.358e-15
Identity = 46/114 (40.35%), Postives = 58/114 (50.88%), Query Frame = 2
Query: 1826 FYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREK 2167
            ++YD S G+C  F + GC GG N F TYEEC   C        QR      T P   G    W           RW Y+ INK+C  F +GGC+GN NNFR+K EC++ C + K
Sbjct:  335 WHYDTSLGSCRPFAHGGCPGGRNRFETYEECQAAC--------QREGLGLCTLPAVQGPCRNW---------EARWAYNTINKQCQAFVYGGCQGNNNNFRSKVECESRCPQPK 431          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon2a (spondin-2-like [Source:NCBI gene;Acc:103039648])

HSP 1 Score: 73.9442 bits (180), Expect = 1.133e-13
Identity = 47/186 (25.27%), Postives = 85/186 (45.70%), Query Frame = 2
Query:  629 SCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT 1180
            S A   +T  V  C+    A Y +     W+     K +P    + P    ++ +  +H++++ ++  G  A+ GV      G   EL K+  +A        + R+    S     S  ++++    L+S L ++ PSPDW  G+   +LC G  +W+++    L+P+DAG  SG T+ + N  T
Sbjct:   25 SSAFPLRTSNVTTCSARGPASYILVFTGHWSPQTFPKQYPL---FRPPAQWSKLVAVTHNDQYRLWQEGSPASPGVQNFAELGVTVELVKEAKEARKTRAVGSMYRTAGIPSGIGHSSTELILHPRNPLLSLLVKVIPSPDWFVGVDSLNLCEGG-QWKQEVTFDLHPFDAGTDSGFTFSSPNFPT 206          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 75.0998 bits (183), Expect = 8.577e-15
Identity = 62/257 (24.12%), Postives = 110/257 (42.80%), Query Frame = 2
Query:  665 QCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQF---------YKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSA-LKSNP 1396
            +C+ G    Y++    +W+  +  K +P    + P    +  +   H   F ++     A+ GV ++   G    + ++                +  V  A +L   + T + S  +   A Q L+S + RL PSPDW  G+   +LC G  +W+E+  + L P+DAG  SG T+ + N  T  Q PI  +TSS P     +    K+K +  +   ++    K  +   +   +++     QNEP S   +K  P
Sbjct:    9 KCSAGGHPKYQLVFTGRWSQTSFPKQYPL---FRPPAQWSSLVAVVHGRPFQMWRASRFASPGVREMSERGEAWGIMREVDAHAQARTAAARPPAVAGVFSAPALP--NGTGQSSTELEFTAKQPLLSLMVRLVPSPDWFVGVDSLNLCEGE-RWKERLSLDLQPYDAGTDSGFTFSSPNYATIPQEPITQMTSSSPSHPANSFYYPKLKQLPPLARLVLTRMGKRPHSSKHPDANLV---TRQNEPASGVYIKQTP 256          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: spon2a (spondin 2a, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-160])

HSP 1 Score: 60.077 bits (144), Expect = 1.510e-10
Identity = 39/132 (29.55%), Postives = 58/132 (43.94%), Query Frame = 2
Query: 1010 VSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTR-QTPICPITS---SWPKDNPFTVMNGKIKNIGVVTFQL---IQEYNKNDNQYCNSINSILQDEAYQNEPKSSAL 1384
            VS + RL PSPDW  G+S  DLC+ +  W       L PWD G  SG  + + N  +  Q PI  IT+   S P ++ +      +  IG + F L      + + D+  C     +  D   + E   + L
Sbjct:    1 VSIVVRLIPSPDWFVGVSSLDLCSNAGGWAPLVSHDLQPWDGGTDSGFAFSSPNYASEPQEPISLITAQRPSHPANSFYYPRLQALPRIGFLEFHLQPADHAFQRPDDLICKHCQIVRSDSGQREEAAGTPL 132          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.844e-10
Identity = 33/112 (29.46%), Postives = 52/112 (46.43%), Query Frame = 2
Query: 1823 RFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCL 2158
            R +Y+  +  C  F Y GC+G  NNF +  EC   C        Q R    +  P  C + M  G+    ++   R++++  +  C  F +GGC+GN NNF+    C   C+
Sbjct:   18 RVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKCAWIPDHRLQLRRKQTDIAPKACRLDMEVGV---CRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCV 126          

HSP 2 Score: 53.5286 bits (127), Expect = 4.596e-8
Identity = 36/129 (27.91%), Postives = 60/129 (46.51%), Query Frame = 2
Query: 1820 QRFYYDFSSGTCNAFIYKGCYGGLNNFHT----YEECILLCRP-KLKETDQRRFNTPETYPNRCG------------VSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            +R++++ +SG+C  F Y GC G LNNF      Y+ C+    P K+K+  ++  N       RC             + +      +  +   R++Y+     C  F +GGC GN NNF ++  C +VC
Sbjct:   89 RRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFVLPRICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 217          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009465.1 (pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 gene:ENSPMAG00000008558.1 transcript:ENSPMAT00000009465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 3.019e-10
Identity = 42/115 (36.52%), Postives = 56/115 (48.70%), Query Frame = 2
Query: 1823 RFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLC-RPKLKETDQ-RRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLR 2161
            R+ YD ++ TC  F Y GC G  NNF    EC++ C R  +K      +F +   +P  C +    G     + S  RW YD  +  C  F +GGC GN NNF  +TEC   C R
Sbjct:   16 RWTYDAATSTCKEFTYGGCRGNQNNFLEEAECLMDCGRSDVKMAVYCWQFGS---WPYICLLEEAVG---PCRGSFTRWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTCGR 124          

HSP 2 Score: 58.9214 bits (141), Expect = 8.793e-10
Identity = 42/130 (32.31%), Postives = 54/130 (41.54%), Query Frame = 2
Query: 1823 RFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYP---NRCG-VSMTW---------------GIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            R+ YD  S  C  F Y GC G  NNF    EC++ C   L      R++    Y    N C  +S  W                +    + S  RW YD  +  C  F +GGC GN NNF  +TEC  +C
Sbjct:   87 RWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTCGRSLGTLRTCRYHRTLNYLVVNNSCFLISSCWMTRRLFHVQDVCLLEAVTSPCRGSFTRWTYDAESGHCKEFTYGGCGGNFNNFLEETECVAMC 216          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 9.992e-10
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 2
Query: 1823 RFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTP--ETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLR 2161
            R +Y+  +  C  F Y GC+G  NNF +  EC   C       D +R  +P     P  C + M  G+    ++   R++++  +  C  F +GGC+GN NNF+    C   C+ 
Sbjct:   18 RVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC---AWIPDNKRLASPCPLVAPKACRLDMEVGV---CRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVH 126          

HSP 2 Score: 53.5286 bits (127), Expect = 4.935e-8
Identity = 36/129 (27.91%), Postives = 60/129 (46.51%), Query Frame = 2
Query: 1820 QRFYYDFSSGTCNAFIYKGCYGGLNNFHT----YEECILLCRP-KLKETDQRRFNTPETYPNRCG------------VSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            +R++++ +SG+C  F Y GC G LNNF      Y+ C+    P K+K+  ++  N       RC             + +      +  +   R++Y+     C  F +GGC GN NNF ++  C +VC
Sbjct:   88 RRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFVLPRICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 216          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO49895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF43])

HSP 1 Score: 106.301 bits (264), Expect = 1.063e-24
Identity = 101/370 (27.30%), Postives = 171/370 (46.22%), Query Frame = 2
Query:  665 QCNIGSTAVYRMTIENKWNLLNHWKDWPGKDG-YSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEK-TRQTPICPITSSW---PKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIE-SSLTNTESCS-SKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERC 1753
            +C     A Y++T + KW+   H +  PG    +SP I    G SHSN++ ++  GG+A+  V  +   G+   L ++       +M++I   SL       + SA+  V++T+HL+S ++R+ PSPDW  G+ R +LC  +C W+ +  + L PWDAG   G T+ + N + T + PI  IT+     P+ + +   N +I+    +  + +          C++   I     Y   PKS+ +         C L+ WS+W+SCS +CG GE+ R R +++      I   +L     C+  +CS   S + C    W  WS C  +C     +   R+    Q     M    +    +C L+   C
Sbjct:    1 ECCACGKATYKLTFKGKWSQETHARHHPGPMARWSPLI----GCSHSNKYVMWRYGGIASRAVQMMSEWGATEYLDEEMRNQQENVMSIIQTPSLWYG--VGESSAVFRVDSTRHLLSMISRMIPSPDWNVGVDRVNLCTTNCTWKHEETIDLIPWDAGTDDGITFKSPNARSTPKQPISRITTRLHDHPRASFYLNTNDQIRPFASLKLERLAVSGG-----CSNDAHIAPKNPY--PPKSARID--------CQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNLYEHRPCARQRCS---STKKCEVTPWSAWSSCRGSCGVGRKVRTRRII--RQSSLSGMTCPSLVKKRKCKLSPCHC 344          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO31760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX09])

HSP 1 Score: 59.3066 bits (142), Expect = 2.405e-11
Identity = 25/45 (55.56%), Postives = 34/45 (75.56%), Query Frame = 2
Query: 2033 QSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREK 2167
            ++S  RWYY+N  ++C +F FGGC GNANNF TK+ C+N C+R K
Sbjct:   11 RASIQRWYYNNETRKCIKFTFGGCHGNANNFPTKSSCRNACMRRK 55          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO38466 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV3])

HSP 1 Score: 46.9802 bits (110), Expect = 7.205e-7
Identity = 19/36 (52.78%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 2048 RWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            RW+YD  + EC  F +GGC+GNANNF +K  C   C
Sbjct:   30 RWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKC 65          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 46.2098 bits (108), Expect = 7.331e-7
Identity = 17/36 (47.22%), Postives = 28/36 (77.78%), Query Frame = 2
Query: 2048 RWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            RW+Y+  +++C +F +GGC+GN+NNF +K EC+  C
Sbjct:   17 RWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO26263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 46.2098 bits (108), Expect = 7.331e-7
Identity = 17/36 (47.22%), Postives = 28/36 (77.78%), Query Frame = 2
Query: 2048 RWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            RW+Y+  +++C +F +GGC+GN+NNF +K EC+  C
Sbjct:   17 RWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon1b (spondin-1 [Source:NCBI gene;Acc:101161803])

HSP 1 Score: 148.288 bits (373), Expect = 2.552e-36
Identity = 139/532 (26.13%), Postives = 232/532 (43.61%), Query Frame = 2
Query:  113 GFCDIQFPKSYVAFSTR-----FNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            GFC+ + P++ +  + +     F L    E+E      +Y P  TY + +     A     T+             ++E +E    +     F +     T++   CP  A  +    +   +  +W AP   + C+ +   +    +I        +  +CE++  ++D   A               P++ C  G TA YR+T    W+   H KD+P +  +    +  +GASHS  + ++  GG A+EGV QV   GS  +++ +  + G+ ++TVI  ++   A    N R   SA   V+  +HL+SFL  L PSPDW  GLS  DLC   C W ++ +  L PWDAG  SG TY + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++I+ I+ D   +        K   D    C+ S WS WS+CS +     +   +++LK + +  +    T + + C +   ++    TC    W  WS C+ +C   G+  RER
Sbjct:   32 GFCE-RIPRAQIQRTRKEGHHEFRLKVEGEQE------NYNPGTTYKVLLLATSPAYFRGFTL-----------IALKEGTEGTTPDDYIGQFQIVDKDDTQFMTSCPP-AVTETTPRRRTKIQVFWTAPPSGSGCVILKASIVQKRVIFFQDKGSLTVRLCEKEPVQLDTTSAP--------------PIECCACG-TAKYRLTFYGNWSEKVHPKDYPRRANH---WSALIGASHSRNYVLWEYGGYASEGVRQVAEFGSPIKMEGEIRQKGDDVLTVIKTKAQWPAWQPLNLRAAPSAEFSVDRARHLMSFLTMLGPSPDWNVGLSGEDLCTKDCGWIQRLVADLIPWDAGTDSGVTYESPNKPTIPQDKIRPLTSFDHPQSPFYDPQGGPISPLARVVVERIARKGEQCNVVPDNIDDIVADIGQEE-------KEEDDTPETCIYSAWSPWSACSSATCDKGRRMRQRMLKAQLDLSVPCPHTQDFQPCMAPGCSMEEPSTCMMSEWISWSACSVSCGM-GMRSRER 518          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon1a (spondin 1 [Source:NCBI gene;Acc:101161963])

HSP 1 Score: 142.895 bits (359), Expect = 1.696e-34
Identity = 132/494 (26.72%), Postives = 216/494 (43.72%), Query Frame = 2
Query:  212 SYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEY---CPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARS-LDASSKTNKR---SALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKT-RQTPICPITSSWPKDNPF-TVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLT-NTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRER 1663
            SY P  TY + V  +  +     T+             ++E +  D  +     F +    +T++   CP  A  +    +  ++  +W AP   + C+ +   +    +I        +  +CE++    D                   P+  C    TA YR+T    W+   H KD+P +  +   I   +GASHS  + ++  GG A++GV QV   GS  +++++  + G+ ++TVI  ++   A    N R   SA   V+  +HL+SFL  + PSPDW  GLS  +LC   C W +K +  L PWDAG  SG +Y + N+ T  Q  I P+TS     +PF     G I  +  V  + I    +  N   ++++ I+ D A +        K   D    C+ S WS WS+CS +  +  K   +++LK + +  +    T + E C     +     TC    W  WSPC+ +C   GI  RER
Sbjct:   69 SYQPGSTYRVNVIASSPSYFRGFTL-----------IALKEGAGGDKDDDYAGNFRIIDEDETQFMTNCPH-AVTESTPRRRNNIQVFWTAPPTGSGCVLLKASIVQKKIIFFQDEGPLTKQMCEKESLYGDATDK---------------PLLDCCACGTAKYRVTFYGNWSEKIHPKDYPRRANHWSAI---IGASHSKNYVLWEYGGSASDGVKQVAELGSPVKMEEEIRQKGDDVLTVIKMKAQWPAWQPLNVRAAPSAEFSVDRIRHLMSFLTMMGPSPDWNVGLSAENLCTKECGWVQKVVQDLIPWDAGTDSGVSYESSNKPTVPQEKIRPLTSLDHPQSPFYDPEGGAITPVARVVVERIARKGEQCNIVPDNVDDIVADIAQEE-------KEEDDTPETCIYSNWSPWSACSSATCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDGSTCMMSEWITWSPCSMSCG-AGIRSRER 524          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon2b (spondin 2 [Source:NCBI gene;Acc:101164320])

HSP 1 Score: 91.2781 bits (225), Expect = 2.034e-19
Identity = 91/374 (24.33%), Postives = 137/374 (36.63%), Query Frame = 2
Query:  659 VKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDAS-SKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKN-EKTRQTPICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASE--RCKPD 1762
            +  C     A Y +T   KW      K +P    Y P    +  +G +HS +++++     A+ GV +         L K+   AG  I +V    S  A    T +      V A   L+SF+ R+ PSPDW  G+   +LCNG  KW+E   + L+P+DAG  SG T+ + N E   Q  I  ITSS+P     +    ++K++  +    + +  K      N I S+  +    N                                          LL   +E  IE +L NT               C   +W  W  C   C + G+ HR R  I     +           + C L  E  +C PD
Sbjct:   37 LPMCTASEPAQYSLTFSGKWTRAAFPKQYPV---YRPPAQWSNLIGVTHSLDYHMWQRNEFASNGVREFAEKSEAWTLMKEVETAGERIQSVYGILSAPAVVGGTGQMDTEFEVFARHSLMSFMVRIIPSPDWFVGVDSINLCNGD-KWKESVTLELFPYDAGTDSGFTFSSPNFETIPQDRITQITSSYPSHPANSFFYPRLKHLPPIAKVKLTKIKKT-----NQIISLPMEPTQSN------------------------------------------LLPTGNE--IEETLINTPL------------DCEVSVWSPWGLCKGKCGESGVQHRTRYVIMHPANN----------GVACPLLEEERKCIPD 335          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon2a (spondin-2 [Source:NCBI gene;Acc:101163419])

HSP 1 Score: 71.633 bits (174), Expect = 7.079e-13
Identity = 55/231 (23.81%), Postives = 101/231 (43.72%), Query Frame = 2
Query:  665 QCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKI--TQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP-ICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQD 1348
            +C   S A Y +     W+  +  K +P    + P    ++ +  SH++ F ++  G  A+ GV +    G   EL K   +A        + R+    +     S  + +     L+S + ++ PSPDW  G++  +LC G+  W+++  V+L P+DAG  SG T+ +    T     I  ITS  P     +    ++K +  +    I   +++ N+     N IL +
Sbjct:   37 ECTAKSPASYILVFTGHWSPQSFPKQYPL---FRPPAQWSKLIAVSHNHHFRLWEEGAAASLGVQKFAELGLTVELMKAGKEARKKRTVGAMQRTAGIPNGIGHSSTEVHMQPRSSLLSLMVKMIPSPDWFVGVNSLNLCEGN-HWKQEVTVNLQPYDAGTNSGFTFSSPKFPTSPPENISKITSQVPNHPANSFYYPRLKELPAIASIKITRQHRSANRQTVLSNHILPN 263          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: COL6A3 (collagen type VI alpha 3 chain [Source:NCBI gene;Acc:101161016])

HSP 1 Score: 71.633 bits (174), Expect = 3.386e-12
Identity = 42/150 (28.00%), Postives = 63/150 (42.00%), Query Frame = 2
Query: 1757 PDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLC-----------------RPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            P + CK+Y              ++YY+  +G C  F Y GC G  N F +   C+  C                 +P+ ++T+Q     P    + C +    G        + +WYYD  +K C RF +GGC GN N F T+ EC+  C
Sbjct: 2557 PGMPCKDY------------QAKWYYERQNGFCTQFWYGGCGGNDNRFDSEALCLKRCLRSEVQLAGKPEEKPQMQPEAQQTEQ--VEIPPAPVDICQLPKQEG---SCAEFALKWYYDTTSKSCTRFWYGGCDGNQNRFDTQEECKEAC 2689          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000039905.1 (SMESG000039905.1)

HSP 1 Score: 1621.68 bits (4198), Expect = 0.000e+0
Identity = 834/837 (99.64%), Postives = 835/837 (99.76%), Query Frame = 2
Query:   47 MKLILNILSTFFILKFDFAECFGFCDIQFPKSYVAFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEYCPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTPICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLKGKSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREKXXXXXXXXISQPVTVRKVCIYXXXXXXXXXXXXXQNQQTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYXXXXXXXXXXXRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD 2557
            MKLILNILSTFFILKFDFAECFGFCDIQFPKSYVAFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEYCPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTPICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLSEWSEWSSCSESCGKGEKTRYRKLLKGKSEQCIESSLTNTESCSSKCST ISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQS SNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCD+NCQNQQTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYSSWSEWSACSSRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD
Sbjct:    1 MKLILNILSTFFILKFDFAECFGFCDIQFPKSYVAFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEYCPQRAYVQYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTPICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLSEWSEWSSCSESCGKGEKTRYRKLLKGKSEQCIESSLTNTESCSSKCSTAISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSPSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCDDNCQNQQTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYSSWSEWSACSSRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD 837          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 246.128 bits (627), Expect = 3.387e-69
Identity = 212/747 (28.38%), Postives = 322/747 (43.11%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSN--------------VHTEMEE---LSEHDW---KNAGEVVFNVTHASKTEYCPQRAYV---QYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNK------RSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQT--PICPITSSWPKDNPFT-------VMNGKIK--------NIGVVTFQLIQEYNKNDN---QYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLK-GKSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASL----ECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQ------------------RRFNTPETYPNRCGVSMTW-GIFCDSQSSSN-RWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREK 2167
            A +TR N +  H+K   T     + D  + I +      M ++    E Y ++ N                 EME+   +  H     +  G  + N         CP R +     +L     +V   WIAP  P  CIR    +   D +           IC  K  KM   + ++    S    + T  VK+C     A Y++T    W+   H KDWP K       T  +GA+H+ ++ IY+ GG A++ V  +C  G  T L++QF +     +   L    + S   N+      RS  I VN T H  SFL  + PSPDWCTG++  D+C   C W++ F + L+P+DAG+ +G TY  +N   +    PI  I +++    PFT       V+  KIK         +     +   E N N N   Q+  S  +  +    +  P      +N   T  C+ S WSEW+ CS +CG G + R R +LK  K+E C    L  + +C  +  +      CS   W +W PCNATC   G   R R+F   +EK +C++  E +  +     C   +  C P +IC E +  G SC    P  +++YD +  +C  F Y GC G LNNF +   C   C   +    Q                  +R   P T  N+C + + + G+ CD     + R+YYDN N  C +F++ GC GN+NNFR+   C   C+ ++
Sbjct:    7 AMNTRTNCFKMHKK---TYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFL----TYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMIS-EENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEE---TIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANM-ATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSC--GKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMP-TMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQ 737          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 245.358 bits (625), Expect = 6.979e-69
Identity = 212/747 (28.38%), Postives = 322/747 (43.11%), Query Frame = 2
Query:  149 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSN--------------VHTEMEE---LSEHDW---KNAGEVVFNVTHASKTEYCPQRAYV---QYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNK------RSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQT--PICPITSSWPKDNPFT-------VMNGKIK--------NIGVVTFQLIQEYNKNDN---QYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLK-GKSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASL----ECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQ------------------RRFNTPETYPNRCGVSMTW-GIFCDSQSSSN-RWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREK 2167
            A +TR N +  H+K   T     + D  + I +      M ++    E Y ++ N                 EME+   +  H     +  G  + N         CP R +     +L     +V   WIAP  P  CIR    +   D +           IC  K  KM   + ++    S    + T  VK+C     A Y++T    W+   H KDWP K       T  +GA+H+ ++ IY+ GG A++ V  +C  G  T L++QF +     +   L    + S   N+      RS  I VN T H  SFL  + PSPDWCTG++  D+C   C W++ F + L+P+DAG+ +G TY  +N   +    PI  I +++    PFT       V+  KIK         +     +   E N N N   Q+  S  +  +    +  P      +N   T  C+ S WSEW+ CS +CG G + R R +LK  K+E C    L  + +C  +  +      CS   W +W PCNATC   G   R R+F   +EK +C++  E +  +     C   +  C P +IC E +  G SC    P  +++YD +  +C  F Y GC G LNNF +   C   C   +    Q                  +R   P T  N+C + + + G+ CD     + R+YYDN N  C +F++ GC GN+NNFR+   C   C+ ++
Sbjct:   14 AMNTRTNCFKMHKK---TYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFL----TYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMIS-EENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEE---TIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANM-ATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSC--GKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMP-TMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQ 744          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 244.202 bits (622), Expect = 1.109e-68
Identity = 202/706 (28.61%), Postives = 311/706 (44.05%), Query Frame = 2
Query:  215 YIPDKTYDITVSLNDKAMH-EKLTIKEIYVLVSNVHTEMEELSEHDWKNAGEVVFNVTHASKTEYCPQRAYV---QYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNK------RSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQT--PICPITSSWPKDNPFT-------VMNGKIK--------NIGVVTFQLIQEYNKNDN---QYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLXXXXXXXXXXXXXXXXXXTRYRKLLK-GKSEQCIESSLTNTESCSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASL----ECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQ------------------RRFNTPETYPNRCGVSMTW-GIFCDSQSSSN-RWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREK 2167
            + P ++Y I ++     M     +I   Y +  ++  E  ++   +    G  + N         CP R +     +L     +V   WIAP  P  CIR    +   D +           IC  K  KM   + ++    S    + T  VK+C     A Y++T    W+   H KDWP K       T  +GA+H+ ++ IY+ GG A++ V  +C  G  T L++QF +     +   L    + S   N+      RS  I VN T H  SFL  + PSPDWCTG++  D+C   C W++ F + L+P+DAG+ +G TY  +N   +    PI  I +++    PFT       V+  KIK         +     +   E N N N   Q+  S  +  +    +  P      +N   T  C+ S WSEW+ CS +CG G + R R +LK  K+E C    L  + +C  +  +      CS   W +W PCNATC   G   R R+F   +EK +C++  E +  +     C   +  C P +IC E +  G SC    P  +++YD +  +C  F Y GC G LNNF +   C   C   +    Q                  +R   P T  N+C + + + G+ CD     + R+YYDN N  C +F++ GC GN+NNFR+   C   C+ ++
Sbjct:   31 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDE--GLGHFIINKKFGLVDYKCPNRMHGNDNMFL----TYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMIS-EENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEE---TIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANM-ATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSC--GKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMP-TMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQ 721          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000037996.1 (SMESG000037996.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.186e-10
Identity = 36/111 (32.43%), Postives = 58/111 (52.25%), Query Frame = 2
Query: 1823 RFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRCGVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVC 2155
            R++Y+ +S  C  FIY GC    NNF T ++C  LC  + K+               C   +  G FC  ++   R++Y++ +++C RF +GGC  N NNF+   +CQ+ C
Sbjct:   42 RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEERNKQN--------------CEDPLAKG-FC--KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKILKDCQDFC 135          
The following BLAST results are available for this feature:
BLAST of Spondin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPON15.094e-3828.35spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252][more]
SPON27.699e-2032.98spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON27.699e-2032.98spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON27.699e-2032.98spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPINT14.515e-1436.59serine peptidase inhibitor, Kunitz type 1 [Source:... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon-12.708e-3624.51SPONdin (Extracellular matrix glycoprotein) family... [more]
E01G6.12.554e-1127.88pep chromosome:WBcel235:X:12260881:12266537:1 gene... [more]
Y55F3BR.22.788e-1125.78pep chromosome:WBcel235:IV:862099:874724:1 gene:WB... [more]
Y55F3BR.22.961e-1125.78pep chromosome:WBcel235:IV:857327:874724:1 gene:WB... [more]
Y55F3BR.22.961e-1125.78pep chromosome:WBcel235:IV:858930:874724:1 gene:WB... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fat-spondin1.514e-3122.86gene:FBgn0026721 transcript:FBtr0086975[more]
CG177394.411e-3128.57gene:FBgn0033710 transcript:FBtr0087893[more]
CG302038.914e-2828.57gene:FBgn0050203 transcript:FBtr0273303[more]
CG300461.608e-2526.96gene:FBgn0050046 transcript:FBtr0087895[more]
CG300461.608e-2526.96gene:FBgn0050046 transcript:FBtr0339627[more]
back to top
BLAST of Spondin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b1.191e-3726.78spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.273e-3726.78spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.491e-3726.78spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.005e-3628.31spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.043e-3627.59spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
back to top
BLAST of Spondin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon15.831e-3728.67spondin 1, extracellular matrix protein [Source:NC... [more]
spon11.340e-3627.57spondin 1, extracellular matrix protein [Source:NC... [more]
spon11.367e-3631.47spondin 1, extracellular matrix protein [Source:NC... [more]
spon11.490e-3629.28spondin 1, extracellular matrix protein [Source:NC... [more]
spon13.204e-3632.18spondin 1, extracellular matrix protein [Source:NC... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spon11.915e-3828.10spondin 1, (f-spondin) extracellular matrix protei... [more]
Spon26.949e-1930.14spondin 2, extracellular matrix protein [Source:MG... [more]
Tfpi5.846e-1335.45tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi5.846e-1335.45tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi5.846e-1335.45tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Spondin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VCC9|SPON1_MOUSE1.339e-3728.10Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 S... [more]
sp|P35446|SPON1_RAT2.340e-3728.10Spondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 P... [more]
sp|Q9HCB6|SPON1_HUMAN2.446e-3728.35Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV... [more]
sp|Q9GLX9|SPON1_BOVIN8.986e-3728.60Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1[more]
sp|Q9W770|SPON1_CHICK3.954e-3628.60Spondin-1 OS=Gallus gallus OX=9031 GN=SPON1 PE=2 S... [more]
back to top
BLAST of Spondin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7E8N43.661e-5229.70Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3WMX04.014e-5229.70Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3U4987.653e-5228.90Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3R7C1T52.122e-4843.42Spondin-1 OS=Clonorchis sinensis OX=79923 GN=SPON1... [more]
H2KTV52.409e-4843.42Spondin-1 OS=Clonorchis sinensis OX=79923 GN=CLF_1... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b2.558e-3526.72spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1a1.035e-2326.02spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9][more]
spon2b7.527e-2033.50spondin 2b, extracellular matrix protein [Source:Z... [more]
wfikkn12.358e-1540.35WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
spon2a1.133e-1325.27spondin-2-like [Source:NCBI gene;Acc:103039648][more]
back to top
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon2b8.577e-1524.12spondin 2b, extracellular matrix protein [Source:Z... [more]
spon2a1.510e-1029.55spondin 2a, extracellular matrix protein [Source:Z... [more]
ENSPMAT00000005038.12.844e-1029.46pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000009465.13.019e-1036.52pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 ... [more]
ENSPMAT00000005043.19.992e-1029.57pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spondin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498951.063e-2427.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317602.405e-1155.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384667.205e-752.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416967.331e-747.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262637.331e-747.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b2.552e-3626.13spondin-1 [Source:NCBI gene;Acc:101161803][more]
spon1a1.696e-3426.72spondin 1 [Source:NCBI gene;Acc:101161963][more]
spon2b2.034e-1924.33spondin 2 [Source:NCBI gene;Acc:101164320][more]
spon2a7.079e-1323.81spondin-2 [Source:NCBI gene;Acc:101163419][more]
COL6A33.386e-1228.00collagen type VI alpha 3 chain [Source:NCBI gene;A... [more]
back to top
BLAST of Spondin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039905.10.000e+099.64SMESG000039905.1[more]
SMESG000009946.13.387e-6928.38SMESG000009946.1[more]
SMESG000009946.16.979e-6928.38SMESG000009946.1[more]
SMESG000009946.11.109e-6828.61SMESG000009946.1[more]
SMESG000037996.12.186e-1032.43SMESG000037996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002168 ID=SMED30002168|Name=Spondin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2693bp
CAATTGCTTAATAAAATTTTCCTTTCAATAATTACCGTAAAAGTTGATGA
AATTAATTTTGAATATTTTATCCACTTTTTTCATATTGAAATTTGATTTT
GCTGAATGTTTCGGATTTTGTGACATTCAATTTCCGAAATCATACGTTGC
CTTTTCCACTAGATTCAATCTCTATACGAATCATGAAAAAGAAAAACTGA
CCAAAATCACCTCGTACATTCCTGATAAAACCTACGACATAACTGTGTCA
TTGAATGATAAAGCTATGCACGAAAAGTTGACAATAAAAGAAATATACGT
CTTAGTCTCAAATGTTCACACGGAAATGGAAGAATTGTCGGAACATGACT
GGAAAAACGCCGGTGAAGTGGTTTTTAATGTAACTCACGCATCCAAAACA
GAATATTGCCCCCAAAGAGCTTACGTTCAGTATTTATATACCCAACCCCA
ACATGTCACATTCTATTGGATAGCACCTAAAATACCGAATTTTTGTATTA
GAATAACAGTTATTTTGAAAATGAACGATTTGATTTCAGAAAGCAAATTC
GAAGAAAGATCCCACTGGATATGTGAACAAAAAAGAAACAAAATGGATCA
GATGCAAGCAGATCAATATGCATCTACCTCTTGCGCAATGAAACAAAAAA
CTGATCCAGTTAAACAATGTAATATTGGATCAACAGCGGTATATAGAATG
ACAATTGAAAATAAATGGAATTTATTAAATCATTGGAAAGATTGGCCGGG
CAAAGACGGGTATTCTCCTAAAATAACTCAATATCTCGGAGCTTCTCATT
CAAATGAGTTTAATATTTATCATCTTGGTGGAATGGCCAATGAAGGAGTT
TCTCAGGTATGTGGAAACGGGAGCTACACTGAATTGCAAAAGCAATTCTA
CAAAGCTGGGAACGGGATCATGACAGTTATATTGGCCAGGTCACTAGATG
CGTCATCAAAAACCAATAAAAGATCAGCACTGATTGTTGTAAATGCAACT
CAACATTTGGTTAGTTTTCTTGCAAGACTTCATCCAAGTCCCGATTGGTG
CACAGGTCTAAGTAGATTTGATCTTTGTAACGGCTCATGCAAATGGCAAG
AAAAATTTATCGTCCATTTATATCCTTGGGATGCCGGTGTTTACAGTGGA
GAGACTTATTTAAATAAAAACGAGAAAACTAGACAGACTCCAATATGTCC
AATCACTAGCAGTTGGCCAAAGGATAACCCTTTCACGGTGATGAACGGAA
AAATCAAAAATATCGGAGTGGTAACCTTCCAATTAATACAAGAATATAAC
AAAAATGATAACCAGTATTGTAATTCTATTAATTCAATCCTTCAAGACGA
AGCATACCAAAATGAACCGAAATCCAGTGCTCTGAAATCAAATCCAGATA
AAACCAGGCATTGCTTATTGTCAGAATGGAGTGAATGGAGCTCTTGTTCA
GAATCTTGTGGTAAAGGTGAAAAAACTCGTTACCGAAAACTGCTGAAAGG
AAAATCCGAACAATGCATTGAATCTTCCCTAACTAATACAGAGAGCTGTA
GCAGTAAATGTTCGACAGTAATTTCATTCGAAACATGTTCGTTTCGCTTG
TGGGGCCAATGGAGCCCATGCAATGCTACTTGTTCCCAGAAGGGAATTAT
TCATAGGGAACGTGTTTTTATCAATGAACAGGAAAAACACGAATGTATGC
AATATTCCGAAATGAAAGCCTCTCTTGAATGTGCATTAGCAAGCGAGAGG
TGCAAACCCGACGTGATCTGCAAGGAATATGTTTATCCTGGAGATTCGTG
TTCTTGGTCTAGCCCATCACAAAGATTTTATTACGATTTTTCTAGTGGAA
CTTGTAATGCATTTATTTACAAAGGCTGCTATGGGGGTCTGAATAATTTT
CACACCTACGAGGAATGTATTTTACTCTGTCGACCAAAATTAAAAGAAAC
AGATCAAAGACGATTTAATACGCCAGAAACTTATCCCAACCGATGCGGAG
TTTCGATGACATGGGGAATCTTTTGTGATAGTCAATCTTCATCAAACCGT
TGGTACTATGACAATATTAATAAAGAATGCTACCGATTTCGTTTCGGGGG
CTGTCGAGGGAATGCCAACAATTTCCGAACTAAAACTGAATGTCAAAATG
TTTGCTTGAGAGAAAAGTCTACTTCAACAACAACGACAACGATCAGTCAG
CCAGTAACGGTAAGAAAAGTCTGCATCTATTCCAACTGGTCGGACTGGAG
TTCTTGTGATAACAACTGTCAAAATCAACAAACAAGAATAAGATTTTTAA
TTGAAAAAAATGACGACTGCACCGAAAGTATCAGTGAAACAAGAAAATGT
CAATCAGAGAAATGCAATTCGCCAAATAACGGGTTTATTTCACTAAGGAA
TTGCAAGTATTCGAGTTGGTCGGAATGGTCGGCTTGTTCATCAAGATGCG
GTCCTGGCGTTAGAGAGAGAAAGCGGAAGAAACTTTCTCGTAATTGTAAA
CCGGAATTTCCGCAATTTACTGACCGAGAATCATGTTACAATGCTTGTGC
TTATGACTGAATCCGGTAAAGAAAAAAAAACTGTCAATGTATTTGTGTCA
TGACATTTTACCTATTGTGCATTTCATTTTGTGAACTTTGTTTGGTTTTT
GATTTATTTTTTCTTGGTGTTTTTCTCTAGAATATGATTTGTT
back to top

protein sequence of SMED30002168-orf-1

>SMED30002168-orf-1 ID=SMED30002168-orf-1|Name=SMED30002168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=838bp
MKLILNILSTFFILKFDFAECFGFCDIQFPKSYVAFSTRFNLYTNHEKEK
LTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSNVHTEMEELSEH
DWKNAGEVVFNVTHASKTEYCPQRAYVQYLYTQPQHVTFYWIAPKIPNFC
IRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQ
KTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGAS
HSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSL
DASSKTNKRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKW
QEKFIVHLYPWDAGVYSGETYLNKNEKTRQTPICPITSSWPKDNPFTVMN
GKIKNIGVVTFQLIQEYNKNDNQYCNSINSILQDEAYQNEPKSSALKSNP
DKTRHCLLSEWSEWSSCSESCGKGEKTRYRKLLKGKSEQCIESSLTNTES
CSSKCSTVISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHEC
MQYSEMKASLECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSS
GTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQRRFNTPETYPNRC
GVSMTWGIFCDSQSSSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQ
NVCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCDNNCQNQQTRIRF
LIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYSSWSEWSACSSR
CGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR036383TSP1_rpt_sf
IPR038678Spondin_N_sf
IPR000884TSP1_rpt
IPR002223Kunitz_BPTI
IPR009465Spondin_N
IPR020901Prtase_inh_Kunz-CS
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 458..506
e-value: 1.9E-7
score: 40.7
coord: 788..835
e-value: 5.4E-6
score: 35.9
coord: 516..576
e-value: 0.092
score: 18.5
coord: 728..774
e-value: 0.0035
score: 26.6
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 789..820
e-value: 3.0E-5
score: 24.1
coord: 518..551
e-value: 8.9E-6
score: 25.8
coord: 459..504
e-value: 9.2E-7
score: 29.0
coord: 729..773
e-value: 1.6E-4
score: 21.8
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 455..506
score: 10.397
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 785..835
score: 9.904
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 725..774
score: 9.596
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 513..576
score: 8.228
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 573..629
e-value: 1.1E-12
score: 58.1
coord: 648..704
e-value: 9.8E-13
score: 58.3
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 650..703
e-value: 2.0E-12
score: 47.1
coord: 574..629
e-value: 1.1E-10
score: 41.6
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 575..628
score: 13.236
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 650..703
score: 14.312
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 660..704
e-value: 5.8308E-12
score: 59.1858
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 593..629
e-value: 4.06708E-10
score: 53.793
IPR009465Spondin, N-terminalPFAMPF06468Spond_Ncoord: 214..394
e-value: 5.1E-44
score: 150.7
IPR009465Spondin, N-terminalPROSITEPS51020SPONDINcoord: 204..395
score: 45.855
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 644..706
e-value: 1.2E-13
score: 52.8
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 567..643
e-value: 2.1E-12
score: 48.6
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 645..704
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 574..631
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 512..566
e-value: 4.8E-5
score: 25.4
coord: 453..505
e-value: 4.9E-10
score: 41.4
coord: 724..773
e-value: 2.4E-5
score: 26.4
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 778..836
e-value: 5.3E-9
score: 37.6
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 726..773
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 455..501
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 513..552
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 784..830
IPR038678Spondin, N-terminal domain superfamilyGENE3DG3DSA:2.60.40.2130coord: 195..391
e-value: 3.0E-49
score: 169.7
NoneNo IPR availablePANTHERPTHR11311F-SPONDINcoord: 199..824
NoneNo IPR availablePANTHERPTHR11311:SF16SPONDIN-1coord: 199..824
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.6
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 681..699