Glycosyl transferase

Overview
NameGlycosyl transferase
Smed IDSMED30002162
Length (bp)1295
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycosyl transferase (SMED30002162) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycosyl transferase (SMED30002162) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycosyl transferase (SMED30002162) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycosyl transferase (SMED30002162) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002162

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002162h1SMcG0007108 SmedASXL_012212SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002162h1SMcG0007108 dd_Smed_v4_11247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002162h1SMcG0007108 dd_Smed_v4_11247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002162h1SMcG0007108 dd_Smed_v4_11247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002162h1SMcG0007108 dd_Smed_v4_11247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycosyl transferase vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 6.531e-7
Identity = 29/103 (28.16%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  474 GIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMN 782
             IPKI+H   +  +I +++    K C  ++ D + VLWTD S      T++   LT ++ S+   ++   R  +++  ILY +GG+ L LD  C   +  +++
Sbjct:   56 AIPKIIHQTWKTNEIPEKWVGAQKSCIDLHPDYEYVLWTDESMREFIATDYPWFLT-QYDSYPYNIE---RADVVRYFILYKYGGIYLDLDVGCNRTLDPLLH 154          
BLAST of Glycosyl transferase vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 8.465e-7
Identity = 32/104 (30.77%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  468 PNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIM 779
            P  IPKI+H   + EDI + +K+  ++C  ++ D K +LWTD   Y  FI E      D ++++   ++   R   I+  IL  +GGV + LD  C   +  ++
Sbjct:   52 PQLIPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYE-FIKEEYPWFLDTFENYKYPIE---RADAIRYFILSHYGGVYIDLDDGCERKLDPLL 151          
BLAST of Glycosyl transferase vs. TrEMBL
Match: A0A267F0E4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012259g1 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.421e-14
Identity = 58/231 (25.11%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  456 INQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEF--LFACSSKHQFLKSLIN-------DKNNF--------DKDRFYLTNYFELYKGQASKFKVETVN-VKLAEQILPKTEMEKICKTNVTGTKRKFG 1094
            I + P G+PKI+H +  + ++   Y++  + C   N D + VLWTD +        F+  +   ++SF  K+    R   I+ +ILY +GG+ + LD  C +P+   + S  CF++  +  R+  +F    +Y        C+ +H F + +I         K NF              LT  F+L+K  A+   V  +N    + +I P++ +   CK+     +R  G
Sbjct:   77 IPRTPAGVPKIIHFVYRDANVLAPYREALQTCVTKNPDWQVVLWTDQAIKAFMQKHFSSHM-KVFESFPHKIQ---RSDAIRYLILYKYGGLYMDLDMTCHAPLLPSLASHSCFLD--SERRHQTQFLHGRQYSAMNSAMGCTPEHPFFRQVIQFVFRPSTAKRNFLFPVSIFSTTGPEMLTKQFDLWKRDAANPTVVMLNETYFSPKINPRSGIYGRCKSMAPRLQRHSG 301          
BLAST of Glycosyl transferase vs. TrEMBL
Match: A0A267GVK0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033812g1 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.302e-14
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 3
Query:  456 INQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEF--LFACSSKHQFLKSLI-------NDKNNF--------DKDRFYLTNYFELYKGQASKFKVETVN-VKLAEQILPKTEMEKICKTNVTGTKRKFG 1094
            I + P G+PKI+H +  + ++   Y++  + C   N D + VLWTD +        F+  +   ++SF  K+    R   I+ +ILY +GG+ + LD  C +P+   +    CF++  +  R+  +F    +Y        C+  H F + +I         K NF              LT  F+L+K  A+   V  +N    + +I P++ +   CK+     +R  G
Sbjct:   77 IPRTPAGVPKIIHFVYRDANVLAPYREALQTCVTKNPDWQVVLWTDQAIKAFMQKHFSSHM-KVFESFPHKIQ---RSDAIRYLILYKYGGLYMDLDMTCHAPLLPSLAPHSCFLD--SERRHQTQFLHGRQYSAMNSAMGCTPGHPFFRQVIRFVFRPSTAKRNFLFPVSIFSTTGPEMLTKQFDLWKRDAANPTVVMLNETYFSPKINPRSGIYGRCKSMAPRLQRHSG 301          
BLAST of Glycosyl transferase vs. TrEMBL
Match: A0A1I8GZ28 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033812g2 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.725e-14
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 3
Query:  456 INQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEF--LFACSSKHQFLKSLI-------NDKNNF--------DKDRFYLTNYFELYKGQASKFKVETVN-VKLAEQILPKTEMEKICKTNVTGTKRKFG 1094
            I + P G+PKI+H +  + ++   Y++  + C   N D + VLWTD +        F+  +   ++SF  K+    R   I+ +ILY +GG+ + LD  C +P+   +    CF++  +  R+  +F    +Y        C+  H F + +I         K NF              LT  F+L+K  A+   V  +N    + +I P++ +   CK+     +R  G
Sbjct:   77 IPRTPAGVPKIIHFVYRDANVLAPYREALQTCVTKNPDWQVVLWTDQAIKAFMQKHFSSHM-KVFESFPHKIQ---RSDAIRYLILYKYGGLYMDLDMTCHAPLLPSLAPHSCFLD--SERRHQTQFLHGRQYSAMNSAMGCTPGHPFFRQVIRFVFRPSTAKRNFLFPVSIFSTTGPEMLTKQFDLWKRDAANPTVVMLNETYFSPKINPRSGIYGRCKSMAPRLQRHSG 301          
BLAST of Glycosyl transferase vs. TrEMBL
Match: A0A1I8I557 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031525g1 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.399e-9
Identity = 41/151 (27.15%), Postives = 71/151 (47.02%), Query Frame = 3
Query:  468 PNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDAS---FYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLIN 911
            P  IP+ILH + E E +  EY    + C ++N +   +LW D       + F  +F      K+ + L K D       I+ +ILY+FGG+   LD  C  P    ++   CF++  N  +++I ++K+      +  C   H F+  L++
Sbjct:   35 PRLIPRILHQVGESELVFAEYSFAIESCRRLNPNWTYILWRDKDAELLIKEFFPDFYRTQYAKYTNRLKKSDS------IRYIILYLFGGLYADLDVECMKPFSPDLDEEACFLDQENPAQSHIFWNKERSAMNSVMGCRPGHPFMLDLVS 179          
BLAST of Glycosyl transferase vs. TrEMBL
Match: A0A1I8GMC1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031525g2 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.464e-9
Identity = 41/151 (27.15%), Postives = 71/151 (47.02%), Query Frame = 3
Query:  468 PNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDAS---FYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLIN 911
            P  IP+ILH + E E +  EY    + C ++N +   +LW D       + F  +F      K+ + L K D       I+ +ILY+FGG+   LD  C  P    ++   CF++  N  +++I ++K+      +  C   H F+  L++
Sbjct:   35 PRLIPRILHQVGESELVFAEYSFAIESCRRLNPNWTYILWRDKDAELLIKEFFPDFYRTQYAKYTNRLKKSDS------IRYIILYLFGGLYADLDVECMKPFSPDLDEEACFLDQENPAQSHIFWNKERSAMNSVMGCRPGHPFMLDLVS 179          
BLAST of Glycosyl transferase vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 54.6842 bits (130), Expect = 1.219e-8
Identity = 32/104 (30.77%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  468 PNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIM 779
            P  IPKI+H   + EDI + +K+  ++C  ++ D K +LWTD   Y  FI E      D ++++   ++   R   I+  IL  +GGV + LD  C   +  ++
Sbjct:   52 PQLIPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYE-FIKEEYPWFLDTFENYKYPIE---RADAIRYFILSHYGGVYIDLDDGCERKLDPLL 151          
BLAST of Glycosyl transferase vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 46.2098 bits (108), Expect = 5.825e-6
Identity = 27/104 (25.96%), Postives = 51/104 (49.04%), Query Frame = 3
Query:  468 PNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIM 779
            P  IPKI+H   +  DI +++ +  ++C  ++ D   +LWTD      FI +      D ++S+   ++   R   I+  IL  +GG+ + LD  C   +  ++
Sbjct:   59 PQLIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTD-EMSDTFIKQEYPWFLDTFRSYEYPIE---RADAIRYFILSHYGGIYIDLDDGCERRLDPLL 158          
BLAST of Glycosyl transferase vs. Planmine SMEST
Match: SMESG000030921.1 (SMESG000030921.1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 367/370 (99.19%), Postives = 369/370 (99.73%), Query Frame = 3
Query:  126 MQRQQNYFSNGFHFRGILLNFDKFNPEFSLSSKSMRKIVLFYMXXXXXXXXXXXFISKDHFPIAFNNSFLIFSNIELFKRMKNNHSIDLPAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDRFYLTNYFELYKGQASKFKVETVNVKLAEQILPKTEMEKICKTNVTGTKRKFGCELLKTYKVNVNSSAVLVHLPLYGISKVQIVADDICSLGIAIHIVIV 1235
            MQRQQNYFSNGFHFRGILLNFDKF P+FSLSSKSMRKIVLFYMGSGVVLLSLVLFISKDHFPIAFNNSFLIFSNIELFKRMKNNHSIDLPAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDRFYLTNYFELYKGQASKFKVETVNVKLAEQ+LPKTEMEKICKTNVTGTKRKFGCELLKTYKVNVNSSAVLVHLPLYGISKVQIVADDICSLGIAIHIVIV
Sbjct:    1 MQRQQNYFSNGFHFRGILLNFDKFYPKFSLSSKSMRKIVLFYMGSGVVLLSLVLFISKDHFPIAFNNSFLIFSNIELFKRMKNNHSIDLPAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDRFYLTNYFELYKGQASKFKVETVNVKLAEQVLPKTEMEKICKTNVTGTKRKFGCELLKTYKVNVNSSAVLVHLPLYGISKVQIVADDICSLGIAIHIVIV 370          
BLAST of Glycosyl transferase vs. Planmine SMEST
Match: SMESG000030941.1 (SMESG000030941.1)

HSP 1 Score: 318.161 bits (814), Expect = 1.531e-106
Identity = 151/299 (50.50%), Postives = 198/299 (66.22%), Query Frame = 3
Query:  354 LFKRMKNNHSIDLPAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPI-----KQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDRFYLTNYFELYKGQASKFKVETVNVKLAEQILPKTEMEKICKTNVTGTKRKFGCELLKTYKVNVNSSAVLVHLPLYGISKVQIVADDICSLGIAIHIVIV 1235
            L K  +   SI +P IYRGDC+V++ + LK+F+  N+F NGIPKILH +S EEDI K Y ++YK C K+N DM  +LWTDASFY++F+TEF++ + DKWK   S LD   R  +I+SM+LYVFGGV LSLDTVC+ PI       +     CF ++ N +R NIE D+D +YGE +  CS+ H F + LI +K        Y T Y E Y     KF V  ++V +AEQ+ PK EMEKICK N TGTKR   C+L+   K+   S A+LVHLP YG+S VQIVA+DICS GI ++IVI+
Sbjct:   22 LVKVQRTKESIYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKMVFSNLDHPLRTFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTNTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNKMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTKIPGTSKAMLVHLPSYGVSNVQIVANDICSAGIPVYIVII 320          
BLAST of Glycosyl transferase vs. Planmine SMEST
Match: SMESG000030931.1 (SMESG000030931.1)

HSP 1 Score: 123.25 bits (308), Expect = 8.128e-34
Identity = 53/98 (54.08%), Postives = 71/98 (72.45%), Query Frame = 3
Query:  393 PAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFR 686
            P IYRGDC+V+  + LK+F+  N+F NGIPKILH +S EEDI K Y ++YK C K+N DM  +LWTDASFY++F+TEF++ + DKWK     L+   R
Sbjct:   19 PTIYRGDCRVMNIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTKMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFWNLNHPLR 116          
BLAST of Glycosyl transferase vs. Planmine SMEST
Match: SMESG000018285.1 (SMESG000018285.1)

HSP 1 Score: 110.153 bits (274), Expect = 8.880e-27
Identity = 83/300 (27.67%), Postives = 144/300 (48.00%), Query Frame = 3
Query:  396 AIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCFVN----IGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDR-------FYLTNYFELYKGQASKFKVETVNVKL----AEQILPKTEMEKI--CKTNVTGTKRKFGCELLKTYKVN---VNSSAVLVHLPLY-----GISKVQIVADDICSLGIAI 1220
              YR +C  I+ + +  +    +F NGIPK+LH + + E+I KEY +    C  +N D+K +LWTD + Y+  I  F E+L   ++S+    +    + I + ++LY FGG+ + +DT C+ P +  M+  +C ++    I +++  N+EF   N +     AC   H F K +     + D            LTN ++ Y    + F++      +     +Q  P  E   I  C+ ++ G  ++ GC+ L TYKVN       A+L+HL  +     G   +QI+  +IC +   I
Sbjct:   40 VFYRQNCWSISDEEILSYGKQEKFRNGIPKLLHYLCKTENIPKEYWEHVDNCMALNRDVKFILWTDYTLYQFVIKHFPEQLK-MYQSYFRSNEKLKNVDIARYLLLYKFGGLYMDMDTSCQKPFRDAMDHHNCILSSEMEIASQILYNVEFVTMNSF----MACIPNHIFFKFVYTQLKHDDGGHIMGLTGPLMLTNRYKEYINFLNLFELNDSKANIYRAPGKQFSPFFEYYIIDRCR-DLRGLWKRKGCKELDTYKVNRFKYEKEAILIHLFFHLGYNKGSKSIQILR-NICYVNGVI 332          
BLAST of Glycosyl transferase vs. Planmine SMEST
Match: SMESG000052805.1 (SMESG000052805.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.069e-26
Identity = 83/282 (29.43%), Postives = 136/282 (48.23%), Query Frame = 3
Query:  381 SIDLPAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLT-IIKSMILYVFGGVVLSLDTVCRSPIKQIMNSSDCF----VNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDR-------FYLTNYFELYKGQASKFKVETVN--VKLAEQIL--PKT--EMEKICKTNVTGTKRKFGCELLKTYKV---NVNSSAVLVHLPLY 1163
            S D+P    G C +I +D L +   + QFPN IPKI+H + +   I  +Y  L K C +IN D+K V W+D   YR  +  F E L + + S+ S   D  +++ +I+  IL  FGG+ +  DT C+ P + +  +  C     V    ++  N+ F   N     L AC S HQF + L++  N  D+           LT  F+ YK    + K + ++  + LA   L  P +   +E +C  ++    + +GC  LK ++       + AV++HL L+
Sbjct:   44 SADIPI---GFCSIITSDNLIEHGNLFQFPNRIPKIIHYVYKTSFIPNQYVALMKTCMEINYDVKFVFWSDLMAYRFMMNHFPEYL-NVYSSYFSNFTDILKISDVIRYFILLKFGGIYMDFDTKCQKPFRLVFVNDSCILSKEVEEQTQILWNVPFLAMNS----LMACVSNHQFFQYLVSRLNISDQSSSVHQTGPIMLTGTFKSYKKSTRQLKNKNISQKISLANSYLFSPYSVGNLESLCNYDLNHQWKIYGCLNLKAHREIQKRKMTEAVVLHLFLH 317          
The following BLAST results are available for this feature:
BLAST of Glycosyl transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q10323|IMT3_SCHPO6.531e-728.16Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|P33300|SUR1_YEAST8.465e-730.77Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
back to top
BLAST of Glycosyl transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F0E41.421e-1425.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GVK06.302e-1424.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GZ286.725e-1424.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I5571.399e-927.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GMC11.464e-927.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Glycosyl transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SUR11.219e-830.77Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH15.825e-625.96Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
back to top
BLAST of Glycosyl transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycosyl transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030921.10.000e+099.19SMESG000030921.1[more]
SMESG000030941.11.531e-10650.50SMESG000030941.1[more]
SMESG000030931.18.128e-3454.08SMESG000030931.1[more]
SMESG000018285.18.880e-2727.67SMESG000018285.1[more]
SMESG000052805.11.069e-2629.43SMESG000052805.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002162 ID=SMED30002162|Name=Glycosyl transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1295bp
CGATCTCAGTCATTGTCATTTTTTTCTCATAGAATCTATCCGAACGTCTG
TGTGTCCAATTGTTCCAATATTTCATCCAATAGGATTGCGCGCATGCAAT
CGATTATGGTTTTTTCTCTGTTGATATGCAACGTCAACAGAATTACTTTT
CAAATGGTTTTCATTTTCGTGGAATTTTATTGAATTTCGACAAGTTTAAT
CCAGAATTCTCTCTTTCATCGAAATCAATGAGGAAAATTGTCCTATTCTA
CATGGGATCTGGTGTTGTCCTGTTAAGTTTGGTGTTGTTCATTTCCAAAG
ATCATTTTCCGATAGCCTTCAATAATTCTTTCTTGATTTTTTCCAATATC
GAATTGTTTAAACGAATGAAAAATAATCACAGCATCGATTTGCCGGCAAT
ATATCGCGGAGACTGCAAGGTCATTGCTGCTGATTATTTAAAGGATTTTG
CAATCATCAATCAGTTTCCGAATGGAATTCCAAAAATCCTTCATTTGATT
TCCGAAGAAGAAGACATTTCTAAAGAATACAAACAGTTGTACAAAGAATG
CAGCAAAATCAACTCCGACATGAAAACGGTACTTTGGACAGATGCAAGTT
TTTACAGAATTTTCATCACGGAATTCAACGAGAAGTTGACTGACAAATGG
AAATCCTTTCTATCGAAATTAGACGATCAATTTCGGTTGACAATTATCAA
ATCCATGATTCTTTATGTATTTGGCGGGGTTGTGTTGTCATTGGATACGG
TTTGTAGAAGCCCAATCAAACAAATAATGAACAGCAGTGATTGTTTTGTC
AATATAGGAAACAGATTGAGAAACAATATTGAGTTCGACAAGGACAACAA
ATACGGAGAATTTCTGTTTGCATGCTCTTCAAAGCACCAGTTTCTGAAAT
CTTTAATCAATGACAAAAACAACTTCGATAAAGATCGATTCTATCTGACG
AATTACTTTGAATTGTATAAAGGTCAAGCTTCAAAATTCAAAGTGGAAAC
GGTCAATGTTAAACTTGCGGAACAGATTCTTCCAAAAACGGAAATGGAGA
AAATTTGCAAGACAAATGTCACAGGAACGAAGCGGAAATTCGGATGTGAG
TTGTTGAAAACTTATAAAGTAAATGTAAATTCTTCGGCGGTTTTAGTTCA
TTTGCCCCTCTATGGGATATCAAAAGTCCAAATTGTTGCCGATGACATTT
GCTCCCTTGGTATCGCAATTCACATAGTTATTGTATAAACAAACTTTCAG
CCTACCTAAGATCTTTTTTATCAACTATATCAGATAGTAAAAGCA
back to top

protein sequence of SMED30002162-orf-1

>SMED30002162-orf-1 ID=SMED30002162-orf-1|Name=SMED30002162-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=371bp
MQRQQNYFSNGFHFRGILLNFDKFNPEFSLSSKSMRKIVLFYMGSGVVLL
SLVLFISKDHFPIAFNNSFLIFSNIELFKRMKNNHSIDLPAIYRGDCKVI
AADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMK
TVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFG
GVVLSLDTVCRSPIKQIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFAC
SSKHQFLKSLINDKNNFDKDRFYLTNYFELYKGQASKFKVETVNVKLAEQ
ILPKTEMEKICKTNVTGTKRKFGCELLKTYKVNVNSSAVLVHLPLYGISK
VQIVADDICSLGIAIHIVIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.550.20coord: 118..319
e-value: 3.2E-5
score: 26.2
NoneNo IPR availablePANTHERPTHR32385FAMILY NOT NAMEDcoord: 109..276
NoneNo IPR availablePANTHERPTHR32385:SF18coord: 109..276
NoneNo IPR availableTMHMMTMhelixcoord: 38..57
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 59..277