GCR004

Overview
NameGCR004
Smed IDSMED30002158
Length (bp)1354
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR004 (SMED30002158) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR004 (SMED30002158) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR004 (SMED30002158) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR004 (SMED30002158) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of GCR004 vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 160.999 bits (406), Expect = 1.323e-44
Identity = 140/360 (38.89%), Postives = 196/360 (54.44%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SS + G  S  + K +    LST+I +AI GN LV+V+V    +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+    +S++PI       G+    E  ++ Q SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++  +QI QM +R  +         D +S +               ++ E KAAKTL IIMG F +CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSEE-GFGS--VEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQI-QMLQRAGASSESRPQSADQHSTH--------------RMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVD------PFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 160.999 bits (406), Expect = 1.699e-44
Identity = 140/360 (38.89%), Postives = 196/360 (54.44%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SS + G  S  + K +    LST+I +AI GN LV+V+V    +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+    +S++PI       G+    E  ++ Q SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++  +QI QM +R  +         D +S +               ++ E KAAKTL IIMG F +CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSEE-GFGS--VEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQI-QMLQRAGASSESRPQSADQHSTH--------------RMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVD------PFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 160.614 bits (405), Expect = 2.321e-44
Identity = 140/360 (38.89%), Postives = 196/360 (54.44%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SS + G  S  + K +    LST+I +AI GN LV+V+V    +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+    +S++PI       G+    E  ++ Q SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++  +QI QM +R  +         D +S +               ++ E KAAKTL IIMG F +CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSEE-GFGS--VEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQI-QMLQRAGASSESRPQSADQHSTH--------------RMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVD------PFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 160.614 bits (405), Expect = 2.321e-44
Identity = 140/360 (38.89%), Postives = 196/360 (54.44%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SS + G  S  + K +    LST+I +AI GN LV+V+V    +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+    +S++PI       G+    E  ++ Q SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++  +QI QM +R  +         D +S +               ++ E KAAKTL IIMG F +CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSEE-GFGS--VEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQI-QMLQRAGASSESRPQSADQHSTH--------------RMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVD------PFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 160.999 bits (406), Expect = 2.396e-44
Identity = 140/360 (38.89%), Postives = 196/360 (54.44%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SS + G  S  + K +    LST+I +AI GN LV+V+V    +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+    +S++PI       G+    E  ++ Q SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++  +QI QM +R  +         D +S +               ++ E KAAKTL IIMG F +CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSEE-GFGS--VEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQI-QMLQRAGASSESRPQSADQHSTH--------------RMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVD------PFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 127.487 bits (319), Expect = 3.043e-32
Identity = 108/347 (31.12%), Postives = 170/347 (48.99%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQ------ENQIFQMQKRTFSHGH------RSSVKCDHNSINLNDKKK-----------------------TLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            GN LV+V+V  +  L+++  N F+VSLA +DL V+  VM        + G WL G  +C  F   D+L  T+SI +L +I++DRY +I  P  Y Q  T++   ++++  WI ++++S  PI  G  +  EN          C       F + S+  SF++P +VM +VY  I+  AR++       + + ++Q       +      R+SV+    S  + +K                          L K E+I + KE +AAKT+ +I+ VF  CWLPFF+   I+  C  C +LH  +     W+GY NS+LNP +Y     +FRRAFK  L     + QR
Sbjct:   74 GNTLVVVAVFSYRPLKKV-QNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII-GWNNWQENMMED-----SCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRVGEKTPLVIADGQTTVTTLAAHSNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETC-KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQR 412          
BLAST of GCR004 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 127.487 bits (319), Expect = 3.245e-32
Identity = 110/359 (30.64%), Postives = 172/359 (47.91%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQ------ENQIFQMQ-------------KRTFSHGHRSSVKCDHNSINLNDKKK----------------------------TLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            GN LV+V+V  +  L+++  N F+VSLA +DL V+  VM        + G WL G  +C  F   D+L  T+SI +L +I++DRY +I  P  Y Q  T++   ++++  WI ++++S  PI  G  +  EN          C       F + S+  SF++P +VM +VY  I+  AR++       + + ++Q             KR      R+S + D  S+  ++  K                             L K E+I + KE +AAKT+ +I+ VF  CWLPFF+   I+  C  C +LH  +     W+GY NS+LNP +Y     +FRRAFK  L     + QR
Sbjct:   63 GNTLVVVAVFSYRPLKKV-QNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII-GWNNWQENMMEDS-----CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETC-KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQR 413          
BLAST of GCR004 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 127.102 bits (318), Expect = 4.153e-32
Identity = 110/359 (30.64%), Postives = 172/359 (47.91%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQ------ENQIFQMQ-------------KRTFSHGHRSSVKCDHNSINLNDKKK----------------------------TLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            GN LV+V+V  +  L+++  N F+VSLA +DL V+  VM        + G WL G  +C  F   D+L  T+SI +L +I++DRY +I  P  Y Q  T++   ++++  WI ++++S  PI  G  +  EN          C       F + S+  SF++P +VM +VY  I+  AR++       + + ++Q             KR      R+S + D  S+  ++  K                             L K E+I + KE +AAKT+ +I+ VF  CWLPFF+   I+  C  C +LH  +     W+GY NS+LNP +Y     +FRRAFK  L     + QR
Sbjct:   74 GNTLVVVAVFSYRPLKKV-QNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII-GWNNWQENMMEDS-----CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETC-KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQR 424          
BLAST of GCR004 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 127.102 bits (318), Expect = 4.266e-32
Identity = 110/359 (30.64%), Postives = 172/359 (47.91%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQ------ENQIFQMQ-------------KRTFSHGHRSSVKCDHNSINLNDKKK----------------------------TLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            GN LV+V+V  +  L+++  N F+VSLA +DL V+  VM        + G WL G  +C  F   D+L  T+SI +L +I++DRY +I  P  Y Q  T++   ++++  WI ++++S  PI  G  +  EN          C       F + S+  SF++P +VM +VY  I+  AR++       + + ++Q             KR      R+S + D  S+  ++  K                             L K E+I + KE +AAKT+ +I+ VF  CWLPFF+   I+  C  C +LH  +     W+GY NS+LNP +Y     +FRRAFK  L     + QR
Sbjct:   71 GNTLVVVAVFSYRPLKKV-QNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII-GWNNWQENMMEDS-----CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETC-KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQR 421          
BLAST of GCR004 vs. Ensembl Celegans
Match: dop-1 (DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q86ME5])

HSP 1 Score: 118.242 bits (295), Expect = 3.454e-29
Identity = 122/342 (35.67%), Postives = 179/342 (52.34%), Query Frame = 2
Query:  146 LLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASD--GLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQI-FQMQKRT---FSHGHRSSVKCDHNSI--NLNDKKKTLYKEERIMLQ------------KEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPEL-HPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFK---IQLKSCC 1099
            L S +I +A+FGN LV  ++L    LR+   N F+VSLA++DLLVS  VM F+A    +D  G W FG F C  + + D+   TASI +L +IS+DRY  I  P  Y +    R+   +++  W+ +  +   P+  G + S          P  CE R+   + IGSS++SF++P +VM I+Y  +Y  ARK    I  Q+Q+ T           ++    SI   LN    T +K +R                 + KA  TLG+IMG F+VCWLPFF  + I  A L  PE+     +  + W+GY NS+ NP IY+ + +DFRRAFK   +++  CC
Sbjct:   11 LFSVLIILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAA---VNDILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYVIVLVWLISAGIGAAPLGFG-FGSKVTINNLTGLPV-CEMRLPLPYAIGSSMVSFFLPAMVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREIRTSIFSKLNFLCPTRFKNQRSPQDPHTPAAHNRSNISDQKARLTLGVIMGTFLVCWLPFFT-VNILRAWL--PEIFSSKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKIIVRVFGCC 344          
BLAST of GCR004 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0301484)

HSP 1 Score: 249.98 bits (637), Expect = 4.453e-78
Identity = 160/342 (46.78%), Postives = 217/342 (63.45%), Query Frame = 2
Query:   89 SSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTF---SHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC--PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
            S++    SS +    +K  ++  II  AI GN LVIVSV+R  KLR IITN FVVSLA+AD+LV+ C MTF+AS++ S G W+FG  +CD++N+ DV FSTASI HL  IS+DRY +I  P  Y  IMT R+  +ML+  W+   ++S++PI +G Y++ EN+++ KSNP  CEF+VN  + I SS +SFWIP IVM  +Y  IY++A +QE  +++ +        H   S +     SI +     +  + ER       KAA+TLGIIM  F++CWLPFFLW  + + C  C  P L   LV  LFWIGYFNS LNP IYA++ +DFR AFK  LK  C
Sbjct:   94 STDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR-IITNYFVVSLAVADMLVALCAMTFNASVMIS-GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRER-------KAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRL---LVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKVSC 423          
BLAST of GCR004 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0100322)

HSP 1 Score: 248.054 bits (632), Expect = 1.747e-77
Identity = 159/340 (46.76%), Postives = 217/340 (63.82%), Query Frame = 2
Query:   89 SSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTF---SHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC--PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKS 1093
            S++    SS +    +K  ++  II  AI GN LVIVSV+R  KLR IITN FVVSLA+AD+LV+ C MTF+AS++ S G W+FG  +CD++N+ DV FSTASI HL  IS+DRY +I  P  Y  IMT R+  +ML+  W+   ++S++PI +G Y++ EN+++ KSNP  CEF+VN  + I SS +SFWIP IVM  +Y  IY++A +QE  +++ +        H   S +     SI +     +  + ER       KAA+TLGIIM  F++CWLPFFLW  + + C  C  P L   LV  LFWIGYFNS LNP IYA++ +DFR AFK  LK+
Sbjct:   94 STDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR-IITNYFVVSLAVADMLVALCAMTFNASVMIS-GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRER-------KAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRL---LVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKT 421          
BLAST of GCR004 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0331930)

HSP 1 Score: 248.44 bits (633), Expect = 1.396e-76
Identity = 160/340 (47.06%), Postives = 217/340 (63.82%), Query Frame = 2
Query:   89 SSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTF---SHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC--PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKS 1093
            S++    SS +    +K  ++  II  AI GN LVIVSV+R  KLR IITN FVVSLA+AD+LV+ C MTF+AS++ S G W+FG  +CD++N+ DV FSTASI HL  IS+DRY +I  P  Y  IMT R+  +ML+  W+   ++S++PI +G Y++ EN+++ KSNP  CEF+VN  + I SS +SFWIP IVM  +Y  IY++A +QE  +++ +        H   S +     SI +     +  + ER       KAA+TLGIIM  F++CWLPFFLW  + + C  C  P L   LV  LFWIGYFNS LNP IYA++ +DFR AFK  LKS
Sbjct:   94 STDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR-IITNYFVVSLAVADMLVALCAMTFNASVMIS-GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRER-------KAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRL---LVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKS 421          
BLAST of GCR004 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0084260)

HSP 1 Score: 248.44 bits (633), Expect = 1.396e-76
Identity = 160/340 (47.06%), Postives = 217/340 (63.82%), Query Frame = 2
Query:   89 SSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTF---SHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC--PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKS 1093
            S++    SS +    +K  ++  II  AI GN LVIVSV+R  KLR IITN FVVSLA+AD+LV+ C MTF+AS++ S G W+FG  +CD++N+ DV FSTASI HL  IS+DRY +I  P  Y  IMT R+  +ML+  W+   ++S++PI +G Y++ EN+++ KSNP  CEF+VN  + I SS +SFWIP IVM  +Y  IY++A +QE  +++ +        H   S +     SI +     +  + ER       KAA+TLGIIM  F++CWLPFFLW  + + C  C  P L   LV  LFWIGYFNS LNP IYA++ +DFR AFK  LKS
Sbjct:   94 STDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR-IITNYFVVSLAVADMLVALCAMTFNASVMIS-GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRER-------KAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRL---LVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKS 421          
BLAST of GCR004 vs. Ensembl Fly
Match: Octbeta2R (gene:FBgn0038063 transcript:FBtr0304845)

HSP 1 Score: 248.44 bits (633), Expect = 2.371e-76
Identity = 152/322 (47.20%), Postives = 208/322 (64.60%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEE------------RIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIF 1108
            GN LVI+SV+R  KLR +ITN FVVSLA+AD++V+   MTF+ S V   G W F PFLCDL+N+ DV FSTASI HL  IS+DRY +I  P +Y   MT R   +ML+  WI   ++S++PIF G Y++ ++ Q+   NPT+C F VN ++ + SS ISFWIPC +M   Y  I+++A +QE Q+  M+       HR S++    +++ +   KTL   E             I +++EHKAA+TLGIIMG FI+CWLPFFLW T+   C  C ++  I+V  LFWIGYFNSTLNP IYA++ +DFR AF+    +  C+F
Sbjct:  170 GNLLVIISVMRVRKLR-VITNYFVVSLAMADIMVAIMAMTFNFS-VQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLM-MRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEEC-QVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFR---NTLLCLF 484          
BLAST of GCR004 vs. Ensembl Zebrafish
Match: adrb2a (adrenoceptor beta 2, surface a [Source:ZFIN;Acc:ZDB-GENE-100414-3])

HSP 1 Score: 170.629 bits (431), Expect = 5.166e-48
Identity = 133/351 (37.89%), Postives = 199/351 (56.70%), Query Frame = 2
Query:  146 LLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTK-CEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSR 1195
            L+S ++ I +FGN +VI ++ RF +L+ + TN F+ SLA ADL++   V+ F A  +  +  W FG FLCD + A DVL  TASI  L  I+MDRYI+I  PF+Y  ++T  ++  +++  W+ A +VSY+PI    + S +N      N T  CEF +   + I SSIISF+IP ++M  VY  ++++ARKQ  +I + + R   H  +S+ +    + N ++ + T  K+ +  L KEHKA KTLGIIMGVF +CWLPFF+   I    +            L WIGY NS  NP IY     DFR AFK  L    C+ +     ++ N   + N++ + + N   S+
Sbjct:   34 LMSILVLIIVFGNVMVITAISRFQRLQNV-TNCFITSLACADLVMGLVVIPFGALYIILN-TWHFGHFLCDFWTATDVLCVTASIETLCVIAMDRYIAITSPFRYQSLLTKNRARFIVLMVWVIAGLVSYLPIHMEWWISTDNETLCCYNNTYCCEFDITYSYAIVSSIISFYIPLVIMVFVYSRVFQEARKQLKKINKTEGRF--HAQKSNSRNQDVANNHSEMRST--KKAKFYL-KEHKALKTLGIIMGVFTLCWLPFFVLNVIPKGSVDIWTFR-----ILNWIGYANSAFNPLIYC-RSPDFRYAFKEIL----CLNRSRYPNVRPNNGYIYNAHSWQSENREQSK 367          
BLAST of GCR004 vs. Ensembl Zebrafish
Match: drd1a (dopamine receptor D1a [Source:ZFIN;Acc:ZDB-GENE-130522-1])

HSP 1 Score: 161.384 bits (407), Expect = 4.989e-45
Identity = 120/322 (37.27%), Postives = 176/322 (54.66%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTK---------------CEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC----PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQL 1087
            GN LV  +V +F  LR  +TN FV+SLA++DLLV+  VM + A +    G W FG F CD++ A D++ STASI +L  IS+DRY +I  PF+Y + MT R + +M+   W  ++++S+IP+           +W K+ PT                C+  +N  + I SS+ISF+IP  +M + Y  IY+ A+KQ  +I  +++         S K  H+S+  +          ++  ++E K  KTL +IMGVF+ CWLPFF+   +   C R     P + P   D   W G+ NS+LNP IYAF   DFRRAF I L
Sbjct:   41 GNTLVCAAVTKFRHLRSKVTNFFVISLAVSDLLVAILVMPWKA-VTEVAGFWPFGAF-CDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPRVAFVMISVAWTLSVLISFIPV---------QLKWHKAQPTSFPEANASHRALLTDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTQIYRIAQKQIRRISALERAA------ESAKIRHDSMGSS-SNVDSESSFKLSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKRTSVGLPCISPTTFDVFVWFGWANSSLNPIIYAF-NADFRRAFAILL 343          
BLAST of GCR004 vs. Ensembl Zebrafish
Match: drd1a (dopamine receptor D1a [Source:ZFIN;Acc:ZDB-GENE-130522-1])

HSP 1 Score: 161.384 bits (407), Expect = 4.989e-45
Identity = 120/322 (37.27%), Postives = 176/322 (54.66%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTK---------------CEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC----PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQL 1087
            GN LV  +V +F  LR  +TN FV+SLA++DLLV+  VM + A +    G W FG F CD++ A D++ STASI +L  IS+DRY +I  PF+Y + MT R + +M+   W  ++++S+IP+           +W K+ PT                C+  +N  + I SS+ISF+IP  +M + Y  IY+ A+KQ  +I  +++         S K  H+S+  +          ++  ++E K  KTL +IMGVF+ CWLPFF+   +   C R     P + P   D   W G+ NS+LNP IYAF   DFRRAF I L
Sbjct:   41 GNTLVCAAVTKFRHLRSKVTNFFVISLAVSDLLVAILVMPWKA-VTEVAGFWPFGAF-CDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPRVAFVMISVAWTLSVLISFIPV---------QLKWHKAQPTSFPEANASHRALLTDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTQIYRIAQKQIRRISALERAA------ESAKIRHDSMGSS-SNVDSESSFKLSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKRTSVGLPCISPTTFDVFVWFGWANSSLNPIIYAF-NADFRRAFAILL 343          
BLAST of GCR004 vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 164.466 bits (415), Expect = 5.171e-45
Identity = 134/376 (35.64%), Postives = 204/376 (54.26%), Query Frame = 2
Query:   77 NASISSNKLGISSQIIAKCIK-TLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQK---SNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEER-------IMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIK--NACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSN-RNSLTNSY 1162
            N S+  N  G+   ++++ +   L+L   I  AI GN LVI+SV+    LR   TN F+V+LA+ADLL+   V+  SA++    G W+FG   CD++ A DVL  TASI  L  IS+DRYI +  P QY  I+T R+++L ++G W+ +LV+S  P+            W++    + T C     PF+ + SS+ SF+IP IV+ ++Y  +Y  A++    +    K    +    +++    S    D  K+   + R       +   +E KAAKTLG+++G+F +CWLPFFL + I   N  LR PE    +   +FW+GYFNS LNP IY  Y ++F+ AF I++  C C  +R       N R S  NS+
Sbjct:   29 NFSLKLNGTGLEPLLLSRAVPLGLVLGFFITFAIAGNILVILSVVCNRHLRSP-TNYFIVNLAIADLLLGTTVLPVSATLEVV-GHWVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVISIGPL----------LGWKEPPSPDDTVCAINEEPFYALFSSLGSFYIPLIVILVMYCRVYVVAKRTTKNLEAGVKTESMNSGEITLRIHRGSQVHEDAGKSRAHQARNSLTVKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPE---TVSSIIFWLGYFNSCLNPIIYPCYSREFKLAF-IRILKCRCHRRRRPGWRAYNYRGSQINSF 388          
BLAST of GCR004 vs. Ensembl Zebrafish
Match: adrb2b (adrenoceptor beta 2, surface b [Source:ZFIN;Acc:ZDB-GENE-070410-32])

HSP 1 Score: 162.155 bits (409), Expect = 8.578e-45
Identity = 117/317 (36.91%), Postives = 180/317 (56.78%), Query Frame = 2
Query:  140 TLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ-KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIML-QKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVD--TLFWIGYFNSTLNPAIYAFYQQDFRRAFK 1078
            ++L+  ++ + +FGN LVI +++RF +L+  +TN F+ SLA ADL++   V+ F A  +  +  W FG F C+ + A DVL  TASI  L  I++DRYI+I  P +Y  ++T RK+  M+IG W  A ++S++PI    + S E         PT C+F  N  + + SSIISF+IP ++M  VY  ++++AR+Q  +I +++ R  +              +L+ ++    K  R     K+HKA KTLGIIMG F +CWLPFF    + N      ++  I++    L WIGY NS  NP IY     +FR AF+
Sbjct:   44 SILIGILVLVIVFGNALVISAIVRFQRLQ-TVTNYFISSLACADLVMGLMVVPFGACYILLN-TWHFGNFFCEFWTATDVLCVTASIETLCVIALDRYIAIMWPLRYQSMLTKRKACGMVIGVWAVAALISFLPIHMEWWVSDEPEALSCLEEPTCCDFNTNAAYAVTSSIISFYIPLVIMAFVYSRVFQEARRQLQKIDRIEGRIRTQ-------------SLSTQEGNEIKNRRTKFCMKDHKALKTLGIIMGTFTLCWLPFF----VLNVVAAIWKMDNIMLPFRILNWIGYANSAFNPLIYC-RSPEFRCAFQ 340          
BLAST of GCR004 vs. Ensembl Xenopus
Match: rgs9bp (regulator of G-protein signaling 9 binding protein [Source:Xenbase;Acc:XB-GENE-1011615])

HSP 1 Score: 163.31 bits (412), Expect = 1.252e-45
Identity = 137/352 (38.92%), Postives = 189/352 (53.69%), Query Frame = 2
Query:   77 NASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSA-----ENFQWQKS-NPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
            N +++SN+      + A+ +    +S +I + I GN LV+V+V R  +LR+I TN F+VSLA ADLLVS  VM F A  +  +  W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCWI    +S++PI  G  S       E  ++ KS N T C F VN  + I  S+++F+IP  +M + Y  IY  AR+   QI  +Q+      HR      H   +   + KT           E KAAKTL IIMG F +CW PFF+   +       P ++   P+ + T F W+GY NS LNP +YAF  + FRRAF I L  CC
Sbjct:    4 NINVTSNE---GYGVAARIVLISFISAVILMTILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQEK-WIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRITLMLSGCWIIPTFISFLPIMQGWNSIGILDLIETRKYNKSSNSTNCIFMVNKPYAITCSVVAFYIPFFLMVLAYYRIYITAREHARQIGVLQRAGAPADHRH----QHPDQHTTHRMKT-----------ETKAAKTLCIIMGCFCLCWAPFFITNVVD------PFINYSVPVELWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL--CC 328          
BLAST of GCR004 vs. Ensembl Xenopus
Match: rgs9bp (regulator of G-protein signaling 9 binding protein [Source:Xenbase;Acc:XB-GENE-1011615])

HSP 1 Score: 162.925 bits (411), Expect = 2.285e-45
Identity = 137/352 (38.92%), Postives = 189/352 (53.69%), Query Frame = 2
Query:   77 NASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSA-----ENFQWQKS-NPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
            N + S+   G++++I+        +S +I + I GN LV+V+V R  +LR+I TN F+VSLA ADLLVS  VM F A  +  +  W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCWI    +S++PI  G  S       E  ++ KS N T C F VN  + I  S+++F+IP  +M + Y  IY  AR+   QI  +Q+      HR      H   +   + KT           E KAAKTL IIMG F +CW PFF+   +       P ++   P+ + T F W+GY NS LNP +YAF  + FRRAF I L  CC
Sbjct:    7 NVNKSNEGYGVAARIVL----ISFISAVILMTILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQEK-WIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRITLMLSGCWIIPTFISFLPIMQGWNSIGILDLIETRKYNKSSNSTNCIFMVNKPYAITCSVVAFYIPFFLMVLAYYRIYITAREHARQIGVLQRAGAPADHRH----QHPDQHTTHRMKT-----------ETKAAKTLCIIMGCFCLCWAPFFITNVVD------PFINYSVPVELWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL--CC 330          
BLAST of GCR004 vs. Ensembl Xenopus
Match: prrc2c (proline-rich coiled-coil 2C [Source:Xenbase;Acc:XB-GENE-984671])

HSP 1 Score: 159.844 bits (403), Expect = 9.026e-44
Identity = 128/379 (33.77%), Postives = 197/379 (51.98%), Query Frame = 2
Query:   77 NASISSNKLG----ISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ-KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILV-DTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSR 1195
            N S +S+K G    +   II  CI  +++         GN LVI ++ +F +L+ + TN F+ SLA ADLL+   V+ F AS +  D  W+F  F C+ + + D+L  TASI  L  I++DRY +I  PF+Y  ++T  K+ ++++  W+ + + S++PI+   Y   E        +P+ C F  NP + I SSIISF++P +VM  VY  ++++A+KQ  +I + + R     H  + + D N    N +    +        KEHKA KTLGIIMG F +CWLPFF+   ++   +   +  P+ V + L W+GY NS  NP IY     DFR             FQ  +C  K    +  N Y     NSA++ 
Sbjct:   24 NTSNASDKPGDAWMVGMGIIMSCIVLVIV--------LGNVLVITAIAKFQRLQTV-TNYFITSLACADLLMGLIVVPFGASSIILDT-WVFNNFWCEFWTSVDILCVTASIETLCVIAVDRYFAITSPFRYQSLLTKCKARIVILLVWVVSTLTSFLPIYMHWYRIEEESALHCYDDPSCCFFFTNPAYAISSSIISFYLPLVVMIFVYARVFQEAKKQLKKIDKSEGRF----HNQNNQQDTNGKQGNKRTSKFW-------LKEHKALKTLGIIMGTFTLCWLPFFIVNIVQ---VMHKDFIPVKVYNFLNWVGYVNSAFNPLIYC-RSPDFRYT-----------FQELLCLRKPGSKAYANGYPQSNGNSAYNE 366          
BLAST of GCR004 vs. Ensembl Xenopus
Match: crtam (cytotoxic and regulatory T cell molecule [Source:Xenbase;Acc:XB-GENE-962112])

HSP 1 Score: 158.303 bits (399), Expect = 8.472e-43
Identity = 118/310 (38.06%), Postives = 174/310 (56.13%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPT-KCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC--------PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFK 1078
            FGN LV  +V+RF  LR  +TN F+VSLA++DLLV+  VM + A +    G W FG F CD++ A D++ STASI +L  IS+DRY +I  PF+Y + MT R ++LM+   W  ++++S+IP+    + S  +     +  T  C+  +N  + I SS+ISF+IP  +M + Y  IY+ A+ Q  +I  ++ R   H       C  N ++    + +L    +  ++KE K  KTL IIMGVF+ CWLPFF+   +   C R         P +     D   W G+ NS+LNP IYAF   DFR+ F 
Sbjct:   57 FGNILVCTAVMRFRHLRNRVTNIFIVSLAVSDLLVALLVMPWKA-VAEVAGHWPFGAF-CDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTQRVALLMISAAWALSVLISFIPVQLSWHKSETDDHLLSNQSTGNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQIQIRRISTLE-RAAEHAQ----SCRSNRVDCRHHQSSL----KTSIKKETKVLKTLSIIMGVFVCCWLPFFILNCMVPFCDRSSGHPQAGLPCVSETTFDIFVWFGWANSSLNPIIYAF-NADFRKVFS 354          
BLAST of GCR004 vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 158.303 bits (399), Expect = 1.581e-42
Identity = 114/318 (35.85%), Postives = 173/318 (54.40%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTK---CEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHG-------HRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
             GN LVI+SV   H+  + +T+ F+ +LA+ADLL+   V+ FSA+     G WLFG   C+++ A DVL  TASI  L +IS+DRYI +  P +Y  IMT ++ +L L+  W+ +LV+S  P+          F W++  P     CE    P + + S+  SF++P  ++ ++Y  +Y  A+++   +    K   S         HR S      S + + K+KT +    +   +E KAAKTLGI++G F++CWLPFFL M I +          I   T FW+GYFNS +NP IY     +FR+AF+  L + C
Sbjct:   66 LGNILVILSV-ACHRHLQTVTHYFIANLAVADLLLMSMVLPFSATF-EIQGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVISIGPL----------FGWKQPAPEDDKICEITKEPGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESKVLTSGMKLEKSDSEEVTLRIHRKSTPESIGSTS-SSKQKTQFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIYPPANSSDTIFKIT-FWLGYFNSCINPVIYPCSSPEFRKAFQNILHARC 369          
BLAST of GCR004 vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 160.999 bits (406), Expect = 1.409e-44
Identity = 144/393 (36.64%), Postives = 203/393 (51.65%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCC---------IFQRAVCCLKSNRNSLTNSYEYYTTNSA 1186
            +  +A++SSN+ G  S  + K +    L+ +I +AI GN LV+V+V R  +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W +G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+  + +S++PI       G+    E  ++   SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++   QI QM +R  +         D +S +               ++ E KAAKTL +IMG F  CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC         I  + V C  +  N  T+   Y   +S 
Sbjct:    2 DKLDANVSSNE-GFRS--VEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQI-QMLQRAGATSESRPQPADQHSTH--------------RMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVD------PFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDERYKRPPILGQTVPCSTTTINGSTHVLRYTVLHSG 366          
BLAST of GCR004 vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 159.844 bits (403), Expect = 2.253e-44
Identity = 138/360 (38.33%), Postives = 194/360 (53.89%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SSN+ G  S  + K +    L+ +I +AI GN LV+V+V R  +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W +G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+  + +S++PI       G+    E  ++   SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++   QI QM +R  +         D +S +               ++ E KAAKTL +IMG F  CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSNE-GFRS--VEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQI-QMLQRAGATSESRPQPADQHSTH--------------RMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVD------PFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 159.844 bits (403), Expect = 2.961e-44
Identity = 138/360 (38.33%), Postives = 194/360 (53.89%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIF-----TGLYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SSN+ G  S  + K +    L+ +I +AI GN LV+V+V R  +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W +G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+  + +S++PI       G+    E  ++   SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++   QI QM +R  +         D +S +               ++ E KAAKTL +IMG F  CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSNE-GFRS--VEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQI-QMLQRAGATSESRPQPADQHSTH--------------RMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVD------PFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 159.844 bits (403), Expect = 3.650e-44
Identity = 138/360 (38.33%), Postives = 194/360 (53.89%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTG-----LYSSAENFQW-QKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELH---PILVDTLF-WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            +  +A++SSN+ G  S  + K +    L+ +I +AI GN LV+V+V R  +LR+I TN F+VSLA ADLLVS  VM F A  +  D +W +G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LML GCW+  + +S++PI  G     +    E  ++   SN T C F VN  + I  S+++F+IP ++M + Y  IY  A++   QI QM +R  +         D +S +               ++ E KAAKTL +IMG F  CW PFF+   +       P +    P  V T F W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:    2 DKLDANVSSNE-GFRS--VEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQI-QMLQRAGATSESRPQPADQHSTH--------------RMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVD------PFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL---CCDDER 333          
BLAST of GCR004 vs. Ensembl Mouse
Match: Adrb2 (adrenergic receptor, beta 2 [Source:MGI Symbol;Acc:MGI:87938])

HSP 1 Score: 153.295 bits (386), Expect = 2.261e-41
Identity = 123/358 (34.36%), Postives = 192/358 (53.63%), Query Frame = 2
Query:  140 TLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ-KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNT 1210
             +L+S I+   +FGN LVI ++ +F +L+  +TN F++SLA ADL++   V+ F AS +    +W FG F C+ + + DVL  TASI  L  I++DRY++I  PF+Y  ++T  K+ ++++  WI + + S++PI    Y +         +  T C+F  N  + I SSI+SF++P +VM  VY  +++ A++Q  +I + + R F   + S V+ D  S         L +  +  L KEHKA KTLGIIMG F +CWLPFF+   +    +R   +   +   L W+GY NS  NP IY     DFR A           FQ  +C  +S+  +  N Y   +        +PNT
Sbjct:   37 AILMSVIVLAIVFGNVLVITAIAKFERLQ-TVTNYFIISLACADLVMGLAVVPFGASHILMK-MWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGR-FHAQNLSQVEQDGRS------GHGLRRSSKFCL-KEHKALKTLGIIMGTFTLCWLPFFIVNIVH--VIRDNLIPKEVYILLNWLGYVNSAFNPLIYC-RSPDFRIA-----------FQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEPNT 370          
BLAST of GCR004 vs. UniProt/SwissProt
Match: sp|Q9VCZ3|OCTB1_DROME (Octopamine receptor beta-1R OS=Drosophila melanogaster OX=7227 GN=Octbeta1R PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.399e-75
Identity = 160/340 (47.06%), Postives = 217/340 (63.82%), Query Frame = 2
Query:   89 SSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTF---SHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC--PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKS 1093
            S++    SS +    +K  ++  II  AI GN LVIVSV+R  KLR IITN FVVSLA+AD+LV+ C MTF+AS++ S G W+FG  +CD++N+ DV FSTASI HL  IS+DRY +I  P  Y  IMT R+  +ML+  W+   ++S++PI +G Y++ EN+++ KSNP  CEF+VN  + I SS +SFWIP IVM  +Y  IY++A +QE  +++ +        H   S +     SI +     +  + ER       KAA+TLGIIM  F++CWLPFFLW  + + C  C  P L   LV  LFWIGYFNS LNP IYA++ +DFR AFK  LKS
Sbjct:   94 STDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR-IITNYFVVSLAVADMLVALCAMTFNASVMIS-GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRER-------KAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCITPRL---LVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKS 421          
BLAST of GCR004 vs. UniProt/SwissProt
Match: sp|Q4LBB9|OCTB2_DROME (Octopamine receptor beta-2R OS=Drosophila melanogaster OX=7227 GN=Octbeta2R PE=2 SV=2)

HSP 1 Score: 248.44 bits (633), Expect = 2.377e-75
Identity = 152/322 (47.20%), Postives = 208/322 (64.60%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEE------------RIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIF 1108
            GN LVI+SV+R  KLR +ITN FVVSLA+AD++V+   MTF+ S V   G W F PFLCDL+N+ DV FSTASI HL  IS+DRY +I  P +Y   MT R   +ML+  WI   ++S++PIF G Y++ ++ Q+   NPT+C F VN ++ + SS ISFWIPC +M   Y  I+++A +QE Q+  M+       HR S++    +++ +   KTL   E             I +++EHKAA+TLGIIMG FI+CWLPFFLW T+   C  C ++  I+V  LFWIGYFNSTLNP IYA++ +DFR AF+    +  C+F
Sbjct:  170 GNLLVIISVMRVRKLR-VITNYFVVSLAMADIMVAIMAMTFNFS-VQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLM-MRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEEC-QVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFR---NTLLCLF 484          
BLAST of GCR004 vs. UniProt/SwissProt
Match: sp|G3M4F8|OCTB2_CHISP (Octopamine receptor beta-2R OS=Chilo suppressalis OX=168631 GN=OA2B2 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.445e-69
Identity = 144/348 (41.38%), Postives = 218/348 (62.64%), Query Frame = 2
Query:   77 NASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIF-QMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIM-LQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNAC--LRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIF 1108
            N + ++   G  +  +   ++T +L  I+ +A+ GN LVIVSV+R  KLR +ITN FVVSLA AD+LV+  VM F+ S+  + G W+FG  +CDL+N++DV F++ SI HL  IS+DRY +I  P +Y   MT + + +ML   W+  + +SY+PIF G Y++ +  + ++ +  +CEF+VN  + + SS ISFWIPC +M   Y  I+K+A +QE  +  +       H H   V   + ++++N    T  K+  ++ +++EHKAA+TLGIIMG FI+CWLPFFL+    + C    CPE+  ++   +FW GYFNS LNP IYA++ +DFR AFK  L    C F
Sbjct:   20 NGAYNATDAGEWTSSVMFKLRTCVLLLIVIMAVLGNMLVIVSVMRHRKLR-VITNYFVVSLAFADILVAMVVMPFNFSVQFNQG-WVFGETICDLWNSSDVYFTSTSILHLCCISVDRYYAIVKPLKYPIKMTKKMAFVMLAATWLSPITISYVPIFMGWYTTTDFLESRRDD--QCEFKVNKPYAVISSSISFWIPCTIMIFTYLAIFKEANRQEKALHARAGNAMLMHRHSREVSDKNGALHINATTPT--KDRNLLKMKREHKAARTLGIIMGAFILCWLPFFLYYVSTSLCDSCNCPEVVTVI---MFWTGYFNSALNPIIYAYFNRDFRNAFKNTLACAFCSF 358          
BLAST of GCR004 vs. UniProt/SwissProt
Match: sp|P35406|DRD1_CARAU (D(1) dopamine receptor OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.457e-46
Identity = 126/346 (36.42%), Postives = 189/346 (54.62%), Query Frame = 2
Query:  110 SSQIIAKC-IKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNP---------------TKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC----PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQL 1087
            S +++  C +  L+LST+      GN LV  +V +F  LR  +TN FV+SLA++DLLV+  VM + A +    G W FG F CD++ A D++ STASI +L  IS+DRY +I  PF+Y + MT R + +M+ G W  ++++S+IP+           +W K+ P                 C+  +N  + I SS+ISF+IP  +M + Y  IY+ A+KQ  +I  +++         S +  H+S+  +     L    ++  ++E K  KTL +IMGVF+ CWLPFF+   +   C R     P + P   D   W G+ NS+LNP IYAF   DFRRAF I L
Sbjct:   22 SVRVLTGCFLSVLILSTL-----LGNTLVCAAVTKFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKA-VTEVAGFWPFGAF-CDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPRVAFVMISGAWTLSVLISFIPV---------QLKWHKAQPIGFLEVNASRRDLPTDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTQIYRIAQKQIRRISALERAA------ESAQIRHDSMG-SGSNMDLESSFKLSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKRTSNGLPCISPTTFDVFVWFGWANSSLNPIIYAF-NADFRRAFAILL 343          
BLAST of GCR004 vs. UniProt/SwissProt
Match: sp|P47800|DRD1L_OREMO (D(1)-like dopamine receptor OS=Oreochromis mossambicus OX=8127 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.308e-46
Identity = 133/375 (35.47%), Postives = 197/375 (52.53%), Query Frame = 2
Query:   68 EPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSA-SMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLF----WIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTT 1177
            EP            +S +  + +   +L  +I   + GN LV  +V++F  LR  +TN FV+SLA++DL V+  VM + A S VA  G+WLFG F CD + A D++ STASI HL  ISMDRY +I  PF+Y + MT R   +M+   W  ++++S+IP+    ++       ++++P  C   +N  + I SS+ISF+IP ++M   Y  I++  R Q  +I  ++ R      R    CD  S       KT ++       +E K  KTL +IMGVF+ CWLPFF+   +   C   P   P + DT F    W G+ NS+LNP IYAF   DFR+AF   L   C  + R       + ++   SY + TT
Sbjct:   15 EPAPGGHGGTDSPRTSDLSLRALTGCVLCILIVSTLLGNALVCAAVIKFRHLRSKVTNAFVISLAVSDLFVAVLVMPWRAVSEVA--GVWLFGAF-CDTWVAFDIMCSTASILHLCIISMDRYWAISSPFRYERRMTPRFGCVMIGVAWTLSVLISFIPVQLNWHARGR----ERTDPGDCNASLNRTYAISSSLISFYIPVLIMVGTYTRIFRIGRTQIRRISSLE-RAAPRATRGPALCDEES-----SLKTSFR-------RETKVLKTLSVIMGVFVFCWLPFFVLNCMVPFCRLEPAAAPCVSDTTFSVFVWFGWANSSLNPVIYAF-NADFRKAFSTILG--CSRYCRTSAVEAVDFSNELASYHHDTT 366          
BLAST of GCR004 vs. TrEMBL
Match: A0A193KUF1 (GCR004 OS=Schmidtea mediterranea OX=79327 GN=gcr004 PE=2 SV=1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 387/387 (100.00%), Postives = 387/387 (100.00%), Query Frame = 2
Query:   53 MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN 1213
            MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTIIAIAIFGNGLVIVSVLRFHKLRRIITNRFVVSLALADLLVSCCVMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPFFGIGSSIISFWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN
Sbjct:    1 MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTIIAIAIFGNGLVIVSVLRFHKLRRIITNRFVVSLALADLLVSCCVMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPFFGIGSSIISFWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN 387          
BLAST of GCR004 vs. TrEMBL
Match: A0A2T7P997 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09249 PE=3 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 4.362e-81
Identity = 159/323 (49.23%), Postives = 216/323 (66.87%), Query Frame = 2
Query:  134 IKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQE----NQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLK 1090
            +K L+++ I+  A+FGN LVI SV +F +LR +ITN FVVSLA ADLLV+  VM F+ASM  S G W+FG  +CD FNANDVLFSTASI HL  ISMDRYI+I  P +Y   MT  +  +ML   W+ ++++SYIP+++ LY++ ++FQ  +++P  C F VN  +   SS +SFWIPC +M  VY  I+ +ARKQE    +    MQ    +H  RS++    N + L D +  + + ER  +++EHKAAKTLGIIMG FI+C+LPFFLW  I   C       P++   LFWIGYFNS+LNP IYA++ +DFR AFK  L+
Sbjct:   42 VKGLVMTLIMVGAVFGNLLVIASVKKFERLRAVITNYFVVSLAFADLLVAILVMPFNASMELS-GKWVFGRTMCDFFNANDVLFSTASILHLCCISMDRYIAILHPLKYEIKMTRTRVAVMLTVTWVASILISYIPVYSQLYTTRQHFQQLETHPHSCVFIVNKVYAGVSSSVSFWIPCAIMVFVYAKIFVEARKQEKFVQSNAMYMQYSHAAH-ERSALASQTNGM-LADGE--VQRSERKRMRREHKAAKTLGIIMGAFILCFLPFFLWYVITTMCGDACPYPPVVGSMLFWIGYFNSSLNPIIYAYFNRDFRTAFKKLLR 359          
BLAST of GCR004 vs. TrEMBL
Match: A0A433U5X8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_003010 PE=3 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.142e-80
Identity = 160/327 (48.93%), Postives = 217/327 (66.36%), Query Frame = 2
Query:  110 SSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLK 1090
            S + IA  ++ + ++ I+  AIFGN LVI SVLRF +LR I TN F+VSLA ADLLV+  VM F+ASM  S G W+FG  +CD+FNANDVLFSTASI HL  ISMDRYI+I  P QY   MT  ++++ML   W+ ++++SYIP+++ LY++ EN Q   S+P  C F VN  +   SS +SFWIPC +M  VY  I+ +ARKQE    +M + +  + H S      N   ++     +++ ER  +++EHKAAKTLGIIMG FI+C+LPFF W      C +CP   P+L   LFW+GYFNS LNP IYA++ ++FR AFK  L+
Sbjct:   30 SLEAIALILRAMAMAAIMVGAIFGNVLVISSVLRFERLRGI-TNFFIVSLAFADLLVAILVMPFNASMEIS-GKWVFGRTMCDIFNANDVLFSTASILHLCCISMDRYIAIMHPLQYETKMTQSRALMMLGVTWVSSVLISYIPVYSQLYTTEENRQMLISDPDSCPFIVNRVYAGVSSSVSFWIPCTIMLFVYARIFLEARKQE----KMIQSSALYMHYSDHSRGSNGAAMDGD---VHRSERRRMKREHKAAKTLGIIMGAFILCFLPFFSWYVATTMCRKCP-YPPMLGSALFWVGYFNSCLNPIIYAYFNREFRTAFKKLLR 346          
BLAST of GCR004 vs. TrEMBL
Match: W0U9P0 (Octopamine beta-type receptor 2 OS=Apis mellifera OX=7460 GN=Octbeta2 PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.590e-80
Identity = 172/366 (46.99%), Postives = 229/366 (62.57%), Query Frame = 2
Query:   77 NASISSN-KLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLND--KKKTL-------------YKEERIM-LQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLR---CPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            NAS SS  KL +   I+  C+    L +II  A+FGN LV+VSV+R  KLR IITN FVVSLALAD+LV+   MTF+AS V   G WLFG F+CD++N+ DV FST+SI HL  IS+DRY +I  P +Y  IMT R +  ML+ CWI    +S++PIF G Y++AEN   ++++P  CEF+VN  + I SS +SFWIPC +MT+ Y  ++K+  +QE Q+           HR S   ++ +  LN     KTL              K++ IM +++EHKAA+TLGIIMG FI+CWLPFFLW  I   C     CP+   +++  LFWIGY NS LNP IYA++ +DFR AFK  L+   C   R
Sbjct:   36 NASYSSEEKLSVPVTIVKGCV----LGSIIVTAVFGNLLVMVSVMRHRKLR-IITNYFVVSLALADMLVAMFAMTFNAS-VQLTGKWLFGYFMCDVWNSLDVYFSTSSILHLMCISVDRYWAIVKPLKYPIIMTRRLAAYMLLACWILPAFISFVPIFMGWYTTAENSMRRQNHPEICEFKVNKIYVIFSSSVSFWIPCTIMTLTYVAVFKEPNRQEKQMHSRMGSVMLLSHRPSKDLNNLNGELNSAGSSKTLTLNEISTNHLHTPTKDKNIMKMKREHKAARTLGIIMGTFILCWLPFFLWYVITTLCGESCPCPD---VVIALLFWIGYTNSALNPLIYAYFNRDFREAFKNTLQCAFCSLCR 392          
BLAST of GCR004 vs. TrEMBL
Match: A0A193KU78 (GCR034 OS=Schmidtea mediterranea OX=79327 GN=gcr034 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.889e-79
Identity = 152/314 (48.41%), Postives = 206/314 (65.61%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIM---LQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKS---CC 1099
            FGNGLVI+SV ++ +LRR ITN FV SLA AD LV+  VM F+     ++G WLFGP LC++FN+NDV FSTAS+ H+  I +DRYI+I  PF+Y  I+T+ +  ++L   WI +L++S+IPI +G+Y++ EN    K     C F+VN  + I SS ISFWIP  +M +VY  I+K+A+ QE +I  +    +   +R+S+  D N  + N  KK+L     +     ++EHKAAKTLGIIMG FI CWLPFF+W T+ N C        I+ D +FWIGY NSTLNP IYAFY ++FR+AFK  LK    CC
Sbjct:   40 FGNGLVIISVWKYPRLRRQITNHFVFSLAFADFLVAILVMPFNLIQTVNNGRWLFGPVLCNIFNSNDVFFSTASLIHIGCIGLDRYIAIIKPFKYEIILTNSRVAIILTVSWITSLLISHIPIHSGIYTTEENLVLLKFCRLVCHFKVNMIYAIVSSTISFWIPSSIMCVVYLKIFKEAKNQEKKI--ILATPYPKENRNSLTVDMNIQSQNFIKKSLSVSSNMSKRNFKREHKAAKTLGIIMGCFIACWLPFFIWYTVSNVCQSSCSFPEIIGDIVFWIGYVNSTLNPIIYAFYNREFRKAFKQVLKYNKWCC 351          
BLAST of GCR004 vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 161.384 bits (407), Expect = 4.326e-45
Identity = 129/331 (38.97%), Postives = 178/331 (53.78%), Query Frame = 2
Query:  149 LSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ----KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTL----FWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            LS ++ +++ GN LV+V+V +  +LR+I TN F+VSLA ADLLVS  VM F A  +     W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LM+ GCWI   V+S++PI  G  S   N   +      N T C F VN  + +  S+++F+IP  +M + Y  IY  AR+   QI  M +R    G+ +S   DH     N + +T           E KAAKTL IIMG F +CW PFF+   +       P +   + + L     W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:   33 LSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQI-SMLQRAGGAGNATSDSADHQR---NHRMRT-----------ETKAAKTLCIIMGCFCLCWAPFFITNVVD------PFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIIL---CCGHKR 338          
BLAST of GCR004 vs. Ensembl Cavefish
Match: ENSAMXT00000025832.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:7261601:7266785:-1 gene:ENSAMXG00000025106.2 transcript:ENSAMXT00000025832.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 6.622e-45
Identity = 119/319 (37.30%), Postives = 175/319 (54.86%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPT---------------KCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLR-CPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQL 1087
            GN LV  +V +F  LR  +TN FV+SLA++DLLV+  VM + A +    G W FG F CD++ A D++ STASI +L  IS+DRY +I  PF+Y + MT + + +M+   W  ++++S+IP+            W K+ PT                C+  +N  + I SS++SF+IP  +M + Y  IY+ A+KQ  +I  +++         S K  HNS+  N    +     ++  ++E K  KTL +IMGVF+ CWLPFF+   +   C    P + P   D   W G+ NS+LNP IYAF   DFRRAF I L
Sbjct:   29 GNTLVCAAVTKFRHLRSKVTNFFVISLAVSDLLVAILVMPWKA-VTEIAGFWPFGSF-CDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFVMISVAWTLSVLISFIPV---------QLNWHKAQPTSLALSNGSGGVPLMDNCDSSLNRTYAISSSLVSFYIPVAIMIVTYTQIYRIAQKQIRRISALERAA------ESAKIRHNSMGSNSNMDS-ESSFKLSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCEHNLPCISPTTFDIFVWFGWANSSLNPIIYAF-NADFRRAFAILL 328          
BLAST of GCR004 vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 160.999 bits (406), Expect = 1.015e-44
Identity = 129/331 (38.97%), Postives = 178/331 (53.78%), Query Frame = 2
Query:  149 LSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ----KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTL----FWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            LS ++ +++ GN LV+V+V +  +LR+I TN F+VSLA ADLLVS  VM F A  +     W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LM+ GCWI   V+S++PI  G  S   N   +      N T C F VN  + +  S+++F+IP  +M + Y  IY  AR+   QI  M +R    G+ +S   DH     N + +T           E KAAKTL IIMG F +CW PFF+   +       P +   + + L     W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:   25 LSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQI-SMLQRAGGAGNATSDSADHQR---NHRMRT-----------ETKAAKTLCIIMGCFCLCWAPFFITNVVD------PFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIIL---CCGHKR 330          
BLAST of GCR004 vs. Ensembl Cavefish
Match: adrb2a (adrenoceptor beta 2 [Source:NCBI gene;Acc:103041180])

HSP 1 Score: 160.999 bits (406), Expect = 2.081e-44
Identity = 117/312 (37.50%), Postives = 183/312 (58.65%), Query Frame = 2
Query:  146 LLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLY-SSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFK 1078
            +LS ++   + GN LVI ++ RF +L+ + TN F++SLA ADL++   V+ F A  +  +  W FG F C+ + A DVL  TASI  L  I++DRY++I  PF+Y  ++T  K+ ++++  WI   ++SY+PI    Y S+++  Q    + + CEF+ N  + I SSIISF+IP ++M  VY  ++++ARKQ  +I + + R     H + +   H   N +   +   K +  +  +EHKA KTLGIIMG+F +CWLPFF+   +++      ++   L   L WIGY NS  NP IY     +FR AFK
Sbjct:   34 VLSVLVLAIVLGNVLVITAIARFQRLQNV-TNCFIMSLACADLVMGLIVVPFGAIHIILNN-WYFGRFWCEFWTATDVLCVTASIETLCIIALDRYLAITSPFRYQSLLTKCKARIVVLLVWIIGALISYLPIHLRWYLSNSDEAQTCMKDASCCEFQPNRLYTIISSIISFYIPLVIMVFVYSRVFQEARKQLKKIDRSEGRF----HHNGIGKGHQDANSSSDVRIAKKPKFCL--REHKALKTLGIIMGIFTLCWLPFFVLNVVESFY----QVDKYLYRILNWIGYANSAFNPLIYC-RSPEFRYAFK 332          
BLAST of GCR004 vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 160.229 bits (404), Expect = 4.058e-44
Identity = 129/331 (38.97%), Postives = 178/331 (53.78%), Query Frame = 2
Query:  149 LSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ----KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTL----FWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            LS ++ +++ GN LV+V+V +  +LR+I TN F+VSLA ADLLVS  VM F A  +     W++G   C +  + DVL +TASI HL  IS+DRY +I   P  Y   MT  +  LM+ GCWI   V+S++PI  G  S   N   +      N T C F VN  + +  S+++F+IP  +M + Y  IY  AR+   QI  M +R    G+ +S   DH     N + +T           E KAAKTL IIMG F +CW PFF+   +       P +   + + L     W+GY NS LNP +YAF  + FRRAF I L   CC  +R
Sbjct:   66 LSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQI-SMLQRAGGAGNATSDSADHQR---NHRMRT-----------ETKAAKTLCIIMGCFCLCWAPFFITNVVD------PFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIIL---CCGHKR 371          
BLAST of GCR004 vs. Ensembl Sea Lamprey
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 148.673 bits (374), Expect = 4.647e-41
Identity = 119/319 (37.30%), Postives = 167/319 (52.35%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSA-SMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTG--LYSSAENF-----QWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKN-ACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCC 1102
             GN LV+V+V +   LR+I TN F+VSLA+ADLLV+  VM F A   V +D  W +G   C +  + DV+F+TASI HL  I++DR+ +I   P  Y   MT  +  LML  CW+   ++S+IPI  G  +    +       Q +++N T C F VN  + +  S+++F+IP  +M   Y  IY  AR    QI  +Q+                S +    + T+ + +    + E KAAKTL IIMG F +CW PFF+   I        P+    L D   W+GY NS LNP +YAF  + FRRAF   L   CC
Sbjct:   35 LGNLLVVVAVCKDRHLRKIKTNYFIVSLAVADLLVAILVMPFGAVERVQND--WPYGDKFCIIRTSFDVMFTTASIMHLCCIALDRFYAICCKPLVYQNKMTPLRVGLMLGACWVVPSLISFIPIANGWNIIGIEQQLELRLGQAKEANQTHCIFMVNKVYAVACSLVAFYIPLGLMAAAYQRIYVTARAHARQIGSLQRAV--------------SKDTTGDEATMVQTQSTRFRHETKAAKTLAIIMGCFCLCWAPFFINNVIDPFVNYDTPQQ---LWDAWLWLGYANSALNPLLYAFLNRSFRRAF---LAILCC 331          
BLAST of GCR004 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000271.1 (pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 gene:ENSPMAG00000000243.1 transcript:ENSPMAT00000000271.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 4.862e-35
Identity = 106/333 (31.83%), Postives = 181/333 (54.35%), Query Frame = 2
Query:   95 NKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFS-HGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLF----WIGYFNSTLNPAIYAFYQQDFRRAFK 1078
            +++ +S   ++ C    LLS I  + +FGN  V++  L   +LR + T  F++SLA ADLLV+C VM FS  +    G+W+FG   C ++ + DV+F TASI  L  IS+DRY S+  P  Y   M+ ++ I M +  W+Y+L++S++P+  G ++     ++      +C F  N  F + +S ++F++P + M  +Y  +Y+ +R +  ++     +T   H H +S + ++                    Q E+KA +T+ II+  F++CWLP+F++    NA       H  +V T+F    W+GY NS +NP +YAF  +DF+ A K
Sbjct:   15 DEVALSPGALSVCA---LLSLIDIVTLFGNAAVLLCPLVERRLRTV-TYMFIMSLATADLLVACLVMPFSI-IYEVTGVWIFGELFCKVWISFDVMFCTASIVTLCFISLDRYCSVTTPNHYPTRMSGKRCIAMTVSIWVYSLLISFLPVTQG-WNEIPGVRFDARR--ECLFITNWAFVLVASTLAFYLPFLAMCTMYFFVYRASRLKAARV---ASQTLDIHYHPNSQRPNNP-------------------QLENKATRTMSIIISAFVMCWLPYFVFNVAMNA---YGSKHDRVVVTMFKIMTWLGYCNSAINPVLYAFLNRDFQHALK 314          
BLAST of GCR004 vs. Ensembl Sea Lamprey
Match: adrb2a (adrenoceptor beta 2, surface a [Source:ZFIN;Acc:ZDB-GENE-100414-3])

HSP 1 Score: 128.257 bits (321), Expect = 5.246e-35
Identity = 76/231 (32.90%), Postives = 126/231 (54.55%), Query Frame = 2
Query:  374 DVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFR 1066
            D++  TASI  L  I++DRYI++  P +Y  +M  R++  +++  W+ + ++S++PI  G + S        +    CEF ++  + + SS +SF++P  VM I+Y  ++++ARKQ  +I   + R +++ + S+             K    K  R + +KEH+A KTLG+IMG F +CWLPFF+ + I      C      +  +L W+GY NS  NP IY     DFR
Sbjct:    1 DIMCVTASIDTLCVIAVDRYIAVARPLRYETLMNKRRARFIIVAVWLVSALISFLPIEMGWWKSEAAAAANNTAEDVCEFNISLEYAVASSSVSFYLPLTVMIILYSKVFREARKQMEKINTSEGRFYNNANDSAT-----------IKNPARKLSRFLSRKEHRALKTLGLIMGTFTLCWLPFFV-VNIVQVVWNCVPTGVFV--SLNWLGYINSAFNPIIYC-RSPDFR 216          
BLAST of GCR004 vs. Ensembl Sea Lamprey
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 131.724 bits (330), Expect = 5.493e-35
Identity = 112/324 (34.57%), Postives = 167/324 (51.54%), Query Frame = 2
Query:  188 LVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNP---TKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYK---------EERIM-LQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHP--ILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQR 1114
            LV++SV+  +K  R +TN F+++LA ADLL+S  V+ FSA+     G W+FG   CD++ A DVL  TASI  L +I                     + +L+LI  W+ A+V+S  P+            W++  P   T CE    P + + S++ SF+IP +++  +Y  +Y  AR+Q   + +  KR      RSS       + L +KK  + +           R M   +E KAAKTLGI++GVFI+CWLPFF+ + I       P + P   +   +FW+GYFNS +NP IY    Q+F+RAF   L+  C   QR
Sbjct:   56 LVVLSVV-CNKHLRTVTNYFIINLASADLLLSTTVLPFSATF-EILGYWVFGRIFCDIWAALDVLCCTASIMSLCAI---------------------RVLLILIAVWVLAIVISVGPLL----------GWKEPAPPDETVCEITEVPGYALFSAMGSFYIPLVILLAMYCRVYVAARRQTKSLEEGIKR-----ERSS---SSEEVTLKEKKAAVLEIYGLFRSSLSVRFMKFSREKKAAKTLGIVVGVFILCWLPFFIALPIAPGSF-FPSVRPSQTVFKVVFWLGYFNSCINPLIYPCSSQEFKRAFLRALRCHCREGQR 337          
BLAST of GCR004 vs. Ensembl Sea Lamprey
Match: TAAR1 (trace amine associated receptor 1 [Source:HGNC Symbol;Acc:HGNC:17734])

HSP 1 Score: 124.79 bits (312), Expect = 1.715e-32
Identity = 104/306 (33.99%), Postives = 153/306 (50.00%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCP----ELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKI 1081
             GN LVI S++ F +L+   TN   +SLA ADLLV   VM FS  M      W +G  LC L  + D +FST SI HL+ ++ DRY++I  P  Y   +T+     MLI CW   LV     + +      E     +     C    N +F    +  +F  P  +M   Y  IY+ AR+Q  Q+             +SV     ++ LN  ++   + +  ++++EH A KTLGIIMG F+  WLP F+      A L  P    +  P++ + + W+GY NST+NP +YA + + FR+AFKI
Sbjct:   45 LGNMLVIASIIYFKQLQSH-TNSLTLSLAAADLLVGLVVMPFSM-MRTVHSCWFYGKLLCKLHCSLDYIFSTVSILHLSCVAFDRYVAICDPLHYTSRVTNNTVAFMLILCWTCPLVYFAPFLLSWNIIGIEEMVQSRICADTCAIVKNVWFAYVDTCCAFITPMAIMITTYVKIYRVARRQARQV-----------SAASV-----ALQLNRDER---QNQWALMKREHNATKTLGIIMGGFLFFWLPNFV------ASLIDPVNDFQTDPLVWNIVVWLGYINSTINPLLYASFNRPFRKAFKI 323          
BLAST of GCR004 vs. Ensembl Nematostella
Match: EDO42772 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0P3])

HSP 1 Score: 134.806 bits (338), Expect = 1.017e-35
Identity = 106/302 (35.10%), Postives = 155/302 (51.32%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIP-IFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCP-ELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFK 1078
            GNGLVI +  +F KLR + TN FVVSLAL D+LV+   M   A+ + +   W++  +L  ++   DVL   ASI HL  IS++RYI I  P +Y+QI+T  K+ + +I  W+ AL+++ I  +F G    A    +Q S    C                F +P I+M   Y +I+K +R Q  ++                     ++ +N K K      R  L KE KAAKTL ++MG F  CW PFF+   +   C  CP ++  I++    W+ Y NS LNP IY+F  +DFR AF+
Sbjct:   49 GNGLVISAFAKFRKLRSV-TNHFVVSLALTDILVAVFSMPMWAAFLLTGPEWIYTEWLRRVWQCADVLSGVASILHLTFISVERYICISSPLKYHQIVTPGKTKVAIIAIWMVALIMAAIKFLFWGWPPPA----YQLSAFVFC----------------FTLPTIIMNTAYIMIFKVSRTQAKKM---------------------TMTVNGKPK------RFCLPKEMKAAKTLAVVMGAFFFCWCPFFILNLVYAVCRECPIDIESIMLTK--WLHYLNSVLNPFIYSFMIKDFRMAFR 300          
BLAST of GCR004 vs. Ensembl Nematostella
Match: EDO44740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ8])

HSP 1 Score: 132.88 bits (333), Expect = 3.066e-35
Identity = 92/303 (30.36%), Postives = 163/303 (53.80%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNAC-LRCPELHPILV-DTLFWIGYFNSTLNPAIYAFYQQDFRRAFK 1078
             GN LV+ +   +H+LR  +TN ++VSLA +D+L +  V+ F       DG+W  G   C L+    +L    SI +L ++++DR+I + MP +Y  I+T RK+I+ ++  W YALV + +P+   L    +N+ +   N   C F +   + +  +I +F +P I M + + LI+K A+K + ++ ++++         S+  + N    N +       ++  ++K  K +K + II+G F +CWLP+ L     + C  +C    P  V + L  +GY NS LNP +Y+F+ + F+ AFK
Sbjct:   12 LGNILVVYAFCNYHRLRANVTNYYIVSLAFSDILTAGLVVPFELDQTIRDGIWTHGRITCQLWTTLYLLVVPGSIINLCAVTLDRFIVLHMPLRYTTIITPRKAIVAIVCLWTYALVTACLPV---LGWKDQNYDYILFN--ACYFPLLQEYVMLINITNFLLPMIFMAVFWSLIFKIAKKHQRRVKKLERSMSMVETTMSLSINGNEAQ-NGRPSMSEGGKKKTIRKHLKGSKYIAIIVGTFFICWLPYTLLSLGVSICGTKCFRGTPREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFK 308          
BLAST of GCR004 vs. Ensembl Nematostella
Match: EDO43118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZL7])

HSP 1 Score: 126.716 bits (317), Expect = 3.110e-33
Identity = 100/307 (32.57%), Postives = 151/307 (49.19%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
            GN LVI S + + ++R   TN FVVSLA  DL V+   M    + + +  +W   P L  ++ A D+L  TASI +L +IS+DR++ I  P  Y Q +TS +    +   W+Y++          L + A    WQ        +R+   F   SSI+ FW+P +++   Y ++++ A +Q  QI                       N ++ +KT  +  R     E KAAKTL  ++G F +CW PF L   I + C+ CP + P ++  + W+ Y NS LNP IY    +DFR AFK  L  CC
Sbjct:   35 GNALVIASFIAYSRIRTA-TNFFVVSLACTDLGVALFSMPLWLAYILTGTIWAENPVLFRVWTAMDILVGTASIGNLVAISLDRFLCITKPLMYYQYITSVRVNSTIACIWVYSV----------LMAVASYLLWQ--------YRI---FNFISSIVYFWVPLLIIISAYSIVFRVALRQTRQI-----------------------NTSNSQKT--RASRYSFVTELKAAKTLAAVVGAFALCWAPFVLINGIYSMCIECPYIKPEIILVVKWLHYGNSLLNPPIYGLLNKDFRVAFKHIL--CC 292          
BLAST of GCR004 vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 123.25 bits (308), Expect = 5.235e-32
Identity = 94/308 (30.52%), Postives = 157/308 (50.97%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFF------LW--MTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAF 1075
            +GN +V+++V+ FH++R I TN FVVSLA++DLLV+   + F       +  W  G   C  +   D++   ASI +LA IS+DR+I+I MPF+Y+ +MT    + ++   WI ++ +  + +       + +F  +     +C  + +P +    S++ F++P  ++ ++YG ++  A  Q   +  +Q  +   G RSS+                       L KE KAAK L I++G F+VCW PFF      LW    +    +       I +  ++ +   NSTLNP IYA + +DFRRAF
Sbjct:   14 YGNFMVVLAVVLFHRMRTI-TNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTELGSPHFHIE----VQCR-KFDPVYYTVVSVVGFFLPLFIVLLMYGQVFVVAMNQARAVAALQTDSKRRGRRSSIN----------------------LVKEVKAAKILAIVVGCFVVCWFPFFVLTLVSLWEPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAF 293          
BLAST of GCR004 vs. Ensembl Nematostella
Match: EDO31709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX62])

HSP 1 Score: 122.865 bits (307), Expect = 1.624e-31
Identity = 107/337 (31.75%), Postives = 170/337 (50.45%), Query Frame = 2
Query:   77 NASISSNKLGISSQI-IAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACL--RCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFK 1078
            N++++S+ L  S+   I   + T++L   I   I GN LVI S + + ++R   TN FVVSLA  DL V+   M    + + +  +W+  P L  ++ A D+L  TASI +L +IS+DR + I  P  Y Q +TS +    +   W+Y++          L + A    WQ        +R+   F   SSI+ FW+P +++   Y ++++ A +Q  +I                   + + N +  +KT  +  R    KE KAAKTL +++G F VCW PF +   I + C    CP L P ++  + W+ Y NS +NP IY+F  +DFR AFK
Sbjct:    3 NSTLASSHLEYSNSFRIGTSVFTVIL---ILGTIMGNTLVIASFIAYSRIRTA-TNFFVVSLACTDLGVALFSMPVWLAYILTGPIWVLNPVLFRVWTAMDILVGTASIGNLVAISLDRCLCITKPLMYYQYITSVRVNSTIACIWVYSV----------LMAVAGYLLWQ--------YRI---FNFISSIVYFWVPLLIIISAYSIVFRVALRQTRRI-------------------NTTNNSSQIRKT--RASRYSFMKEMKAAKTLAVVVGAFFVCWAPFVVLNAIYSICTGADCPVLKPQIILVVKWMHYGNSLINPPIYSFLNKDFRVAFK 293          
BLAST of GCR004 vs. Ensembl Medaka
Match: adrb1 (adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-081022-145])

HSP 1 Score: 162.155 bits (409), Expect = 6.177e-45
Identity = 123/327 (37.61%), Postives = 189/327 (57.80%), Query Frame = 2
Query:  140 TLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQ-KSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSI-NLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDT-----LFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
            +L+++ I+   +FGN LVI+++ R  +L+  +TN F+VSLA ADL++   V+ F A ++   GLWL+G F C+++ + DVL  TASI  L  I++DRY++I  PF+Y  ++T  ++  ++   W  + +VS++PI   ++ S ++       NP  C+F  N  + I SS+ISF+IP +VM  VY  +Y++A+KQ  +I + + R             HN++  L  K K   +  +I+  +E KA KTLGIIMG F +CWLPFF+   ++  C         LVD      L W+GY NS  NP IY     DFR+AFK  L  CC
Sbjct:   46 SLVMALIVLSIVFGNILVILAIARTQRLQ-TLTNVFIVSLASADLIMGLLVVPFGA-VLEVRGLWLYGSFFCEIWTSVDVLCVTASIETLCVIAIDRYVAITSPFRYQSLLTKSRAKAVVCVVWAISALVSFLPIL--MHWSRDSMDTDCYENPQCCDFVTNRAYAISSSVISFYIPLVVMIFVYARVYREAKKQLKKIDKCEGRF------------HNTLTGLTSKCKK--RPSKILALREQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAE-------LVDKNVFVFLNWLGYVNSAFNPIIYC-RSPDFRKAFKRLL--CC 344          
BLAST of GCR004 vs. Ensembl Medaka
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:ZFIN;Acc:ZDB-GENE-160114-31])

HSP 1 Score: 156.762 bits (395), Expect = 2.240e-43
Identity = 125/326 (38.34%), Postives = 173/326 (53.07%), Query Frame = 2
Query:  149 LSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIK-MPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSA------ENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSS-VKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNAC-LRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCC 1099
            LS ++ +++ GN LV+V+V +  +LR+I TN F+VSLA ADLLVS  VM F A  +     W++G   C +  + DVL +TASI HL  I++DRY +I   P  Y   MT  +  LM+ GCW+    +S++PI  G  S        E      SN T C F VN  + +  S+++F+IP ++M + Y  IY  AR    QI  +Q+   +    +S V  D      N + +T           E KAAKTL IIMG F +CW PFF+   +      R P+    L     W+GY NS LNP +YAF  + FRRAF I L  CC
Sbjct:   18 LSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVHQH-WIYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRNKMTPMRVALMMGGCWVIPTFISFLPIMQGWNSIGIDHVIEERRHSGGSNTTSCVFMVNKPYALTCSLVAFYIPLVLMVLAYQRIYVTARAHALQISMLQRAGGAGAPGTSGVSADSADHQRNHRMRT-----------ETKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIDYRVPDQ---LWTACLWLGYINSMLNPILYAFLNKSFRRAFLIIL--CC 326          
BLAST of GCR004 vs. Ensembl Medaka
Match: adra1d (adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157273])

HSP 1 Score: 157.918 bits (398), Expect = 1.113e-42
Identity = 136/367 (37.06%), Postives = 201/367 (54.77%), Query Frame = 2
Query:   71 PFNASISS-NKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTK---CEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHG-------HRSSVKCDHNSINLNDKKKTLYKEE---RIM-LQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHP--ILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAV 1120
            P N SI++     +  Q++   I    LS  I +AI GN LVI+SV+  +K  + +TN F+V+LA+ADLLVS  V+ FSAS+    G W+FG   C+++ A DVL  TASI  L  IS+DRYI +K   +Y  IMT RK++ +L+  W+ +LV+S  P+            W++  P     C     P + + SS+ SF++P +V+ I+Y  +Y  AR+    +    KR            H  SV  D    +    K   ++     R+M   +E KAAKTL +++G+FIVCWLPFFL++ I +     P L P   +   +FW+GYFNS +NP IY    ++F+RAF I+L  C C  +R V
Sbjct:   25 PPNISITTCRNFTMDPQVVGVGI---FLSVFILVAIVGNILVILSVV-CNKQLQTVTNFFIVNLAIADLLVSIIVLPFSASLEVL-GCWMFGRVFCNVWAAVDVLCCTASILSLCMISIDRYIGVKHCLKYPSIMTERKAVAILMLVWVSSLVISVGPLLG----------WKEPPPVDESICRITEEPGYALFSSLFSFYLPLLVILIMYFRVYVVARRTTKSLEAGVKRERDKSVEVVLRIHCRSVLGDARPASSKSSKNHPFRSSLSVRLMKFSREKKAAKTLAVVVGMFIVCWLPFFLFLPIGSV---FPALKPSETVFKVVFWLGYFNSCINPMIYPCSSKEFQRAF-IRLLKCQCHQKRRV 372          
BLAST of GCR004 vs. Ensembl Medaka
Match: ENSORLT00000009159.2 (D(1) dopamine receptor [Source:NCBI gene;Acc:101169046])

HSP 1 Score: 154.451 bits (389), Expect = 2.323e-42
Identity = 115/319 (36.05%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  191 VIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPI--------------FTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRC------PELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQL 1087
            V  +V +F  LR  +TN FV+SLA++DLLV+  VM + A +    G W FG F CD + A D++ STASI +L  IS+DRY +I  PF+Y + MT R + +M+   W  ++++S+IP+              FT  + S  +      NP  C+  +N  + I +S+ISF+IP  +M   Y  IY+ A +Q  +I  +++   S  +R      HNS+             ++  ++E K  KTL +IMGVF+ CWLPFF+   +   C +       P + P   D   W G+ NS+LNP IYAF   DFR+AF I L
Sbjct:   43 VCAAVTKFRHLRSKVTNFFVISLAVSDLLVAILVMPWKA-VTEIAGFWPFGSF-CDTWVAFDIMCSTASILNLCVISLDRYWAISSPFRYERKMTPRVAYVMISVAWTLSVLISFIPVQLNWHKAQTKSFKPFTESFVSLGSNGTSHRNPENCDSSLNRTYAISTSLISFYIPVAIMVATYTQIYRIAHRQIRRISALERAAESAKNR------HNSMGRGSSITESESSFKMTFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCEQSSGGEAFPCISPTTFDVFVWFGWANSSLNPIIYAF-NADFRKAFSILL 352          
BLAST of GCR004 vs. Ensembl Medaka
Match: drd1b (dopamine receptor D1b [Source:ZFIN;Acc:ZDB-GENE-070524-2])

HSP 1 Score: 154.066 bits (388), Expect = 1.890e-41
Identity = 120/341 (35.19%), Postives = 184/341 (53.96%), Query Frame = 2
Query:  110 SSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPI-------FTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLW--------MTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQL 1087
            S +++  C  +LL+ T +     GN LV  +V +F  LR  +TN FV+SLA++DLLV+  VM + A+     G W FG F C+++ A D++ STASI +L  IS+DRY +I  PF+Y + MT + + LM+   W  ++++S+IP+        T  Y+           P  C+  +N  + I SS+ISF+IP  +M + Y  IY+ A+KQ  +I  +++   S  +R      H+S+  N          ++  ++E K  KTL +IMGVF+ CWLPFF+           + +     P +     D   W G+ NS+LNP IYAF   DFR+AF I L
Sbjct:   24 SKRVLTGCFLSLLIFTTL----LGNTLVCAAVTKFRHLRTKVTNYFVISLAISDLLVAILVMPWKAATEIM-GFWPFGAF-CNVWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVACLMISAAWTLSVLISFIPVQLNWHKAQTTTYAELNGTYLLDLPPDNCDSSLNRTYAISSSLISFYIPVAIMLVTYTRIYRIAQKQIRRISALERAAESAKNR------HSSMG-NSSSMESESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCETNMPDGSTDFPCISSTTFDVFVWFGWANSSLNPIIYAF-NADFRKAFSILL 350          
BLAST of GCR004 vs. Planmine SMEST
Match: SMESG000022932.1 (SMESG000022932.1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 387/387 (100.00%), Postives = 387/387 (100.00%), Query Frame = 2
Query:   53 MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN 1213
            MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTIIAIAIFGNGLVIVSVLRFHKLRRIITNRFVVSLALADLLVSCCVMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPFFGIGSSIISFWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN
Sbjct:    1 MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTIIAIAIFGNGLVIVSVLRFHKLRRIITNRFVVSLALADLLVSCCVMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPFFGIGSSIISFWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN 387          
BLAST of GCR004 vs. Planmine SMEST
Match: SMESG000055001.1 (SMESG000055001.1)

HSP 1 Score: 258.455 bits (659), Expect = 6.668e-82
Identity = 154/342 (45.03%), Postives = 220/342 (64.33%), Query Frame = 2
Query:  122 IAKCIKTLLLSTXXXXXXFGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHR---SSVKCDHNSINLNDKKKTLYKEERIMLQ-------------KEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLR--CPELHP-ILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLK 1090
            I + IK +  S +I  A+FGN LVI+SV+ + K+R +  N FV+SLA+AD+LV+  VM F+ + + ++G W FG  +C+++N+NDV  STASI HL  ISMDR+ +I  P  Y+ IMT  +  LML+GCW  ++++SYIPI++GLY++ EN    +     C F+VN  + I SS +SFWIPC+VM +VY  IYK+A K E  I++M+K      +R   ++   +++  N +       + +R ++Q             +EHKAAKTLGIIMG FI+CW PFFLW +I N C    CP  +P +L+D LFWIGY NS LNP IYAFY ++FR AF+  LK
Sbjct:   22 ITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTSSILISYIPIYSGLYTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCP--YPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILK 361          
BLAST of GCR004 vs. Planmine SMEST
Match: SMESG000011585.1 (SMESG000011585.1)

HSP 1 Score: 258.455 bits (659), Expect = 6.689e-82
Identity = 151/314 (48.09%), Postives = 205/314 (65.29%), Query Frame = 2
Query:  176 FGNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIM---LQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKS---CC 1099
            FGNGLVI+SV ++ +LRR ITN FV SLA AD LV+  VM F+     ++G WLFGP LC++FN+NDV FSTAS+ H+  I +DRYI+I  PF+Y  I+T+ +  ++L   WI +L++S+IPI +G+Y++ EN    K     C F+VN  + I SS ISFWIP  +M +VY  I+K+A+ QE +I  +    +   +R+S+  D N  + N  KK+      +     ++EHKAAKTLGIIMG FI CWLPFF+W T+ N C        I+ D +FWIGY NSTLNP IYAFY ++FR+AFK  LK    CC
Sbjct:   40 FGNGLVIISVWKYPRLRRQITNHFVFSLAFADFLVAILVMPFNLIQTVNNGRWLFGPVLCNIFNSNDVFFSTASLIHIGCIGLDRYIAIIKPFKYEIILTNSRVAIILTVSWITSLLISHIPIHSGIYTTEENLVLLKFCRLVCHFKVNMIYAIVSSTISFWIPSSIMCVVYLKIFKEAKNQEKKI--ILATPYPKENRNSLTLDMNIQSQNFIKKSQSVSSNMSKRNFKREHKAAKTLGIIMGCFIACWLPFFIWYTVSNVCQSSCSFPEIIGDIVFWIGYVNSTLNPIIYAFYNREFRKAFKQVLKYNKWCC 351          
BLAST of GCR004 vs. Planmine SMEST
Match: SMESG000063119.1 (SMESG000063119.1)

HSP 1 Score: 156.762 bits (395), Expect = 4.744e-43
Identity = 124/343 (36.15%), Postives = 192/343 (55.98%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGC-WIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNS-----LTNSY-EYYTTNSA 1186
            GN LV  ++     LR++ +N   VSLA+ADLLVS  VMTF A++    G W+FG   C+LF + D++ STASI ++ + ++DR++ +  PF Y++I  ++  +   IGC WI + ++S++PI  G + S         N TKC  ++NP + I SS+ISF++PCI+M  +Y  +Y+ AR               H  +++ K + NS       + +YK+    ++ + KAA TLG+IMG F++CWLPFF+   +K+ C  C  +  +  +   W+GYFNS LNP IY  +  DFR A+K        +  RA+C  K +R       LTNS+   Y  N A
Sbjct:   35 GNVLVCAAICTDSNLRQL-SNSLYVSLAVADLLVSSLVMTF-ATLDWIMGKWVFGLVFCNLFLSMDIMCSTASILNILATAIDRFVHVHTPFHYSRIF-NKYFVGGFIGCIWIISAIMSFMPIHLGWHLSNLTVDL---NSTKCMLQLNPSYAIISSVISFYLPCIIMVALYVKLYRFARM--------------HTVKTN-KTNDNSTTTAGCHRLIYKK----IKTDQKAAVTLGVIMGTFLICWLPFFIINCVKSICQEC--ISDLYFNIATWLGYFNSCLNPIIYPLFNTDFRNAYKK-------LIMRALCSTKLSRKKLKFSMLTNSFISSYNLNGA 343          
BLAST of GCR004 vs. Planmine SMEST
Match: SMESG000063119.1 (SMESG000063119.1)

HSP 1 Score: 156.762 bits (395), Expect = 5.940e-43
Identity = 124/343 (36.15%), Postives = 192/343 (55.98%), Query Frame = 2
Query:  179 GNGLVIVSVLRFHKLRRIITNRFXXXXXXXXXXXXXXXMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGC-WIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPXXXXXXXXXXXWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSINLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCCIFQRAVCCLKSNRNS-----LTNSY-EYYTTNSA 1186
            GN LV  ++     LR++ +N   VSLA+ADLLVS  VMTF A++    G W+FG   C+LF + D++ STASI ++ + ++DR++ +  PF Y++I  ++  +   IGC WI + ++S++PI  G + S         N TKC  ++NP + I SS+ISF++PCI+M  +Y  +Y+ AR               H  +++ K + NS       + +YK+    ++ + KAA TLG+IMG F++CWLPFF+   +K+ C  C  +  +  +   W+GYFNS LNP IY  +  DFR A+K        +  RA+C  K +R       LTNS+   Y  N A
Sbjct:   37 GNVLVCAAICTDSNLRQL-SNSLYVSLAVADLLVSSLVMTF-ATLDWIMGKWVFGLVFCNLFLSMDIMCSTASILNILATAIDRFVHVHTPFHYSRIF-NKYFVGGFIGCIWIISAIMSFMPIHLGWHLSNLTVDL---NSTKCMLQLNPSYAIISSVISFYLPCIIMVALYVKLYRFARM--------------HTVKTN-KTNDNSTTTAGCHRLIYKK----IKTDQKAAVTLGVIMGTFLICWLPFFIINCVKSICQEC--ISDLYFNIATWLGYFNSCLNPIIYPLFNTDFRNAYKK-------LIMRALCSTKLSRKKLKFSMLTNSFISSYNLNGA 345          
The following BLAST results are available for this feature:
BLAST of GCR004 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR41.323e-4438.895-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR41.699e-4438.895-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR42.321e-4438.895-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR42.321e-4438.895-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR42.396e-4438.895-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
back to top
BLAST of GCR004 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-23.043e-3231.12Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-23.245e-3230.64Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-24.153e-3230.64Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-24.266e-3230.64Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
dop-13.454e-2935.67DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q8... [more]
back to top
BLAST of GCR004 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Octbeta1R4.453e-7846.78gene:FBgn0038980 transcript:FBtr0301484[more]
Octbeta1R1.747e-7746.76gene:FBgn0038980 transcript:FBtr0100322[more]
Octbeta1R1.396e-7647.06gene:FBgn0038980 transcript:FBtr0331930[more]
Octbeta1R1.396e-7647.06gene:FBgn0038980 transcript:FBtr0084260[more]
Octbeta2R2.371e-7647.20gene:FBgn0038063 transcript:FBtr0304845[more]
back to top
BLAST of GCR004 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adrb2a5.166e-4837.89adrenoceptor beta 2, surface a [Source:ZFIN;Acc:ZD... [more]
drd1a4.989e-4537.27dopamine receptor D1a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
drd1a4.989e-4537.27dopamine receptor D1a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
adra1bb5.171e-4535.64adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adrb2b8.578e-4536.91adrenoceptor beta 2, surface b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of GCR004 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs9bp1.252e-4538.92regulator of G-protein signaling 9 binding protein... [more]
rgs9bp2.285e-4538.92regulator of G-protein signaling 9 binding protein... [more]
prrc2c9.026e-4433.77proline-rich coiled-coil 2C [Source:Xenbase;Acc:XB... [more]
crtam8.472e-4338.06cytotoxic and regulatory T cell molecule [Source:X... [more]
efr3b1.581e-4235.85EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
back to top
BLAST of GCR004 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr41.409e-4436.645 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Htr42.253e-4438.335 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Htr42.961e-4438.335 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Htr43.650e-4438.335 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Adrb22.261e-4134.36adrenergic receptor, beta 2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of GCR004 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VCZ3|OCTB1_DROME1.399e-7547.06Octopamine receptor beta-1R OS=Drosophila melanoga... [more]
sp|Q4LBB9|OCTB2_DROME2.377e-7547.20Octopamine receptor beta-2R OS=Drosophila melanoga... [more]
sp|G3M4F8|OCTB2_CHISP2.445e-6941.38Octopamine receptor beta-2R OS=Chilo suppressalis ... [more]
sp|P35406|DRD1_CARAU1.457e-4636.42D(1) dopamine receptor OS=Carassius auratus OX=795... [more]
sp|P47800|DRD1L_OREMO2.308e-4635.47D(1)-like dopamine receptor OS=Oreochromis mossamb... [more]
back to top
BLAST of GCR004 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUF10.000e+0100.00GCR004 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
A0A2T7P9974.362e-8149.23G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A433U5X81.142e-8048.93G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
W0U9P02.590e-8046.99Octopamine beta-type receptor 2 OS=Apis mellifera ... [more]
A0A193KU781.889e-7948.41GCR034 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
back to top
BLAST of GCR004 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr44.326e-4538.975-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
ENSAMXT00000025832.26.622e-4537.30pep primary_assembly:Astyanax_mexicanus-2.0:8:7261... [more]
htr41.015e-4438.975-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
adrb2a2.081e-4437.50adrenoceptor beta 2 [Source:NCBI gene;Acc:10304118... [more]
htr44.058e-4438.975-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
back to top
BLAST of GCR004 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-247m21.34.647e-4137.30si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ENSPMAT00000000271.14.862e-3531.83pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 g... [more]
adrb2a5.246e-3532.90adrenoceptor beta 2, surface a [Source:ZFIN;Acc:ZD... [more]
adra1bb5.493e-3534.57adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
TAAR11.715e-3233.99trace amine associated receptor 1 [Source:HGNC Sym... [more]
back to top
BLAST of GCR004 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR004 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427721.017e-3535.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447403.066e-3530.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431183.110e-3332.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366105.235e-3230.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317091.624e-3131.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR004 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adrb16.177e-4537.61adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
htr42.240e-4338.345-hydroxytryptamine receptor 4 [Source:ZFIN;Acc:ZD... [more]
adra1d1.113e-4237.06adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157... [more]
ENSORLT00000009159.22.323e-4236.05D(1) dopamine receptor [Source:NCBI gene;Acc:10116... [more]
drd1b1.890e-4135.19dopamine receptor D1b [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of GCR004 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022932.10.000e+0100.00SMESG000022932.1[more]
SMESG000055001.16.668e-8245.03SMESG000055001.1[more]
SMESG000011585.16.689e-8248.09SMESG000011585.1[more]
SMESG000063119.14.744e-4336.15SMESG000063119.1[more]
SMESG000063119.15.940e-4336.15SMESG000063119.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002158 ID=SMED30002158|Name=GCR004|organism=Schmidtea mediterranea sexual|type=transcript|length=1354bp
GTTTGATGCTCGAAATTGATTTTCAGAATGTAAAGAATGAACACTAAAGA
AAATGTTGACTTTTTTTGAACCATTTAATGCTTCAATTTCATCAAATAAA
CTCGGCATTTCTTCCCAAATCATAGCTAAATGCATCAAAACCTTGCTTTT
GTCTACAATAATTGCCATCGCAATATTTGGAAATGGTCTCGTAATAGTCA
GTGTACTTCGGTTTCATAAATTACGACGAATTATTACCAATCGGTTCGTT
GTGTCGCTTGCGCTGGCTGACTTATTGGTTTCTTGTTGCGTAATGACTTT
CAGCGCAAGCATGGTTGCGTCGGATGGACTGTGGCTGTTCGGACCGTTTC
TCTGTGATCTATTTAACGCCAATGATGTTTTATTTTCCACCGCCTCAATT
GCTCATTTGGCCAGCATAAGTATGGATAGGTACATTTCCATTAAAATGCC
ATTTCAATACAATCAAATTATGACAAGTCGAAAATCTATCTTAATGCTCA
TCGGTTGTTGGATTTACGCTCTTGTCGTCTCGTACATTCCGATTTTCACC
GGACTTTATTCATCGGCTGAAAACTTTCAGTGGCAAAAATCCAATCCGAC
CAAGTGTGAATTCCGCGTCAATCCGTTTTTTGGAATTGGCTCGTCAATAA
TTTCATTTTGGATTCCTTGCATAGTGATGACAATAGTTTACGGGTTGATT
TACAAAGATGCAAGAAAACAGGAAAATCAAATATTTCAAATGCAAAAACG
GACTTTTAGTCACGGACACCGATCGAGTGTGAAATGTGATCATAACTCGA
TAAATCTCAACGACAAAAAGAAAACCCTCTACAAAGAAGAACGAATTATG
CTGCAGAAAGAACACAAGGCAGCAAAAACTCTTGGTATCATTATGGGTGT
CTTTATAGTTTGTTGGTTGCCATTTTTTCTGTGGATGACCATAAAAAATG
CTTGCTTGCGATGTCCAGAGCTCCATCCAATTTTGGTGGACACTTTGTTT
TGGATCGGTTATTTCAACTCTACACTCAATCCAGCTATTTATGCATTTTA
TCAACAGGATTTTCGACGGGCTTTCAAAATCCAATTGAAAAGTTGTTGCT
GCATTTTCCAAAGAGCTGTTTGCTGTTTAAAATCTAACCGAAATTCATTA
ACAAACTCCTATGAATATTACACTACTAACAGTGCATTCAGTAGACGCAA
ACCAAACACCAATTAAAACAAATTTATCTCAAAATAATAAATTGCTGTCG
TTGTTTAAAGCCCTATGAAAATTTTCGCAAGGATTTGTTAAATTATATTT
CACACATACAATGACTTTCATTGTCTCAATACTTAATTGTGATTTATCAG
ATGT
back to top

protein sequence of SMED30002158-orf-1

>SMED30002158-orf-1 ID=SMED30002158-orf-1|Name=SMED30002158-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MLTFFEPFNASISSNKLGISSQIIAKCIKTLLLSTIIAIAIFGNGLVIVS
VLRFHKLRRIITNRFVVSLALADLLVSCCVMTFSASMVASDGLWLFGPFL
CDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLI
GCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPFFGIGSSII
SFWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHRSSVKCDHNSI
NLNDKKKTLYKEERIMLQKEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNA
CLRCPELHPILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLKSCCC
IFQRAVCCLKSNRNSLTNSYEYYTTNSAFSRRKPNTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 62..83
score: 38.49
coord: 312..338
score: 33.42
coord: 144..165
score: 18.99
coord: 28..52
score: 26.3
coord: 194..217
score: 26.49
coord: 108..130
score: 36.16
coord: 273..297
score: 35.17
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 43..330
e-value: 2.7E-65
score: 220.3
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 114..130
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 20..358
e-value: 2.4E-81
score: 275.0
NoneNo IPR availablePANTHERPTHR24248:SF167OCTOPAMINE RECEPTOR BETA-2Rcoord: 21..361
NoneNo IPR availablePANTHERPTHR24248ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 21..361
NoneNo IPR availableCDDcd150667tmA_DmOct-betaAR-likecoord: 28..341
e-value: 3.34188E-115
score: 334.344
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 16..354
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 195..217
NoneNo IPR availableTMHMMTMhelixcoord: 310..332
NoneNo IPR availableTMHMMTMhelixcoord: 273..295
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 43..330
score: 40.853