TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30002156
Length (bp)2230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30002156) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30002156) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30002156) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30002156) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002156

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002156SMESG000000368.1 SmedASXL_080827SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002156SMESG000000368.1 SmedASXL_080827SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000294.1 dd_Smed_v4_1243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000294.1 dd_Smed_v4_1243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000294.1 dd_Smed_v4_1243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000294.1 dd_Smed_v4_1243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000294.1 dd_Smed_v4_1243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000294.1 dd_Smed_v4_1243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002156SMESG000000368.1 dd_Smed_v4_7494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002156SMESG000000368.1 Contig22758newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002156 Contig24435newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000411.1 SMESG000000294.1 SMESG000029703.1 SMESG000029692.1 SMESG000000514.1 SMESG000000502.1 SMESG000000371.1 SMESG000044161.1 SMESG000029738.1 SMESG000000421.1 dd_Smed_v6_1243_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000411.1 SMESG000000294.1 SMESG000029703.1 SMESG000029692.1 SMESG000000514.1 SMESG000000502.1 SMESG000000371.1 SMESG000044161.1 SMESG000029738.1 SMESG000000421.1 dd_Smed_v6_1243_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002156SMESG000065606.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000411.1 SMESG000000294.1 SMESG000029703.1 SMESG000029692.1 SMESG000000514.1 SMESG000000502.1 SMESG000000371.1 SMESG000044161.1 SMESG000029738.1 SMESG000000421.1 dd_Smed_v6_1243_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 46.9802 bits (110), Expect = 4.478e-7
Identity = 66/293 (22.53%), Postives = 115/293 (39.25%), Query Frame = 1
Query:  145 VNCPRQNCEFNDELQM-IENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSE---------------------NTEMRNENKQFKQQIDNIERQFINQQQKMCEMEAXXXXXXXXXXXXXXXXXXXXXXNRASQDEMIELMNEIIQSKQQIKNIEKPIETSETKSERQIDAFKQNFEQQQNIKVIYRND*ICDSDSK*NGEMRL*NPV------DSNKFWKCRIYKFRNFDWQIDKLSQLKRRKMIYIKPFYCRIIGYKMCLTV 939
            V CP  +C F+  L+  + +H   C K  ++C F   GC    + N+EM+ H +     H +++      L  ++E +KSE                       EMR +N+Q +Q++ +++    +  +K+ E+E + +E                   RA ++E+  L   +   +  + +++     S + S         + EQQ     + R+D +         EM L   V      +    WK R YK R  +  + K   L      Y +PFY    GYKMC  V
Sbjct:  204 VACP-NHCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGL-NQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPL---------------RAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTL-----ASLEQQ-----LTRHDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSL------YSQPFYTGYFGYKMCARV 463          

HSP 2 Score: 27.335 bits (59), Expect = 4.478e-7
Identity = 12/40 (30.00%), Postives = 21/40 (52.50%), Query Frame = 3
Query:  936 GVKFGLLYL-MCGESDDRLEWPFKYELNIYLINPADGNDY 1052
            G    L ++ M GE D  L+WPFK ++ + L++      +
Sbjct:  473 GTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKH 512          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.015e-14
Identity = 46/136 (33.82%), Postives = 85/136 (62.50%), Query Frame = 1
Query:   97 DIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEMRNENKQFKQQIDNIE------RQFINQQQKMCEMEA 486
            +I +D+P+N++I+++ V C  ++C++ DEL+ +E+H RTC  RS++CP++ IGC    I  +++  HL  EI+ H+KLL++ + N  NEME +K+ N  +   N+  + +I+ ++      R  I   Q+ C  +A
Sbjct:   15 NICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQA 150          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.201e-12
Identity = 41/157 (26.11%), Postives = 83/157 (52.87%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEMRNENKQFKQQIDNIERQFINQQQKM 471
            CS CI  Y+   + +CPG    C+   +   ++I  D+ +N +I+++ V CP + C+   EL  IE H+R C  +S +CPF  +GC   ++  +++ +HL    + HSK        + + + +M+++   +  +  + ++ I+ I+  F +Q + M
Sbjct:   47 CSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSK-------LIIDIISNMRNDFFGLTTKEVELREDINLIKNHFQSQNEIM 196          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 9.156e-11
Identity = 35/109 (32.11%), Postives = 55/109 (50.46%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSK 327
            C  CI  YL  +  +CPG    C+   +N   D+  +  ++ RIS IVV CP   C +  EL  ++ H+  C   S+ CP   IGC    +  +EM  HL +++  H++
Sbjct:   51 CYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQ 159          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000000393.1 (SMESG000000393.1)

HSP 1 Score: 373.244 bits (957), Expect = 4.001e-122
Identity = 254/418 (60.77%), Postives = 280/418 (66.99%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEMRNENKQFKQQIDNIERQFINQQQKMCEMEAXXXXXXXXXXXXXXXXXXXXXXNRASQDEMIELMNEIIQSKQQIKNIEKPIETSETKSERQIDAFKQNFE---QQQNIKVIYRND*ICDSDSK*NGEMRL*NPVDSNKFWKCRIYKFRNFDWQIDKLSQLKRRKMIYIKPFYCRIIGYKMCLTV---*NLGCFI*CVANPMTDWNGHSNMN*TYI**TRQMEMI-MINNR*NTMTALMMPDWVGQL----------ERNIPIYCKYDFNDLSDIKNDKLLLQCRIK 1203
            CSDCIEHYLDG DKFCPGTARYCQNRMINYANDIAI WPINIRISEIVVNCPRQNCEFNDELQMIENH RTC  + ISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSEN E+RNENKQFKQQ   I+RQ  N QQKMCEMEA   +      EI +++ AV  ENRA QD+MIEL  EI QSKQQI+NIEKPIETSETKSER+IDAFKQN E    QQNIK       I +   K   E+R   P+ + KF       F   DW IDKLSQL+R K IY +PFY    GYKMCL V    + G    C      D +        Y   +  +++I   N       +   PD               +RN PIY  Y    LS +KNDKLLL+CRIK
Sbjct:   46 CSDCIEHYLDGKDKFCPGTARYCQNRMINYANDIAIHWPINIRISEIVVNCPRQNCEFNDELQMIENHTRTCGNQPISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENIELRNENKQFKQQ---IKRQLANHQQKMCEMEA---KERENRGEINKKMAAVNNENRALQDKMIELRREISQSKQQIENIEKPIETSETKSEREIDAFKQNCEQQQLQQNIK-------IQNEMEKCANEIR---PIQT-KFGNAEFKNFGILDWHIDKLSQLERDKSIYSEPFYSWPGGYKMCLAVAIRGDFGVIWVCFHLMRGDCDAGLEWPFKY---SVTLDVINPANGNFYRSISEKCPDSRAGAAAARWGRPASDRNDPIY-NY-ITKLSKVKNDKLLLKCRIK 441          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000000493.1 (SMESG000000493.1)

HSP 1 Score: 354.369 bits (908), Expect = 1.013e-114
Identity = 254/432 (58.80%), Postives = 282/432 (65.28%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEM-------RNENKQFKQQIDNIERQFINQQQKMCEMEAXXXXXXXXXXXXXXXXXXXXXXNRASQDEMIELMNEIIQSKQQIKNIEKPIETSETKSERQIDAFKQNFE---QQQNIKVIYRND*ICDSDSK*NGEMRL*NPVDSNKFWKCRIYKFRNFDWQIDKLSQLKRRKMIYIKPFYCRIIGYKMCLTV----------*NLGCFI*CVANPMTDWNGHSNMN*TYI**TRQMEMIMINNR*NTMTALMMPD----------WVGQLE-RNIPIYCKYDFNDLSDIKNDKLLLQCRIK 1203
            CSDCI+H+LDG+DKFCPGT+RYCQNRMINYANDIAIDWP NIRISEIVVNCPRQNCEFNDELQMIENHMRTCDK+SI+CPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENTEM       RN NKQFKQQIDNIERQFINQQQKMCEMEAKEQENTGEIEE+ EE+  +K  NRA QDEMIEL  EI QSKQ                  QIDAFKQN E    QQNIK+    + I +       E+RL       KF       F   DWQIDKLSQL+R K IY +PFY    GYK+CL V           +LG    CV   +   +  + +   +    +   +   N       ++  PD          W      RN  I     F  LSDIKNDKLLL+CRI+
Sbjct:   46 CSDCIQHHLDGNDKFCPGTSRYCQNRMINYANDIAIDWPCNIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKQSINCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENTEMRNYNIELRNANKQFKQQIDNIERQFINQQQKMCEMEAKEQENTGEIEELNEEMVVIKNANRALQDEMIELRREISQSKQ------------------QIDAFKQNGEQQQLQQNIKIQNEMEKIAN-------EIRL----IPTKFGNAEFINFGILDWQIDKLSQLRRDKWIYSEPFYSGPGGYKICLAVFIEYWWDDIRDDLGAI--CVGFYLMCGDCDAGLEWPFKYSVKVDAINPANGNVYCSQSVKCPDCPAATAAAANWGRPASYRNYAICFNNHFTKLSDIKNDKLLLKCRIE 446          

HSP 2 Score: 58.5362 bits (140), Expect = 1.089e-8
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 3
Query:  918 VQDVLDGVKFGLLYLMCGESDDRLEWPFKYELNIYLINPADGNDYDKQSMKYYDC----SDDARLGRPA 1112
            ++D L  +  G  YLMCG+ D  LEWPFKY + +  INPA+GN Y  QS+K  DC    +  A  GRPA
Sbjct:  348 IRDDLGAICVGF-YLMCGDCDAGLEWPFKYSVKVDAINPANGNVYCSQSVKCPDCPAATAAAANWGRPA 415          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000000559.1 (SMESG000000559.1)

HSP 1 Score: 353.984 bits (907), Expect = 1.091e-113
Identity = 263/482 (54.56%), Postives = 292/482 (60.58%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEMRN--------------ENKQFKQQIDNIERQFINQQQKMCEMEAXXXXXXXXXXXXXXXXXXXXXXNRASQDEMIELMN-------EIIQSKQQIKNIEKPIETSE------------------------------------------TKSERQIDAFKQNFEQ---QQNIKVIYRND*ICDSDSK*NGEMRL*NPVDSNKFWKCRIYKFRNFDWQIDKLSQLKRRKMIYIKPFYCRIIGYKMCLT--V*NLGCFI*CVANPM-TDWNGHSNMN*TYI**TRQMEMIMINNR*NTMTA---LMMPD---------WVGQL-ERNIPIYCKYDFNDLSDIKNDKLLLQCRI 1200
            CSDCI+HYLDG+DKFCPGT RYCQNRMINYANDIAIDWP NIRISEIVVNCPRQNCEFNDELQMIENH RTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMK ENTEMRN               N+QFKQQIDNIERQFINQQQKMCEMEAKEQENT EIE++ EE+  +K  NRA QDEMIEL N       EI QSKQQ +NIE  +   +                                          +K ++QIDAFKQ  EQ   QQNIK       I +   K   E+RL       KF       F   DWQIDKLSQL+R+K IY KPFY    GYKMCL   + + G  I    + M  D +        Y      +++  IN     + +   +  PD         W     +RN PI C Y    LS IKNDKLLL+CRI
Sbjct:   46 CSDCIQHYLDGNDKFCPGTTRYCQNRMINYANDIAIDWPFNIRISEIVVNCPRQNCEFNDELQMIENHTRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKRENTEMRNYNIELRNDIIELRNANEQFKQQIDNIERQFINQQQKMCEMEAKEQENTAEIEQLNEEMVVIKNANRALQDEMIELRNDNIQLKREISQSKQQNQNIELQLTNQQQKMCEMEAKEQENRGEINEEIAAVNNANRALQNEMIELRREISKFKQQIDAFKQISEQHQLQQNIK-------IQNEMEKCANEIRL----IQTKFGNAEFINFGILDWQIDKLSQLERKKSIYSKPFYSGPGGYKMCLAVIIRDFGGAILVYFHLMRGDCDAGLEWPFKY-----AVKVDAINPADGNVYSSQSVKCPDSPAAAAAAGWGRPARDRNDPI-CYY-ITKLSAIKNDKLLLKCRI 509          

HSP 2 Score: 53.5286 bits (127), Expect = 5.162e-7
Identity = 30/65 (46.15%), Postives = 37/65 (56.92%), Query Frame = 3
Query:  936 GVKFGLLYLMCGESDDRLEWPFKYELNIYLINPADGNDYDKQSMKYYDCSDDARL---GRPAREK 1121
            G      +LM G+ D  LEWPFKY + +  INPADGN Y  QS+K  D    A     GRPAR++
Sbjct:  420 GAILVYFHLMRGDCDAGLEWPFKYAVKVDAINPADGNVYSSQSVKCPDSPAAAAAAGWGRPARDR 484          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000000421.1 (SMESG000000421.1)

HSP 1 Score: 344.354 bits (882), Expect = 8.995e-113
Identity = 215/236 (91.10%), Postives = 219/236 (92.80%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEM-------RNENKQFKQQIDNIERQFINQQQKMCEMEAXXXXXXXXXXXXXXXXXXXXXXNRASQDEMIELMNEIIQSKQQIKNIEKPIETSETKSERQIDAFKQ 687
            CSDCIEHYLDG +KFCPGT RYCQNRMINYANDIAID PINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDK+SISCPFNAIGC MNEIRNEEMKSHLN+EIYCHSK+LIELINNLRNEMESMKSENTEM       RNENKQFKQQ   IERQ  N QQKMCEMEAKEQENTGEIEEIKEEIKAVKIENRASQDEMIELMNEIIQSKQQIKNIEKPIETSETKSERQIDAFKQ
Sbjct:   46 CSDCIEHYLDGKNKFCPGTTRYCQNRMINYANDIAIDRPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKQSISCPFNAIGCEMNEIRNEEMKSHLNQEIYCHSKMLIELINNLRNEMESMKSENTEMRNDNIELRNENKQFKQQ---IERQIANHQQKMCEMEAKEQENTGEIEEIKEEIKAVKIENRASQDEMIELMNEIIQSKQQIKNIEKPIETSETKSERQIDAFKQ 278          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000000294.1 (SMESG000000294.1)

HSP 1 Score: 345.895 bits (886), Expect = 2.342e-111
Identity = 234/379 (61.74%), Postives = 251/379 (66.23%), Query Frame = 1
Query:    1 CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKXXXXXXXXXXXXMESMKSENTEM--------------RNENKQFKQQIDNIERQFINQQQKMCEMEAXXXXXXXXXXXXXXXXXXXXXXNRASQDEMIELMNE-------IIQSKQQIKNIEKPIETSETK------------------------------------------SERQIDAFKQNFE---QQQNIKVIYRND*ICDSDSK*NGEMRL*NPVDSNKFWKCRIYKFRNFDWQIDKLSQLKRRKMIYIKPFYCRIIGYKMCLTV 939
            CSDCI+H+LDG+DKFCPGT+RYCQNRMINYANDI IDWP NIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENTEM              RN NKQFKQQIDNIERQFINQQQKMCEMEAKEQENT EIE + EE+  +K  NRA QDEMIEL N+       I QSKQQ +NIE  +   + K                                          S++QIDAFKQ  E    QQNIK       I +   K   E+RL       KF       F   DWQIDKLSQL+R K IY +PFY    GYKMCL V
Sbjct:   46 CSDCIQHHLDGNDKFCPGTSRYCQNRMINYANDIGIDWPFNIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENTEMRNYNIELRNDIIELRNANKQFKQQIDNIERQFINQQQKMCEMEAKEQENTAEIELLNEEMVVIKNANRALQDEMIELRNDNIQLKRQISQSKQQNQNIELQLTNQQQKMCEMEAKEQENRGEINGEIAAVNNANRSLQNEMIELRKEISQSKQQIDAFKQISEQQQLQQNIK-------IQNEMEKCANEIRL----IQTKFGNAEFINFGILDWQIDKLSQLERGKSIYSEPFYSGPGGYKMCLKV 413          

HSP 2 Score: 53.9138 bits (128), Expect = 2.778e-7
Identity = 26/32 (81.25%), Postives = 29/32 (90.62%), Query Frame = 2
Query:  743 IQIQNEMEKCAYEIQSIQTNFGNAEFISFGIL 838
            I+IQNEMEKCA EI+ IQT FGNAEFI+FGIL
Sbjct:  348 IKIQNEMEKCANEIRLIQTKFGNAEFINFGIL 379          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf34.478e-722.53TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A0F7GWW33.015e-1433.82TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
I1ZID85.201e-1226.11TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1019.156e-1132.11TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000393.14.001e-12260.77SMESG000000393.1[more]
SMESG000000493.11.013e-11458.80SMESG000000493.1[more]
SMESG000000559.11.091e-11354.56SMESG000000559.1[more]
SMESG000000421.18.995e-11391.10SMESG000000421.1[more]
SMESG000000294.12.342e-11161.74SMESG000000294.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002156 ID=SMED30002156|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2230bp
TGTTCCGATTGTATTGAGCATTATCTGGACGGCAGTGATAAATTCTGTCC
AGGAACTGCAAGATATTGTCAAAACCGAATGATAAATTATGCAAATGACA
TCGCTATCGATTGGCCAATCAACATTCGCATATCAGAAATTGTGGTGAAT
TGCCCGAGGCAAAATTGTGAATTTAATGATGAGTTACAAATGATAGAGAA
TCACATGAGAACGTGCGACAAACGGTCAATTAGCTGCCCATTCAACGCAA
TCGGATGCGGAATGAATGAGATTAGGAATGAGGAAATGAAATCACATCTC
AATGAGGAGATTTATTGTCATAGCAAATTGCTGATTGAGCTCATCAATAA
TTTACGCAATGAGATGGAATCAATGAAGAGTGAAAATACCGAAATGAGAA
ATGAAAACAAACAGTTCAAGCAACAGATTGATAATATTGAGCGGCAATTC
ATTAACCAACAGCAGAAAATGTGCGAGATGGAAGCGAAGGAGCAGGAAAA
CACAGGAGAAATCGAGGAAATCAAGGAGGAAATCAAGGCAGTAAAGATTG
AAAATCGCGCATCGCAAGATGAAATGATCGAATTGATGAACGAAATCATC
CAATCCAAACAACAAATTAAGAACATTGAGAAACCGATCGAAACGAGTGA
AACAAAATCCGAAAGGCAAATTGATGCATTTAAACAAAACTTTGAACAGC
AGCAGAATATAAAAGTGATTTATAGAAATGATTGAATTTGTGATTCAGAT
TCAAAATGAAATGGAGAAATGCGCCTATGAAATCCAGTCGATTCAAACAA
ATTTTGGAAATGCAGAATTTATAAGTTTCGGAATTTTGATTGGCAAATTG
ATAAATTATCGCAACTGAAGAGACGTAAAATGATTTATATCAAGCCATTT
TATTGCAGGATAATCGGGTACAAGATGTGCTTGACGGTGTAAAATTTGGG
TTGCTTTATTTAATGTGTGGCGAATCCGATGACCGATTGGAATGGCCATT
CAAATATGAACTGAACATATATTTGATAAACCCGGCAGATGGAAATGATT
ATGATAAACAATCGATGAAATACTATGACTGCTCTGATGATGCCAGATTG
GGTAGGCCAGCTAGAGAGAAATATTCCGATTTATTGTAAATATGATTTTA
ACGATTTATCAGACATTAAAAACGACAAATTGCTGCTGCAGTGCAGAATC
AAAAATTGTGAAAGACTTTATCAAATATTTCAATAAAAGTTTTGATTTAT
TTTCTCAATTTGCCTCAACTCAGCAGATAAATTTATGCAAATTGCCGGTT
TTGATAGGCGCGCGACATCGGCCAATCAAAACACTGATCACAGCTACATA
TGAATGCAGACGAGAAATTTCTGTTCGATGGACTCGTCAATATTCTTGGA
GTAATTATTCATCTCTACGGGGATTTCGAATCCGTTCTGATTCCCATCTC
AAGCTGTTTCATGGATGAAGGTTGGTAATTCCCACTTCATGCAATTTGTA
ATGGAGCAAACCATGTCAAATGGTCTACGAGAACATTTTACAATGCGAGT
TTATGGTGATATAAACTGGATTTAATCACGAGAGTCTTAGGTGAGCGGTT
TTCTTTTTATTGTTAGTTCTTCCTATTTAAGGGCAGCTTTTGTGGCATTG
AATCTCGCCTCACTACGCAGGTTTCGAACCGTCGATGGGTTTGGATTTAA
ATTTTCATAAATGATTCAGTCGCGTTGGACCTAACTTATGGACACGTGAT
CGAAATACCCGTTGCTCCTTATTGTTCGACGAAGTGGTTGGTTATTACCT
CTATGTTTTTATTTAATAAATTGTCTTGTGATTCATTTTATGGTTTACGA
TAGTCTATACAGGCCTATGCTTTGTTATTTAATAAATTGTTTTATAGTTT
ATCTTTTGATTTACGATTGATCCTGTGTATTCCTGCTTTTATTATGTAAC
AAAATCGTGTTATGATGAGCCTTATGATTTTAGGGTTGATTCTCTGCATG
CCTGTTTTGGTCATTTAACTAAATCAATTTATGATTAACCTTATGGTTTA
GGATTGATTCTACTTGTCTAGTTCGACTGGCGATATAATGCGCAGTATTA
CCCAACCGCTATTTTTATGGGTTCCGATCTTTTATTTCTAGTTTACCTAA
TTGATTGGGTATCCCTTTGTTGGGCAAAAACTGATTTTCTTTAACCAGCA
CAATAACGCCTGAATGTTTTTGAGCGGAAT
back to top

protein sequence of SMED30002156-orf-1

>SMED30002156-orf-1 ID=SMED30002156-orf-1|Name=SMED30002156-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
CSDCIEHYLDGSDKFCPGTARYCQNRMINYANDIAIDWPINIRISEIVVN
CPRQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHL
NEEIYCHSKLLIELINNLRNEMESMKSENTEMRNENKQFKQQIDNIERQF
INQQQKMCEMEAKEQENTGEIEEIKEEIKAVKIENRASQDEMIELMNEII
QSKQQIKNIEKPIETSETKSERQIDAFKQNFEQQQNIKVIYRND*
back to top

protein sequence of SMED30002156-orf-2

>SMED30002156-orf-2 ID=SMED30002156-orf-2|Name=SMED30002156-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MILTIYQTLKTTNCCCSAESKIVKDFIKYFNKSFDLFSQFASTQQINLCK
LPVLIGARHRPIKTLITATYECRREISVRWTRQYSWSNYSSLRGFRIRSD
SHLKLFHG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 1..57
e-value: 1.8E-5
score: 26.4