Sarcosine dehydrogenase

Overview
NameSarcosine dehydrogenase
Smed IDSMED30002142
Length (bp)2916
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sarcosine dehydrogenase (SMED30002142) t-SNE clustered cells

Violin plots show distribution of expression levels for Sarcosine dehydrogenase (SMED30002142) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sarcosine dehydrogenase (SMED30002142) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sarcosine dehydrogenase (SMED30002142) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002142

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30002142SMESG000068610.1 dd_Smed_v4_4280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30002142SMESG000068610.1 dd_Smed_v4_4280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002142SMESG000068610.1 dd_Smed_v4_4280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30002142SMESG000068610.1 dd_Smed_v6_4280_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sarcosine dehydrogenase vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 502/895 (56.09%), Postives = 653/895 (72.96%), Query Frame = 1
Query:  130 SATNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            +   A+  VPY+ T K +G  T       ++ LP +A+VV+IGGG  GC  LYHLAKLG++  VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++  ++ + LE ETG++TG+IQNGGLF+AS  +RL+EY+RL +LGK + + S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA++ +   V  + V  +     FG +R  V  V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM  YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QER G+ERPGWF    P  +L YD+YG+Y    H++Y YR +L  +YTF F  +H+ I KECL  R  AA+F+MSYFGKFYL G D +KA DW+F+A+ ++P GS +YTCM N  GGTE+DLT + +  S     +  P   G  YYLA+GGAV Q+  S I  +L++++  C+LID S+D+ ++SIQGP SR ILQ + D D SNE+FPFST KL++  G   RA+RLSFVGE+GWELHI K     +Y +++  G  HG++NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GL+++L  F++++K+ + GLEAI RNG+ VG +R ADFG  IDK I YGY+    G  V+  +++SGDY +E+MG  Y A  H K+ FDP NKR+KG+Y
Sbjct:   32 AGPTAEKSVPYQRTLK-EGQGTSVVAQGPSRPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDD----FGVRR--VAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPL-APAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGHLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLEAIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQAHLKSPFDPNNKRVKGIY 918          
BLAST of Sarcosine dehydrogenase vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 502/895 (56.09%), Postives = 653/895 (72.96%), Query Frame = 1
Query:  130 SATNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            +   A+  VPY+ T K +G  T       ++ LP +A+VV+IGGG  GC  LYHLAKLG++  VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++  ++ + LE ETG++TG+IQNGGLF+AS  +RL+EY+RL +LGK + + S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA++ +   V  + V  +     FG +R  V  V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM  YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QER G+ERPGWF    P  +L YD+YG+Y    H++Y YR +L  +YTF F  +H+ I KECL  R  AA+F+MSYFGKFYL G D +KA DW+F+A+ ++P GS +YTCM N  GGTE+DLT + +  S     +  P   G  YYLA+GGAV Q+  S I  +L++++  C+LID S+D+ ++SIQGP SR ILQ + D D SNE+FPFST KL++  G   RA+RLSFVGE+GWELHI K     +Y +++  G  HG++NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GL+++L  F++++K+ + GLEAI RNG+ VG +R ADFG  IDK I YGY+    G  V+  +++SGDY +E+MG  Y A  H K+ FDP NKR+KG+Y
Sbjct:   32 AGPTAEKSVPYQRTLK-EGQGTSVVAQGPSRPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDD----FGVRR--VAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPL-APAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGHLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLEAIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQAHLKSPFDPNNKRVKGIY 918          
BLAST of Sarcosine dehydrogenase vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 359/586 (61.26%), Postives = 447/586 (76.28%), Query Frame = 1
Query:  883 AGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIG 2634
            AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM  YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QER G+ERPGWF    P  +L YD+YG+Y    H++Y YR +L  +YTF F  +H+ I KECL  R  AA+F+MSYFGKFYL G D +KA DW+F+A+ ++P GS +YTCM N  GGTE+DLT + +  S     +  P   G  YYLA+GGAV Q+  S I  +L++++  C+LID S+D+ ++SIQGP SR ILQ + D D SNE+FPFST KL++  G   RA+RLSFVGE+GWELHI K     +Y +++  G  HG++NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GL+++L  F++++K+ + GLEAI RNG+ VG +R ADFG  IDK I 
Sbjct:    2 AGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPL-APAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGHLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLEAIWRNGQVVGHVRRADFGFAIDKTIA 586          
BLAST of Sarcosine dehydrogenase vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 332/584 (56.85%), Postives = 432/584 (73.97%), Query Frame = 1
Query:  130 SATNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYT 1857
            +   A+  VPY+ T K +G  T       ++ LP +A+VV+IGGG  GC  LYHLAKLG++  VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++  ++ + LE ETG++TG+IQNGGLF+AS  +RL+EY+RL +LGK + + S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA++ +   V  + V  +     FG +R  V  V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM  YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QER G+ERPGWF    P  +L YD+YG+Y    H++Y YR +L  +YTF F  +H+ I KECL  R  AA+F+MSYFGKFYL G D +KA DW+F+A+ ++P GS +YT
Sbjct:   32 AGPTAEKSVPYQRTLK-EGQGTSVVAQGPSRPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDD----FGVRR--VAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYT 608          
BLAST of Sarcosine dehydrogenase vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 389.037 bits (998), Expect = 2.441e-126
Identity = 193/369 (52.30%), Postives = 250/369 (67.75%), Query Frame = 1
Query: 1750 MSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXE----------------------KIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            MSYFGKFYL G D +KA DW+F+A+ ++P GS +YTCM N  GGTE+DLT + +  S     +  P   G  YYLA+GGAV Q+  S I  +L++++  C+LID S+D+ ++SIQGP SR ILQ + D D SNE+FPFST KL++  G   RA+RLSFVGE+GWELHI K     +Y +++  G  HG++NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GL+++L  F+++E                      K+ + GLEAI RNG+ VG +R ADFG  IDK I YGY+    G  V+  +++SGDY +E+MG  Y A  H K+ FDP NKR+KG+Y
Sbjct:    1 MSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPL-APAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGHLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEEPLWTRPHPAVSGAPAFSTASSSKVPMFGLEAIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQAHLKSPFDPNNKRVKGIY 368          
BLAST of Sarcosine dehydrogenase vs. Ensembl Celegans
Match: pdpr-1 (Pyruvate Dehydrogenase Phosphatase Regulatory subunit [Source:UniProtKB/TrEMBL;Acc:Q9U300])

HSP 1 Score: 262.307 bits (669), Expect = 3.661e-74
Identity = 235/882 (26.64%), Postives = 396/882 (44.90%), Query Frame = 1
Query:  196 KSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAI-TAGTTWHTSGLV-----WHLRPSDTEIQLLSY-SWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILG-PSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWS------PLIAKTAGVKVPLCTLKHAYVISERIEGIQNM-PNVRDHDSSVYLRLQGDAMGIGGYEP---HPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSL-DMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEG-DYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQ-YVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFP-FSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQ-----LHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSA--NFHQKTL 2754
            +S  +   +ADVV+ GGG+SG S  YHLAK G     L+E  +I  +G T  ++GLV     W     DT +Q ++  S +L   L   T     YI+ G  ++AS+       +R+ + G + N   E+L   SE  + +P + T+D+   L+SP D  +DP   C  L   A   GA + +   VL V +              +V  V T +G I+T+  V +AG W+       L  +        CT  + +        + +M P   D D +V LR         G+      P+         +   E DWN F  N+   I+R P+L        + G E++TPD  P +GES + KG ++ C  N  G+ L+GG G+ +   +   + S  D+   D+ RF + +  N+ ++  R+ E  A  YS +Y   +    R++    ++ +L   G ++ E  G+ERP WF                  E+    E   ++ G D      +    +  E    RE+  + +MS F K+ +TG D  + + ++ +AN ++P+G+ +YT M ++ GG   D T + +               G   +  V   + Q  V  ++       +    + DV+     L + GP SR ++  I+    S+  FP F  Q++        RA+ ++  GE+GW +++  + A+++Y  I+  GK + + +AGY  +  L IEK Y +W  D+    TP+E G  F    K D  F+G+ ALE Q + G+ K+     +    +       G E I+++G  VG   SA +G  +   +  GYV   +   V+  ++ SG +EI+  GKR++   N H  +L
Sbjct:   13 RSYTTAVANADVVVCGGGISGTSIAYHLAKRG-KKVALVEKDSIGCSGATGLSAGLVSSPIFWQ----DTSLQAIAQASLDLYSHLA--TTCKFRYIKCGRTYLASSMANEILLRRMYSRGVVHNDKVELLDCQSEMLERWPFLQTEDVQLALFSPEDVALDPVALCQHLALIAKDYGALIYESNPVLEVHIGDEK----------QVYGVSTKMGFIETSHFVDAAGIWAGSHLVKALPHQHVQTAAYPCTYSYIHTSKLPTGSVSDMTPIFNDLDGNVMLRTTSFKTLCAGFAEESIRPLARQTGSATPWQHPEPDWNTFDPNLEKLISRCPMLGDCNHGDLIVGMEAYTPDKLPTIGESSQAKGYWVMCGMNGQGLSLAGGLGKILGELMCESQSSTADVARVDVGRFID-LHANNQYLIGRTPEVAALTYSNLYHSHQCHTARNLRMAPIYHQLRDAGAVFGEIMGYERPLWF------------------EKTPKTERNALMSGQDALIGKPEWFERVASEYEACRERVGLMDMSSFSKYDITGEDAVEYLQFLCSANVDEPIGTTVYTGMQHQKGGYVTDCTLSRL---------------GEKKFFMVAPTIQQERVLVWMKKWQAILKARVHVQDVTGAYTALDLIGPSSRYLMGDITGLSMSSNDFPTFRCQEINIGMATGIRAISVTHCGELGWVIYVPNEVAQNVYEKILDAGKEYSLQHAGYYTLRQLRIEKFYVYWGQDINATVTPVECGRLFRVDFKKD--FIGKKALEEQVERGVSKRFVQLLVDGHDKETDPWPQGGETILKDGRAVGLTTSAAYGFTLGCQVCIGYVENKEFG-VSPEFVSSGHFEIDIAGKRFTCRLNVHSPSL 840          
BLAST of Sarcosine dehydrogenase vs. Ensembl Celegans
Match: Y37E3.17 (pep chromosome:WBcel235:I:2128590:2145971:1 gene:WBGene00021355.1 transcript:Y37E3.17a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37E3.17)

HSP 1 Score: 226.868 bits (577), Expect = 4.560e-62
Identity = 191/778 (24.55%), Postives = 346/778 (44.47%), Query Frame = 1
Query:  253 SGCSALYHLAKLGVTNTVLIESS---AITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSE-------ILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGG-----------------AINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMK-DVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKIN--GLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGR-SALENQAKN 2493
            +G S  YHL K  + + +L+E +   A  +GT++H+ GLV    P+     +L++S EL   LE+ETGVN  +   G + +A+ E RL E+++        + Y E       +L P + ++L P ++   I G L++ +DG I       AL+ GA + GA++ DG     ++  K     +   +   +         + T  ++ + G W+  IA+ +G  +P+  ++H Y +    +     P + DHDS+ Y+R  GD    GG+E              ++   DW   GV   G                 A + +P L+ + + +      S TPD  PL+G  P  K  +++  +   G+   GG G+ +A WI  G P  ++F  D  R+ ER  D   +  ERS E Y+  Y+  + + +  AGR   +   ++  L + G  +  R G+E    F                            V   +Y     + + ++  +C        + ++S+ GK  + G D +K +D+   A+    +G I    M    GG    +             + + D   + + L            ++     EK+F+ ++  VS+ +  L++ GPKSR++L +++ +D S+E FP  + ++I++   G+ C A   +  G++ +EL   +     +YN+++  G+ HG+VN G  A++ + +E GY+ W  +L  D  P E G+G     +    F+GR SALE + K+
Sbjct:   38 AGSSVAYHLTKRNIKDVLLLERASGVASPSGTSFHSPGLVSASHPAHRYKPILAHSIELYSKLEAETGVNIDFQPTGTIRLATNETRLAEFRKYVNR----DYYKEGDVCKTTLLTPDQVRELAPDVDHSKILGALHTTNDGTISARALTQALVVGAKNGGAQVIDGAIPKEIKYDKEKGHWIIALEDGTL---------VTTRNLINAGGIWANDIARLSGHALPVVVVEHQYAVLTPNKTPGPTPAIIDHDSTFYVRKSGDDYLFGGFE----------SLEKTVIREDWYKKGVPTEGSKSIQADFSRLDDAYKRACDLIPGLQGSKVDAR-AAVFSMTPDGYPLVG--PYDKNYWMSTGFLD-GVSSGGGIGKYLADWIVDGEPPAELFDTDASRY-ERWGDRK-FFTERSRETYSMYYN--WSYTDRSAGRPTDRISGVYGRLKKDGASFSFRNGWEVANSFN-------------------------MGVQNEEYLPTLIREYEMVTNKC-------GVIDLSWKGKIEVKGNDAEKLMDYAI-ASQIPALGKISSGLMLTRHGGILGPMM------------IFHHDRQRSAFILLTEPERESRDLYWLRRAAAEKKFDVQVSIVSEYLASLALVGPKSREVLSALTKSDVSDEGFPQKSTRMIRLGPVGVVC-ARSSTSTGQLSYELFHNRAETAKLYNAVMSAGREHGIVNFGQAALNMMRLEHGYKIWGKELTLDTNPFECGIGGLVDFEK-KEFIGRESALELKKKD 737          
BLAST of Sarcosine dehydrogenase vs. Ensembl Celegans
Match: Y37E3.17 (pep chromosome:WBcel235:I:2128590:2145968:1 gene:WBGene00021355.1 transcript:Y37E3.17b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37E3.17)

HSP 1 Score: 224.557 bits (571), Expect = 3.320e-61
Identity = 191/785 (24.33%), Postives = 346/785 (44.08%), Query Frame = 1
Query:  253 SGCSALYHLAKLGVTNTVLIESS----------AITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSE-------ILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGG-----------------AINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMK-DVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKIN--GLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGR-SALENQAKN 2493
            +G S  YHL K  + + +L+E +          A  +GT++H+ GLV    P+     +L++S EL   LE+ETGVN  +   G + +A+ E RL E+++        + Y E       +L P + ++L P ++   I G L++ +DG I       AL+ GA + GA++ DG     ++  K     +   +   +         + T  ++ + G W+  IA+ +G  +P+  ++H Y +    +     P + DHDS+ Y+R  GD    GG+E              ++   DW   GV   G                 A + +P L+ + + +      S TPD  PL+G  P  K  +++  +   G+   GG G+ +A WI  G P  ++F  D  R+ ER  D   +  ERS E Y+  Y+  + + +  AGR   +   ++  L + G  +  R G+E    F                            V   +Y     + + ++  +C        + ++S+ GK  + G D +K +D+   A+    +G I    M    GG    +             + + D   + + L            ++     EK+F+ ++  VS+ +  L++ GPKSR++L +++ +D S+E FP  + ++I++   G+ C A   +  G++ +EL   +     +YN+++  G+ HG+VN G  A++ + +E GY+ W  +L  D  P E G+G     +    F+GR SALE + K+
Sbjct:   38 AGSSVAYHLTKRNIKDVLLLERASDGDFGVHGVASPSGTSFHSPGLVSASHPAHRYKPILAHSIELYSKLEAETGVNIDFQPTGTIRLATNETRLAEFRKYVNR----DYYKEGDVCKTTLLTPDQVRELAPDVDHSKILGALHTTNDGTISARALTQALVVGAKNGGAQVIDGAIPKEIKYDKEKGHWIIALEDGTL---------VTTRNLINAGGIWANDIARLSGHALPVVVVEHQYAVLTPNKTPGPTPAIIDHDSTFYVRKSGDDYLFGGFE----------SLEKTVIREDWYKKGVPTEGSKSIQADFSRLDDAYKRACDLIPGLQGSKVDAR-AAVFSMTPDGYPLVG--PYDKNYWMSTGFLD-GVSSGGGIGKYLADWIVDGEPPAELFDTDASRY-ERWGDRK-FFTERSRETYSMYYN--WSYTDRSAGRPTDRISGVYGRLKKDGASFSFRNGWEVANSFN-------------------------MGVQNEEYLPTLIREYEMVTNKC-------GVIDLSWKGKIEVKGNDAEKLMDYAI-ASQIPALGKISSGLMLTRHGGILGPMM------------IFHHDRQRSAFILLTEPERESRDLYWLRRAAAEKKFDVQVSIVSEYLASLALVGPKSREVLSALTKSDVSDEGFPQKSTRMIRLGPVGVVC-ARSSTSTGQLSYELFHNRAETAKLYNAVMSAGREHGIVNFGQAALNMMRLEHGYKIWGKELTLDTNPFECGIGGLVDFEK-KEFIGRESALELKKKD 744          
BLAST of Sarcosine dehydrogenase vs. Ensembl Celegans
Match: gcst-1 (Aminomethyltransferase [Source:UniProtKB/TrEMBL;Acc:Q22968])

HSP 1 Score: 78.5666 bits (192), Expect = 5.990e-15
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 1
Query: 1624 EQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTAN-SNKPVGSIIYTCMCNEFGGTEADLTYTEIDTS----LPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQ-KLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGF 2427
            E HK +  + V    Y          I +  ++TR+  ++F++S+  + Y+TG D    ++ + TA+       S   +   NE GG + DL   + D      + N G    DL     YL    A ++     +             I+   +  L+++QGP+  ++LQ  +D D S  +F  +T  K+  I+G  CR  R  + GE G E+ +    A+ +   ++   ++  V  AG  A D+L +E G   + +D+  + TP+EAGL F
Sbjct:   32 ETHKKHGGKLVEFAGYDMPTQYADFSIKESTIHTRKHVSLFDVSHMLQTYITGKDRVAFIESLTTADVQGLQENSGTLSVFTNEKGGIKDDLIIMKTDKDFLFLVTNAGCIEKDLP----YLQENAAAWRSKGKDVK------------IETLDNRGLVAVQGPEMAKVLQEGTDIDLSKLTFMKTTVGKVFGIDG--CRVTRCGYTGEDGVEISVDPTKAEQLVERLL-ASQAGSVKLAGLGARDALRLEAGLCLYGSDIEENTTPIEAGLAF 286          
BLAST of Sarcosine dehydrogenase vs. Ensembl Celegans
Match: gcst-1 (Aminomethyltransferase [Source:UniProtKB/TrEMBL;Acc:Q22968])

HSP 1 Score: 78.5666 bits (192), Expect = 5.990e-15
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 1
Query: 1624 EQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTAN-SNKPVGSIIYTCMCNEFGGTEADLTYTEIDTS----LPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQ-KLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGF 2427
            E HK +  + V    Y          I +  ++TR+  ++F++S+  + Y+TG D    ++ + TA+       S   +   NE GG + DL   + D      + N G    DL     YL    A ++     +             I+   +  L+++QGP+  ++LQ  +D D S  +F  +T  K+  I+G  CR  R  + GE G E+ +    A+ +   ++   ++  V  AG  A D+L +E G   + +D+  + TP+EAGL F
Sbjct:   32 ETHKKHGGKLVEFAGYDMPTQYADFSIKESTIHTRKHVSLFDVSHMLQTYITGKDRVAFIESLTTADVQGLQENSGTLSVFTNEKGGIKDDLIIMKTDKDFLFLVTNAGCIEKDLP----YLQENAAAWRSKGKDVK------------IETLDNRGLVAVQGPEMAKVLQEGTDIDLSKLTFMKTTVGKVFGIDG--CRVTRCGYTGEDGVEISVDPTKAEQLVERLL-ASQAGSVKLAGLGARDALRLEAGLCLYGSDIEENTTPIEAGLAF 286          
BLAST of Sarcosine dehydrogenase vs. Ensembl Fly
Match: Sardh (gene:FBgn0034276 transcript:FBtr0089560)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 411/882 (46.60%), Postives = 589/882 (66.78%), Query Frame = 1
Query:  163 KNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKP-DFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNT---KPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFN-FSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKG-VHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            K   ++ G + + +  LP +ADVV+IGGG +GC  LYHLA+ GV   VL+E + +TAGTTWHT+GL+W LRP+D +IQLL+ S  +++ LE ET ++ G+IQNGG+F+A  E RL+EY+RL T+G    I +++L P +T+KLFPL++     G LYSP DGV+DPA  C+AL K AT+LGA++ +   V ++ + + +          +V  V T  G IK   VV + G W   +    G  +PL  +KHAY++SE I G++ +PN+RDHD S Y R+QGDA+ +GGYEP+PI  +P P DF F L+ELDW+VF  ++ GA    P   K G+KSTVCGPESFTPDHKPLMG  P + GL+ NC +NSAGMM  GGCG Q A W+  G+P L MF +D+RRF++       WI E+SHE+Y KNYS+++K+D+PLAGR   KD L DE+++ G + +E+QG+ERPG+F  T   K  + PYD+YGSY  ++HK+ EY  VL+GD  ++ FS+ H++IG E L  R  A +FNMSYF K  L GP  ++A DW+F+AN+N+     +YTC  N+ GG EAD+T + +    P  G V+NP + G  +Y+  GGA   Y  S +   +  K FN  L D++ ++ ++SIQGP SR+ILQ + D D S+E    ++ +L K   +  R LR+SFVGE+G+ELH+ K    ++Y S++K G    + NAGYR++ SLS EKGY  W  DLRPDDTPLEAGLGFTC+ KT  ++ G++A+ENQ   GLKK+L   +L++++ + GLE + RNGE VG LR A++ + + K++G  YV R DG  + + Y+ +G+YE++ +GK+Y A+ H ++ FDP  +R+ G Y
Sbjct:   17 KQVREDGGARREPSGFLPGAADVVVIGGGSAGCHTLYHLARRGV-KAVLLERAQLTAGTTWHTAGLLWRLRPNDVDIQLLANSRRMLQQLEEETELDPGWIQNGGIFIAHNETRLDEYRRLATVGSALGIENQVLSPEDTQKLFPLLDPSAFVGALYSPGDGVMDPAMLCAALKKAATNLGAQVIENCGVDDLLLEQTARGK-------KVVGVSTPFGDIKAEKVVNATGVWGRDLVARHGTHLPLVPMKHAYIVSESIPGVRGLPNIRDHDYSTYFRIQGDAICMGGYEPNPILLEPVPKDFHFGLYELDWSVFETHVEGAQKLCPSYAKYGVKSTVCGPESFTPDHKPLMGPDPNLDGLYHNCGFNSAGMMFGGGCGEQTALWVIQGQPDLPMFGFDLRRFTQEQGKAIQWIREKSHESYVKNYSMVFKYDQPLAGRDFQKDPLHDEMMKAGAVMEEKQGWERPGFFLPTGSKKAVVQPYDWYGSYVHQRHKDSEYERVLDGDLHYSRFSEYHDLIGSEALACRNNAVVFNMSYFAKLLLDGPQAQEAADWLFSANTNRDPSKTVYTCALNDAGGVEADVTISRL---APGSGEVYNPKINGQGFYIVAGGASAFYTYSVLLAEIRRKGFNASLKDLTAELGVISIQGPNSRKILQPLIDCDLSDEHVAPNSTRLAKFGDVGLRLLRVSFVGELGYELHVPKKDCAAVYRSLMKAGAGEDLRNAGYRSLYSLSSEKGYHLWSFDLRPDDTPLEAGLGFTCR-KTGADYRGKAAIENQRAEGLKKRLVYLTLRDQVPIWGLEGVYRNGEPVGILRRAEYAYTLGKSLGQTYVSRPDGKIIDADYIRNGEYEVDILGKKYRADCHLRSPFDPTGQRVLGNY 886          
BLAST of Sarcosine dehydrogenase vs. Ensembl Fly
Match: CG3626 (gene:FBgn0029706 transcript:FBtr0070652)

HSP 1 Score: 307.375 bits (786), Expect = 1.261e-89
Identity = 240/865 (27.75%), Postives = 399/865 (46.13%), Query Frame = 1
Query:  253 SGCSALYHLAKLGVT-NTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAG--VKVPLCTLKHAYVISERIEGIQ-NMPNVRDHDSSVYLRLQGDAMGIGGYEPHP--IFWDPKPDFAFSLFE--LDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEY---RNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGK--FYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQ-----YVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP--CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXE-----KIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGS----TVTSGYLESGDYEIEKMGKRYSA--NFHQKTL 2754
            +G S  YHL   G    T+L+E   +     W   GL     PS TE++L  YS +L+K L +E G+ TG+   G L +A + +R+  + R+ +    + ++ EIL P +  +   L++   I G L+ P DGV DP   C A +  A  LG R+ +   +  +                +V SV T  G ++    V   G W+  +   +   VKVPL  ++H Y+ ++ IEG+  + P VRD D  ++ R     +  GG+E     ++ D     + +  +   DW+ F   +   + RVP      +       + F+PD K ++GE+PE++  ++     + G+  SGG GR +   I  G   LD+   DI RF   + +N  ++ +R  EA  K++ I Y  +E   GR++    ++ +L + G ++ +  G+ERP +F                  +Q K+ E+   R  +    TF      + +  E    RE+  I + S F K  F+  G +    + ++ + + +  VGSII+T M N  GG E D +   +                  +Y+ +   + Q     ++   + N L  K     + DV+     + I GP SR +L  ++DTD + +SFPF T K + + GL    R L ++  GE+G+ L+I  +YA  +Y+ + + G+   + +AGY A  +L IEK Y  W  DL    TPLE G  +  K     +F+GR+AL  Q + G+K+      L +      +   G E I R+G YVG   +  +G+  +K +  G+V   D       VT+ Y+ SG YE+E  G R+ A  N H   L
Sbjct:   79 TGASVAYHLGLRGWGGETLLVEQDRVGGELPWTACGLAGRFEPSYTELKLAEYSIDLIKRL-AENGLPTGWRPVGSLNLARSWDRMTAFNRMKSQALAWGMHCEILSPEQCAQHCELLSLDGIEGGLWIPEDGVCDPQLVCQAYMIEAQRLGVRIVEHCAIKKIHSEHG-----------KVRSVETTAGDVECEYFVNCTGFWAREVGTLSKPVVKVPLKAVEHHYLHTKPIEGLSPDTPFVRDFDGRIFFRECEGHILAGGFEREAKMVYEDGVIPLSQTARQHPPDWDHFHELLDALLLRVPSFRDATLDRLTNSLQVFSPDCKWILGEAPEIQNYYVAAGNKTMGVSASGGIGRVLTDLITKGSTYLDLHILDISRFLG-LHNNRKFLRDRCKEAPGKHFEINYPFEEFQTGRNLRMSPIYPQLKEAGAVFGQSMGYERPNYF-----------------DQQDKHDEFGLPRFRIAQTRTFGKPPWFDHVASEYRACRERIGIADYSSFTKYDFWSKGNEVVDLLQYLCSNDVDVAVGSIIHTGMQNPNGGYENDCSLARLSER---------------HYMMIAPTIQQTRSMCWIRKHMPNHLRAK---VNVADVTSMYTAICILGPYSRILLSELTDTDLTPKSFPFFTYKELDV-GLADGIRVLNITHTGELGYVLYIPNEYALHVYSRLYQAGQKFNIQHAGYYATRALRIEKFYAFWGQDLDTFTTPLECGRSWRVKFNKPIDFIGRNALLKQREEGVKRMYVQLLLNDHDHEVDMWCWGGEPIYRDGVYVGMTTTTGYGYTFEKQVCLGFVRNFDDEGRELPVTNEYVLSGHYEVEVAGVRFEAKVNLHSPNL 894          
BLAST of Sarcosine dehydrogenase vs. Ensembl Fly
Match: CG6415 (gene:FBgn0032287 transcript:FBtr0080108)

HSP 1 Score: 73.9442 bits (180), Expect = 2.326e-13
Identity = 83/346 (23.99%), Postives = 147/346 (42.49%), Query Frame = 1
Query: 1663 GDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANS-NKPVGSIIYTCMCNEFGGTEADLTYTEIDTS----LPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVN-AGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGF--TCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLE--------AIVRNGEYVGFLRSADFGHYIDKAIGYGYVG 2649
            G Y      +   I    L+TR+  +IF++S+  +  + G D    ++ + TA+    P GS   T   NE GG   DL   ++       + N  +   D+          G +   V +F +   + K  + + +    D  L+++QGP+  + L  +     S +   F +  +  + G+P  R  R  + GE G E+ +A   A+ +  S+++     GV+  AG  A DSL +E G   + +D+    TP+EA L +  T + +T  +F G   +  Q K G+ ++         +Q+ G +        AI   G+ VG + S        + I  GYV 
Sbjct:   45 GGYALPVQYSDQSIIASHLHTRQVGSIFDVSHMLQSRIFGKDAAACLESVCTADILGTPEGSGSLTVFTNEAGGILDDLIVNKVSEKELYVVSNAAMKEQDM----------GIMKTAVDNFKS---QGKDVSIEFL-TPADQSLVAVQGPQVAKELSKLLTGKASLDQLYFMSSFVTTLAGIPNVRITRCGYTGEDGVEISVASSQAQKLTESLLE----SGVLKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTTRDFPGADVILGQLKEGVSRRRVG------LQMLGTKPPPARSGVAIFSQGQQVGQVTSGCPSPSAGRNIAMGYVA 366          
BLAST of Sarcosine dehydrogenase vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 502/894 (56.15%), Postives = 658/894 (73.60%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKS-LESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC-NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y + S    +  VPY+ T K++   +   K LPKSADVV+IGGG  GC  LYHL KLG+TN VL+E   +TAGTTWHT+GL+W LRPSDTE++LL+++  ++ S L+ ETG+ TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN KD++G LY P DG +DPAG C+ L + AT  GA + +   V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+  + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAFSLF+LDW+VF  +I GA+NRVP LE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+N+ WI ERSHE+YAKNYS+++  DEPLA R+M KD     L + GC++QER G+ERPGWF  +    +L YD+YG+Y   ++  Y+Y  +L  +YTF+F  +H+VI  ECL  R   A+F+MSYFGKFYL+GPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++ S P+     P+  G  YYLA+GG V Q+  S I ++L+++ F C LID ++DM ++SIQGPKSR++LQ + D++ SNE+FPFST +++   G   RA+RLSFVGEMGWELHI K+    +YN+++  G  +G+ NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLKT   F+GR+ALE Q   GL++++  F++ EK+ + GLEAI RNG  VG LR ++FG  IDK IGYGY+   DG  V+  ++ SGD+ +E+MG  Y A  H K+ FDPENKR+KG+Y
Sbjct:   29 YSSQSTHTKEKSVPYEKTLKHEDGLSGPTKPLPKSADVVVIGGGSLGCQTLYHLCKLGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSSELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLYVPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDD----LGVKR--VKAVQTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVNRVPALEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERSHESYAKNYSVVFPFDEPLASRNMRKDPFHQVLQEHGCVFQERHGWERPGWFNRDGAAPVLDYDYYGAYNVPKNTVYKYSRILSKEYTFDFPPHHDVIRDECLTCRNAVAVFDMSYFGKFYLSGPDAKKAADWLFTADVNKAPGSTVYTCMLNQRGGVESDLTVSRLEPS-PSHLPLTPEFNGDAYYLAIGGGVAQHNWSHIQSVLQDQGFRCTLIDHTEDMGMISIQGPKSRELLQEVLDSELSNEAFPFSTHRIVSAAGHQVRAMRLSFVGEMGWELHIPKESCLPVYNAVMAAGAKYGICNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKTSIPFMGRTALEAQKAEGLRRRIVCFTVDEKVPMFGLEAIFRNGVPVGHLRRSEFGFAIDKTIGYGYIRNPDGGVVSPDFVRSGDFTLERMGVTYKATAHLKSPFDPENKRVKGIY 915          
BLAST of Sarcosine dehydrogenase vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 502/894 (56.15%), Postives = 658/894 (73.60%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKS-LESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC-NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y + S    +  VPY+ T K++   +   K LPKSADVV+IGGG  GC  LYHL KLG+TN VL+E   +TAGTTWHT+GL+W LRPSDTE++LL+++  ++ S L+ ETG+ TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN KD++G LY P DG +DPAG C+ L + AT  GA + +   V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+  + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAFSLF+LDW+VF  +I GA+NRVP LE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+N+ WI ERSHE+YAKNYS+++  DEPLA R+M KD     L + GC++QER G+ERPGWF  +    +L YD+YG+Y   ++  Y+Y  +L  +YTF+F  +H+VI  ECL  R   A+F+MSYFGKFYL+GPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++ S P+     P+  G  YYLA+GG V Q+  S I ++L+++ F C LID ++DM ++SIQGPKSR++LQ + D++ SNE+FPFST +++   G   RA+RLSFVGEMGWELHI K+    +YN+++  G  +G+ NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLKT   F+GR+ALE Q   GL++++  F++ EK+ + GLEAI RNG  VG LR ++FG  IDK IGYGY+   DG  V+  ++ SGD+ +E+MG  Y A  H K+ FDPENKR+KG+Y
Sbjct:   29 YSSQSTHTKEKSVPYEKTLKHEDGLSGPTKPLPKSADVVVIGGGSLGCQTLYHLCKLGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSSELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLYVPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDD----LGVKR--VKAVQTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVNRVPALEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERSHESYAKNYSVVFPFDEPLASRNMRKDPFHQVLQEHGCVFQERHGWERPGWFNRDGAAPVLDYDYYGAYNVPKNTVYKYSRILSKEYTFDFPPHHDVIRDECLTCRNAVAVFDMSYFGKFYLSGPDAKKAADWLFTADVNKAPGSTVYTCMLNQRGGVESDLTVSRLEPS-PSHLPLTPEFNGDAYYLAIGGGVAQHNWSHIQSVLQDQGFRCTLIDHTEDMGMISIQGPKSRELLQEVLDSELSNEAFPFSTHRIVSAAGHQVRAMRLSFVGEMGWELHIPKESCLPVYNAVMAAGAKYGICNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKTSIPFMGRTALEAQKAEGLRRRIVCFTVDEKVPMFGLEAIFRNGVPVGHLRRSEFGFAIDKTIGYGYIRNPDGGVVSPDFVRSGDFTLERMGVTYKATAHLKSPFDPENKRVKGIY 915          
BLAST of Sarcosine dehydrogenase vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 502/894 (56.15%), Postives = 658/894 (73.60%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKS-LESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC-NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y + S    +  VPY+ T K++   +   K LPKSADVV+IGGG  GC  LYHL KLG+TN VL+E   +TAGTTWHT+GL+W LRPSDTE++LL+++  ++ S L+ ETG+ TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN KD++G LY P DG +DPAG C+ L + AT  GA + +   V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+  + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAFSLF+LDW+VF  +I GA+NRVP LE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+N+ WI ERSHE+YAKNYS+++  DEPLA R+M KD     L + GC++QER G+ERPGWF  +    +L YD+YG+Y   ++  Y+Y  +L  +YTF+F  +H+VI  ECL  R   A+F+MSYFGKFYL+GPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++ S P+     P+  G  YYLA+GG V Q+  S I ++L+++ F C LID ++DM ++SIQGPKSR++LQ + D++ SNE+FPFST +++   G   RA+RLSFVGEMGWELHI K+    +YN+++  G  +G+ NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLKT   F+GR+ALE Q   GL++++  F++ EK+ + GLEAI RNG  VG LR ++FG  IDK IGYGY+   DG  V+  ++ SGD+ +E+MG  Y A  H K+ FDPENKR+KG+Y
Sbjct:   29 YSSQSTHTKEKSVPYEKTLKHEDGLSGPTKPLPKSADVVVIGGGSLGCQTLYHLCKLGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSSELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLYVPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDD----LGVKR--VKAVQTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVNRVPALEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERSHESYAKNYSVVFPFDEPLASRNMRKDPFHQVLQEHGCVFQERHGWERPGWFNRDGAAPVLDYDYYGAYNVPKNTVYKYSRILSKEYTFDFPPHHDVIRDECLTCRNAVAVFDMSYFGKFYLSGPDAKKAADWLFTADVNKAPGSTVYTCMLNQRGGVESDLTVSRLEPS-PSHLPLTPEFNGDAYYLAIGGGVAQHNWSHIQSVLQDQGFRCTLIDHTEDMGMISIQGPKSRELLQEVLDSELSNEAFPFSTHRIVSAAGHQVRAMRLSFVGEMGWELHIPKESCLPVYNAVMAAGAKYGICNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKTSIPFMGRTALEAQKAEGLRRRIVCFTVDEKVPMFGLEAIFRNGVPVGHLRRSEFGFAIDKTIGYGYIRNPDGGVVSPDFVRSGDFTLERMGVTYKATAHLKSPFDPENKRVKGIY 915          
BLAST of Sarcosine dehydrogenase vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 502/894 (56.15%), Postives = 658/894 (73.60%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKS-LESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC-NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y + S    +  VPY+ T K++   +   K LPKSADVV+IGGG  GC  LYHL KLG+TN VL+E   +TAGTTWHT+GL+W LRPSDTE++LL+++  ++ S L+ ETG+ TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN KD++G LY P DG +DPAG C+ L + AT  GA + +   V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+  + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAFSLF+LDW+VF  +I GA+NRVP LE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+N+ WI ERSHE+YAKNYS+++  DEPLA R+M KD     L + GC++QER G+ERPGWF  +    +L YD+YG+Y   ++  Y+Y  +L  +YTF+F  +H+VI  ECL  R   A+F+MSYFGKFYL+GPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++ S P+     P+  G  YYLA+GG V Q+  S I ++L+++ F C LID ++DM ++SIQGPKSR++LQ + D++ SNE+FPFST +++   G   RA+RLSFVGEMGWELHI K+    +YN+++  G  +G+ NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLKT   F+GR+ALE Q   GL++++  F++ EK+ + GLEAI RNG  VG LR ++FG  IDK IGYGY+   DG  V+  ++ SGD+ +E+MG  Y A  H K+ FDPENKR+KG+Y
Sbjct:   29 YSSQSTHTKEKSVPYEKTLKHEDGLSGPTKPLPKSADVVVIGGGSLGCQTLYHLCKLGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSSELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLYVPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDD----LGVKR--VKAVQTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVNRVPALEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERSHESYAKNYSVVFPFDEPLASRNMRKDPFHQVLQEHGCVFQERHGWERPGWFNRDGAAPVLDYDYYGAYNVPKNTVYKYSRILSKEYTFDFPPHHDVIRDECLTCRNAVAVFDMSYFGKFYLSGPDAKKAADWLFTADVNKAPGSTVYTCMLNQRGGVESDLTVSRLEPS-PSHLPLTPEFNGDAYYLAIGGGVAQHNWSHIQSVLQDQGFRCTLIDHTEDMGMISIQGPKSRELLQEVLDSELSNEAFPFSTHRIVSAAGHQVRAMRLSFVGEMGWELHIPKESCLPVYNAVMAAGAKYGICNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKTSIPFMGRTALEAQKAEGLRRRIVCFTVDEKVPMFGLEAIFRNGVPVGHLRRSEFGFAIDKTIGYGYIRNPDGGVVSPDFVRSGDFTLERMGVTYKATAHLKSPFDPENKRVKGIY 915          
BLAST of Sarcosine dehydrogenase vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 491/893 (54.98%), Postives = 643/893 (72.00%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKS-LESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y + S    +  VPY+ T K++   +   K LPKSADVV+IGGG  GC  LYHL KLG+TN VL+E   +TAGTTWHT+GL+W LRPSDTE++LL+++  ++ S L+ ETG+ TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN KD++G LY P DG +DPAG C+ L + AT  GA + +   V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+  + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAFSLF+LDW+VF  +I GA+NRVP LE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+N+ WI ERSHE+YAKNYS+++  DEPLA R+M KD      +     +Q  Q              +L YD+YG+Y   ++  Y+Y  +L  +YTF+F  +H+VI  ECL  R   A+F+MSYFGKFYL+GPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++ S P      P+  G  YYLA+GG V Q+  S I ++L+++ F C LID ++DM ++SIQGPKSR++LQ + D++ SNE+FPFST +++   G   RA+RLSFVGEMGWELHI K+    +YN+++  G  +G+ NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLKT   F+GR+ALE Q   GL++++  F++ EK+ + GLEAI RNG  VG LR ++FG  IDK IGYGY+   DG  V+  ++ SGD+ +E+MG  Y A  H K+ FDPENKR+KG+Y
Sbjct:   29 YSSQSTHTKEKSVPYEKTLKHEDGLSGPTKPLPKSADVVVIGGGSLGCQTLYHLCKLGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSSELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLYVPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDD----LGVKR--VKAVQTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVNRVPALEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERSHESYAKNYSVVFPFDEPLASRNMRKDPFHQ--VHPHFTFQYYQ-------------IVLDYDYYGAYNVPKNTVYKYSGILSKEYTFDFPPHHDVIRDECLTCRNAVAVFDMSYFGKFYLSGPDAKKAADWLFTADVNKAPGSTVYTCMLNQRGGVESDLTVSRLEPS-PAHLPLTPESNGDAYYLAIGGGVAQHNWSHIQSVLQDQGFRCTLIDHTEDMGMISIQGPKSRELLQEVLDSELSNEAFPFSTHRIVSAAGHQVRAMRLSFVGEMGWELHIPKESCLPVYNAVMAAGAKYGICNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKTSIPFMGRTALEAQKAEGLRRRIVCFTVDEKVPMFGLEAIFRNGVPVGHLRRSEFGFAIDKTIGYGYIRNPDGGVVSPDFVRSGDFTLERMGVTYKATAHLKSPFDPENKRVKGIY 899          
BLAST of Sarcosine dehydrogenase vs. Ensembl Xenopus
Match: SARDH (sarcosine dehydrogenase [Source:NCBI gene;Acc:100492087])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 399/760 (52.50%), Postives = 518/760 (68.16%), Query Frame = 1
Query:  532 LGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQ----GFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHN--PDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            LGK++ +        E+  L+PLMN  D++G LY P DG +DPAG C+ L + ++  GA++ +   V  + V  +      G +R  V +V T  G+++T CVV  AG W+P + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVP LE+TGIKSTVCGPESFT DHKPL+GESPEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+++ WI ERSHE+YAKNYS+++ +DEPLAGR+M KD L  E+L    ++ +      GF  P         L P  F  S  + +                     H  I +ECL  R +AA+FNMSYFGKFYL GPD KKA +W+FTA+ NKP G+ +YTC+ N+ GG E+DL  + ++   P  G  +  P   G  YYLA+GGAV Q+  S I+ +L++++F+CKL+D S+D  ++SIQGP SR ILQ + D D SNE+FPFST KL+   G   RA+RLSFVGEMGWELH+ ++    +Y +++  G  HG+ NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GLKK+L  F+L EK+ L GLEAI RNG  VG +R AD+G  I+K I YGY+   +G  V+  ++ SG+Y++E+MG  Y A  H K+ FDP N R+KG Y
Sbjct:  186 LGKVYGV--------ESYDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLARASSARGAQVIENCPVTGIRVKTDD----LGVRR--VVAVETQHGTVETPCVVNCAGAWAPKLGQMAGVNVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYESNPIFWEKVSDKFAFGLFDLDWDVFIQHIQGAINRVPALEQTGIKSTVCGPESFTADHKPLLGESPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHRSLTNHNRWIRERSHESYAKNYSVVFAYDEPLAGRNMRKDPL-HEVLNVIPLHNDLASHLGGFTSP---------LTPISFSNSLFRPRRLLLALLTCC-----------HFQIRRECLMCRNQAAVFNMSYFGKFYLLGPDAKKAANWLFTADINKPPGTTVYTCILNKQGGAESDLAVSCLE---PGTGGSDLAPQFEGEGYYLAIGGAVAQHNWSHISTVLQDEKFDCKLVDSSEDQGMISIQGPASRTILQEVLDEDLSNEAFPFSTHKLVTAAGFTVRAIRLSFVGEMGWELHMPREACVPVYKAVMAAGAKHGMGNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSAIPFLGRGALERQKALGLKKRLVCFTLSEKVPLFGLEAIWRNGIAVGHVRRADYGFTINKTIAYGYIRNPEGG-VSPDFVRSGEYKLERMGIAYPAEAHLKSPFDPNNMRVKGFY 906          
BLAST of Sarcosine dehydrogenase vs. Ensembl Xenopus
Match: SARDH (sarcosine dehydrogenase [Source:NCBI gene;Acc:100492087])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 381/762 (50.00%), Postives = 490/762 (64.30%), Query Frame = 1
Query:  532 LGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGC--------MYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            LGK++ +        E+  L+PLMN  D++G LY P DG +DPAG C+ L + ++  GA++ +   V  + V  +      G +R  V +V T  G+++T CVV  AG W+P + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVP LE+TGIKSTVCGPESFT DHKPL+GESPEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+++ WI ERSHE+YAKNYS+++ +DEPLAGR+M KD L + L  QG         +     GF  P         L P  F  S  + +                     H  I +ECL  R +AA+FNMSYFGKFYL GPD KKA +W+FTA+ NKP G++                          NK    P+L                    I+ +L++++F+CKL+D S+D  ++SIQGP SR ILQ + D D SNE+FPFST KL+   G   RA+RLSFVGEMGWELH+ ++    +Y +++  G  HG+ NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GLKK+L  F+L EK+ L GLEAI RNG  VG +R AD+G  I+K I YGY+   +G  V+  ++ SG+Y++E+MG  Y A  H K+ FDP N R+KG Y
Sbjct:  169 LGKVYGV--------ESYDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLARASSARGAQVIENCPVTGIRVKTDD----LGVRR--VVAVETQHGTVETPCVVNCAGAWAPKLGQMAGVNVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYESNPIFWEKVSDKFAFGLFDLDWDVFIQHIQGAINRVPALEQTGIKSTVCGPESFTADHKPLLGESPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHRSLTNHNRWIRERSHESYAKNYSVVFAYDEPLAGRNMRKDPLHEVLNGQGVTVIPLHNDLASHLGGFTSP---------LTPISFSNSLFRPRRLLLALLTCC-----------HFQIRRECLMCRNQAAVFNMSYFGKFYLLGPDAKKAANWLFTADINKPPGNL--------------------------NKQRTEPNL-----------------PFHISTVLQDEKFDCKLVDSSEDQGMISIQGPASRTILQEVLDEDLSNEAFPFSTHKLVTAAGFTVRAIRLSFVGEMGWELHMPREACVPVYKAVMAAGAKHGMGNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSAIPFLGRGALERQKALGLKKRLVCFTLSEKVPLFGLEAIWRNGIAVGHVRRADYGFTINKTIAYGYIRNPEGGAVSPDFVRSGEYKLERMGIAYPAEAHLKSPFDPNNMRVKGFY 853          
BLAST of Sarcosine dehydrogenase vs. Ensembl Xenopus
Match: SARDH (sarcosine dehydrogenase [Source:NCBI gene;Acc:100492087])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 382/754 (50.66%), Postives = 493/754 (65.38%), Query Frame = 1
Query:  532 LGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            LGK++ +        E+  L+PLMN  D++G LY P DG +DPAG C+ L + ++  GA++ +   V  + V  +      G +R  V +V T  G+++T CVV  AG W+P + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVP LE+TGIKSTVCGPESFT DHKPL+GESPEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+++ WI ERSHE+YAKNYS+++ +DEPLAGR+M KD L + L     +          G F  T P L P  F  S  + +                     H  I +ECL  R +AA+FNMSYFGKFYL GPD KKA +W+FTA+ NKP G++      N+  G+        I  + PN   H                        I+ +L++++F+CKL+D S+D  ++SIQGP SR ILQ + D D SNE+FPFST KL+   G   RA+RLSFVGEMGWELH+ ++    +Y +++  G  HG+ NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GLKK+L  F+L EK+ L GLEAI RNG  VG +R AD+G  I+K I YGY+   +G  V+  ++ SG+Y++E+MG  Y A  H K+ FDP N R+KG Y
Sbjct:  128 LGKVYGV--------ESYDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLARASSARGAQVIENCPVTGIRVKTDD----LGVRR--VVAVETQHGTVETPCVVNCAGAWAPKLGQMAGVNVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYESNPIFWEKVSDKFAFGLFDLDWDVFIQHIQGAINRVPALEQTGIKSTVCGPESFTADHKPLLGESPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHRSLTNHNRWIRERSHESYAKNYSVVFAYDEPLAGRNMRKDPLHEVLNGVTVIPLHNDLASHLGGF--TSP-LTPISFSNSLFRPRRLLLALLTCC-----------HFQIRRECLMCRNQAAVFNMSYFGKFYLLGPDAKKAANWLFTADINKPPGNL------NKQRGS--------IFRTEPNLPFH------------------------ISTVLQDEKFDCKLVDSSEDQGMISIQGPASRTILQEVLDEDLSNEAFPFSTHKLVTAAGFTVRAIRLSFVGEMGWELHMPREACVPVYKAVMAAGAKHGMGNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSAIPFLGRGALERQKALGLKKRLVCFTLSEKVPLFGLEAIWRNGIAVGHVRRADYGFTINKTIAYGYIRNPEGGAVSPDFVRSGEYKLERMGIAYPAEAHLKSPFDPNNMRVKGFY 815          
BLAST of Sarcosine dehydrogenase vs. Ensembl Xenopus
Match: SARDH (sarcosine dehydrogenase [Source:NCBI gene;Acc:100492087])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 283/558 (50.72%), Postives = 372/558 (66.67%), Query Frame = 1
Query:  532 LGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHN--PDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGL 2196
            LGK++ +        E+  L+PLMN  D++G LY P DG +DPAG C+ L + ++  GA++ +   V  + V  +      G +R  V +V T  G+++T CVV  AG W+P + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVP LE+TGIKSTVCGPESFT DHKPL+GESPEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+++ WI ERSHE+YAKNYS+++ +DEPLAGR+M KD L + L     +          G F  T P L P  F  S  + +                     H  I +ECL  R +AA+FNMSYFGKFYL GPD KKA +W+FTA+ NKP G+ +YTC+ N+ GG E+DL  + ++   P  G  +  P   G  YYLA+GGAV Q+  S I+ +L++++F+CKL+D S+D  ++SIQGP SR ILQ + D D SNE+FPFST KL+   G 
Sbjct:  123 LGKVYGV--------ESYDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLARASSARGAQVIENCPVTGIRVKTDD----LGVRR--VVAVETQHGTVETPCVVNCAGAWAPKLGQMAGVNVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYESNPIFWEKVSDKFAFGLFDLDWDVFIQHIQGAINRVPALEQTGIKSTVCGPESFTADHKPLLGESPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHRSLTNHNRWIRERSHESYAKNYSVVFAYDEPLAGRNMRKDPLHEVLNGVTVIPLHNDLASHLGGF--TSP-LTPISFSNSLFRPRRLLLALLTCC-----------HFQIRRECLMCRNQAAVFNMSYFGKFYLLGPDAKKAANWLFTADINKPPGTTVYTCILNKQGGAESDLAVSCLE---PGTGGSDLAPQFEGEGYYLAIGGAVAQHNWSHISTVLQDEKFDCKLVDSSEDQGMISIQGPASRTILQEVLDEDLSNEAFPFSTHKLVTAAGF 649          
BLAST of Sarcosine dehydrogenase vs. Ensembl Xenopus
Match: stil (STIL, centriolar assembly protein [Source:Xenbase;Acc:XB-GENE-975750])

HSP 1 Score: 356.295 bits (913), Expect = 9.193e-108
Identity = 256/901 (28.41%), Postives = 427/901 (47.39%), Query Frame = 1
Query:  112 QYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQ----NMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIF-----W---DPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXX-XXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKR 2775
             +  A  ++ A   +  KNT + +       K    +A+ VIIGGG  G S  YHLAK G+ + VL+E S +TAG+TWH +GL  +  P     ++  YS +L + LE ETG   G+ Q G + +AST  R++E +   T          ++ P + ++LFPL+N   +   LY+P DG IDP     AL  GA   GA+L    +V  +    N T             V+T  G+I  N +V +AG W+  + K  G+  PL  + H YV++  +  ++     +P +RD + S YLR + D +  G YE          W      P F   LFE D +    ++  A++ VPVL    I + V GP +++PD  P++G    V+  ++   +   G++ +GG G+ ++ WI  G P  D+   D  R+    T  +  +  R  E+Y  N  + Y  +E  AGR   +     E L+  C      G+E+P WF        P D  G     +  N+                    + +E     EK  + +++ FGKF + G D+   +D +F AN+   VG    + +    G   A+LT ++              L+   + L  G     +   +I  +    ++N  + +V+ ++ +L I GP +R++LQ ++  D  N SF F   + + I G+P  A+R+S+ GE+GWEL+  +    ++Y ++++ G+  G+ N G  A+++L +EKG+R W A++  D  PLEAGL +  KL    +F+G+ AL    + GL++KL  L    + +   G E++  NG+ VG   S  + +  ++++ + YV  ++ ST           E+E +G +Y A   Q+ L   E  R
Sbjct:   24 HFQNAFISSEACHTLTRKNTDQKEKQSAFLGKRWKDTAETVIIGGGCIGVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYYSIKLYERLEEETGQAVGFHQPGSIRIASTPTRVDELKHQMTRAHWHPTPQYLVEPEKVQELFPLLNMNKVLAGLYNPGDGHIDPYSLTMALAAGARKYGAQLYYPAEVTGLIPQPNGT-----------WDVVTAHGTIHANRIVNAAGFWAREVGKLIGLPHPLIPVHHQYVVTATVPEVKALNRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQDSWVTDGVPPGFGKELFESDLDRIMDHVEAAMDMVPVLRNADIINIVSGPITYSPDILPMVGPHQGVQNYWVAIGFGY-GIIHAGGIGKFLSDWIMSGEPPFDLIELDPNRYGRWTTTQYTALKAR--ESYGFNNIVGYPKEERFAGRPTERTSGLYEELKTKCSMGFHAGWEQPHWFYK------PGDDTGYKPSFRRTNW-----------------FEPVRREYKQVMEKVGVIDLTPFGKFTVKGKDSIHLLDHLF-ANTIPKVGFTNISHILTPRGRVYAELTVSQ--------------LSPGEFLLITGSGSELHDLRWIEEVTVRGKYNTDIANVTDEIGVLGIAGPLARKVLQKLTPDDLGNTSFKFLQSRKLNIAGIPVTAIRISYTGELGWELYHKRQDTSALYRALMQAGQEEGIDNFGTYAMNALRLEKGFRAWGAEMNCDTNPLEAGLQYFIKLNKPADFIGKQALTKIKEKGLQRKLVYLTLNTDNVDPEGNESVWHNGKVVGNTTSGTYSYSTNQSLAFAYV-PVELSTTGQ------KLEVELLGNKYPATVIQEPLVLTEPTR 865          
BLAST of Sarcosine dehydrogenase vs. Ensembl Mouse
Match: Sardh (sarcosine dehydrogenase [Source:MGI Symbol;Acc:MGI:2183102])

HSP 1 Score: 1051.58 bits (2718), Expect = 0.000e+0
Identity = 503/893 (56.33%), Postives = 661/893 (74.02%), Query Frame = 1
Query:  136 TNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWF-CNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            T  KS VPY+ T K +           ++ LP +A+VV+IGGG  GC  LYHLAKLGV   VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++ +++ + LE ETG++TG+IQNGGLF+AS ++RLNEY+RL +LGK + I S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A   GA++ +   V  + V  +     FG +R  V +V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM++YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QERQG+ERPGWF      ++L YD+YG+Y  + HK+Y Y  +L  +YTF+F  +H++I KECL  R  AA+FNMSYFGKFYL G D +KA DW+F+A+ N+P GS +YTCM N+ GGTE+DLT + +        +  P   G  YYLAVGGAV Q+  S IN +L++++F C+L+D S+D+ +LSIQGP SR ILQ + D D SNE+FPFST +L++  G   RA+RLSFVGE+GWELH+ +     +Y +++  G  HG+VNAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLKT   FLGR ALE Q   GL+++L   +++E++ + GLEAI RNG+ VG +R ADFG  ++K I YGY+    G  V+  ++++G+Y +E+MG  Y+A  H K+ FDP+NKR+KG+Y
Sbjct:   35 TTEKS-VPYQRTLKEEAQGASVVPQGPSQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIESHVLSPAETKSLYPLMNVDDLYGTLYVPQDGTMDPAGTCTTLTRAAVARGAQVIENCAVTGIRVRTDD----FGVRR--VAAVETEHGSIQTPCVVNCAGVWASKVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWDVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIVHGRPEKDMYSYDIRRFHHSLTDHTRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERQGWERPGWFNPQETAQVLDYDYYGAYGNQAHKDYTYSRLLGDEYTFDFPPHHHMIQKECLACRGAAAVFNMSYFGKFYLLGVDARKAADWLFSADVNRPPGSTVYTCMLNQRGGTESDLTVSRLAPGTQASPL-VPAFEGDCYYLAVGGAVAQHNWSHINTVLQDQEFRCQLMDSSEDLGMLSIQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAGHLVRAIRLSFVGELGWELHVPRASCLPVYRAVMAAGARHGLVNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKTSVPFLGREALEKQRATGLRRRLICLTVEEEVPMFGLEAIWRNGQVVGHVRRADFGFTVNKTIAYGYIRDPSGGPVSLDFVKNGEYALERMGVTYAAQVHLKSPFDPDNKRVKGIY 919          
BLAST of Sarcosine dehydrogenase vs. Ensembl Mouse
Match: Pdpr (pyruvate dehydrogenase phosphatase regulatory subunit [Source:MGI Symbol;Acc:MGI:2442188])

HSP 1 Score: 354.755 bits (909), Expect = 2.724e-107
Identity = 265/864 (30.67%), Postives = 429/864 (49.65%), Query Frame = 1
Query:  208 SLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPL--IAKTAGVKVPLCTLKHAYVISERIEGI--QNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYL--TGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKI---NGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGL-----EAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRL-----DGSTVTSGYLESGDYEIEKMGKRYSAN 2736
            +LP  A VVI GGG+ G S  YHL+K+G  + VL+E   + AG+T   +G++   R S  E ++ +YS +L   LE ETG+ TGY++ G + +A T++RL   +R+ +   +  I SEI+ P +  +L PL+N  D+ G +Y P D V+  A    AL   A+  G ++ D   VL+V + K            +VT V T+ G I+    V  AG W+    ++    + +PL   +H Y+++   +     N P + D D  +Y+R     +  GG+E  P PIF + K          DW+ F   +   + R+P LE   I   V  PE+FTPD K +MGESP V+G F+    NSAG+ L GG G+ +A W+ +G PS +++  D++RF   +  +  ++  R  E     Y +     +   GR +    L+D L  QG  + E+ GFERP +F     +LL                     LE   TF      +++  E    +E   + +MS F KF +  TG +  +++ ++F  + + PVG I++T M NE+GG E D +                 LT  ++++        +  +++N  L  K  N  L DV+     L++ GP++  +L  +S    + + FP    K + +   NG+  R + ++  GE G+ L+I  +YA  +YN ++ VG+ +G+ NAGY A+ SL IEK +  W  DL    TPLE G     KL+   +F+GR AL  Q + G+ K+L++F L +      L     E I RNG+Y G   S+ + + +++ +  GYV        +   VT+ ++  G+YEI+  G R+ A 
Sbjct:   37 ALPAQAQVVICGGGIMGTSVAYHLSKMGWQDIVLLEQGRLAAGSTRFCAGILSTARHSSVEQKMANYSNKLYHQLEQETGIQTGYLRTGSISLAQTQDRLISLKRINSRLNVVGIPSEIISPKKVAELHPLLNVHDLVGAMYVPEDAVVSSADVALALASAASQNGVQIYDRTSVLHVLIKKG-----------QVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPLSIPLHACEHFYLLTRPWDTPLQSNTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLREDWDHFEPLLSSLLRRMPALETLEILKLVNCPETFTPDMKCIMGESPVVQGYFVLAGMNSAGLSLGGGAGKFLAEWMVYGYPSENVWELDLQRFGA-LQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPNKDLL--------------------ALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDEALESLQYLFCNDLDVPVGHIVHTGMLNEYGGYENDCSIAR--------------LTKRSFFMISPTDQQVHCWAWLNKYL-PKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPTLFCKEMSVGYANGI--RVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLNTLTTPLECGGESRVKLEKGIDFIGRDALLQQKQTGVYKRLAMFILDDHDTDLDLWPWWGEPIYRNGKYAGKTTSSAYSYTLERHVCLGYVHNFSEDSGEEQVVTTDFINRGEYEIDIAGHRFQAK 851          
BLAST of Sarcosine dehydrogenase vs. Ensembl Mouse
Match: Dmgdh (dimethylglycine dehydrogenase precursor [Source:MGI Symbol;Acc:MGI:1921379])

HSP 1 Score: 347.436 bits (890), Expect = 9.968e-105
Identity = 250/897 (27.87%), Postives = 424/897 (47.27%), Query Frame = 1
Query:  142 AKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGC---SALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVT-SVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQ----NMPNVRDHDSSVYLRLQGDAMGIGGYEPHP--------IFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXX-XXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIK 2781
            A  G P + +        +S  S P+  D         GC   S  YHLAK G+ + VL+E S +TAG+TWH +GL  +  P     ++   S +L + LE ETG   G+ Q G + +A+T  R++E++   T          I+ P +  +LFPL+N   I   LY+P DG IDP     AL  GA   GA L     V ++            + RP+ T  V T  GS++ N +V +AG W+  + K  G+  PL  ++H YV++  I  ++     +P +RD + S YLR + D +  G YE           +     P F   LFE D +    ++  A+  +PVL+K  I + V GP +++PD  P++G    V+  ++   +   G++ +GG G+ ++ WI HG P  D+   D  R+ +  T  +     ++ E+Y  N  + Y  +E  AGR   +     + L+  C      G+E+P WF   KP                ++ +YR       +F  +     +G E     ++  + ++S FGKF + G D+ + +D +F AN    VG    + M    G   A+LT ++           +P      + L  G     +   +I        ++ ++ +++ +  +L + GP +R++LQ ++  D S+++F F   K   I+ +P  A+R+S+ GE+GWEL+  ++ + ++Y  I+  G+  G+ + G  A+++L +EK +R W +++  D  PLEAGL +  KL    +F+G+ AL+     GLK++L  L    + +   G E+I   G+ VG   S  + + I K++ + YV  +  S V          E+E +GK Y A   Q+ L   E  R +
Sbjct:   13 ALRGSPRRPSSAGLREGQESPASPPEWKDRAETVIIGGGCVGVSLAYHLAKAGMRDVVLMEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYERLEEETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTNWHATEQYIIEPEKIHELFPLLNMNKILAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSL------------KPRPDGTWDVETPQGSVRANRIVNAAGFWAREVGKMIGLDHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVTHGVPPGFGKELFESDLDRISDHLEAAMEMIPVLKKADIINVVNGPITYSPDILPMVGPHQGVRNYWVATGFGY-GIIHAGGVGKFLSDWILHGEPPFDLIELDPNRYGKWTTTQY--TEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYKTLKSKCSMGFHAGWEQPHWFY--KP---------------GQDTQYRP------SFRRTNWFEPVGSEYKQVMQRVGVIDLSPFGKFNIKGRDSTQLLDHLF-ANVIPKVGFTNISHMLTPRGRVYAELTVSQ----------QSPG----EFLLITGSGSELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSEDLSDDAFKFLQTKSFNISDIPVTAIRISYTGELGWELYHRREDSATLYERIMSAGQEEGIGDFGTYALNALRLEKAFRAWGSEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKTEGLKRRLVCLTVATDDVDPEGNESIWYKGKVVGNTTSGSYSYSIQKSLAFAYV-PVQLSEVGQ------QVEVELLGKNYPATIIQEPLVLTEPARAR 849          
BLAST of Sarcosine dehydrogenase vs. Ensembl Mouse
Match: Pdpr (pyruvate dehydrogenase phosphatase regulatory subunit [Source:MGI Symbol;Acc:MGI:2442188])

HSP 1 Score: 261.922 bits (668), Expect = 2.850e-75
Identity = 197/659 (29.89%), Postives = 320/659 (48.56%), Query Frame = 1
Query:  208 SLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPL--IAKTAGVKVPLCTLKHAYVISERIEGI--QNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYL--TGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFP 2160
            +LP  A VVI GGG+ G S  YHL+K+G  + VL+E   + AG+T   +G++   R S  E ++ +YS +L   LE ETG+ TGY++ G + +A T++RL   +R+ +   +  I SEI+ P +  +L PL+N  D+ G +Y P D V+  A    AL   A+  G ++ D   VL+V + K            +VT V T+ G I+    V  AG W+    ++    + +PL   +H Y+++   +     N P + D D  +Y+R     +  GG+E  P PIF + K          DW+ F   +   + R+P LE   I   V  PE+FTPD K +MGESP V+G F+    NSAG+ L GG G+ +A W+ +G PS +++  D++RF   +  +  ++  R  E     Y +     +   GR +    L+D L  QG  + E+ GFERP +F     +LL                     LE   TF      +++  E    +E   + +MS F KF +  TG +  +++ ++F  + + PVG I++T M NE+GG E D +                 LT  ++++        +  +++N  L  K  N  L DV+     L++ GP++  +L  +S    + + FP
Sbjct:   37 ALPAQAQVVICGGGIMGTSVAYHLSKMGWQDIVLLEQGRLAAGSTRFCAGILSTARHSSVEQKMANYSNKLYHQLEQETGIQTGYLRTGSISLAQTQDRLISLKRINSRLNVVGIPSEIISPKKVAELHPLLNVHDLVGAMYVPEDAVVSSADVALALASAASQNGVQIYDRTSVLHVLIKKG-----------QVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPLSIPLHACEHFYLLTRPWDTPLQSNTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLREDWDHFEPLLSSLLRRMPALETLEILKLVNCPETFTPDMKCIMGESPVVQGYFVLAGMNSAGLSLGGGAGKFLAEWMVYGYPSENVWELDLQRFGA-LQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPNKDLL--------------------ALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDEALESLQYLFCNDLDVPVGHIVHTGMLNEYGGYENDCSIAR--------------LTKRSFFMISPTDQQVHCWAWLNKYL-PKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFP 648          
BLAST of Sarcosine dehydrogenase vs. Ensembl Mouse
Match: Sardh (sarcosine dehydrogenase [Source:MGI Symbol;Acc:MGI:2183102])

HSP 1 Score: 170.629 bits (431), Expect = 6.928e-48
Identity = 89/169 (52.66%), Postives = 124/169 (73.37%), Query Frame = 1
Query:  136 TNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFG 624
            T  KS VPY+ T K +           ++ LP +A+VV+IGGG  GC  LYHLAKLGV   VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++ +++ + LE ETG++TG+IQNGGLF+AS ++RLNEY+RL +LGK + I S +L P+ETK L+PLMN  D++G
Sbjct:   35 TTEKS-VPYQRTLKEEAQGASVVPQGPSQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIESHVLSPAETKSLYPLMNVDDLYG 202          
BLAST of Sarcosine dehydrogenase vs. UniProt/SwissProt
Match: sp|Q99LB7|SARDH_MOUSE (Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1)

HSP 1 Score: 1051.58 bits (2718), Expect = 0.000e+0
Identity = 503/893 (56.33%), Postives = 661/893 (74.02%), Query Frame = 1
Query:  136 TNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWF-CNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            T  KS VPY+ T K +           ++ LP +A+VV+IGGG  GC  LYHLAKLGV   VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++ +++ + LE ETG++TG+IQNGGLF+AS ++RLNEY+RL +LGK + I S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A   GA++ +   V  + V  +     FG +R  V +V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM++YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QERQG+ERPGWF      ++L YD+YG+Y  + HK+Y Y  +L  +YTF+F  +H++I KECL  R  AA+FNMSYFGKFYL G D +KA DW+F+A+ N+P GS +YTCM N+ GGTE+DLT + +        +  P   G  YYLAVGGAV Q+  S IN +L++++F C+L+D S+D+ +LSIQGP SR ILQ + D D SNE+FPFST +L++  G   RA+RLSFVGE+GWELH+ +     +Y +++  G  HG+VNAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLKT   FLGR ALE Q   GL+++L   +++E++ + GLEAI RNG+ VG +R ADFG  ++K I YGY+    G  V+  ++++G+Y +E+MG  Y+A  H K+ FDP+NKR+KG+Y
Sbjct:   35 TTEKS-VPYQRTLKEEAQGASVVPQGPSQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIESHVLSPAETKSLYPLMNVDDLYGTLYVPQDGTMDPAGTCTTLTRAAVARGAQVIENCAVTGIRVRTDD----FGVRR--VAAVETEHGSIQTPCVVNCAGVWASKVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWDVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIVHGRPEKDMYSYDIRRFHHSLTDHTRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERQGWERPGWFNPQETAQVLDYDYYGAYGNQAHKDYTYSRLLGDEYTFDFPPHHHMIQKECLACRGAAAVFNMSYFGKFYLLGVDARKAADWLFSADVNRPPGSTVYTCMLNQRGGTESDLTVSRLAPGTQASPL-VPAFEGDCYYLAVGGAVAQHNWSHINTVLQDQEFRCQLMDSSEDLGMLSIQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAGHLVRAIRLSFVGELGWELHVPRASCLPVYRAVMAAGARHGLVNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKTSVPFLGREALEKQRATGLRRRLICLTVEEEVPMFGLEAIWRNGQVVGHVRRADFGFTVNKTIAYGYIRDPSGGPVSLDFVKNGEYALERMGVTYAAQVHLKSPFDPDNKRVKGIY 919          
BLAST of Sarcosine dehydrogenase vs. UniProt/SwissProt
Match: sp|Q64380|SARDH_RAT (Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2)

HSP 1 Score: 1049.27 bits (2712), Expect = 0.000e+0
Identity = 506/898 (56.35%), Postives = 660/898 (73.50%), Query Frame = 1
Query:  121 RALSATNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMK-SLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWF-CNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            R    T  KS VPY+ T K +           ++ LP +A+VV+IGGG  GC  LYHLAKLGV   VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++ +++   LE ETG++TG+IQNGGLF+AS ++RL+EY+RL +LGK + I S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A   GA++ +   V  + V  +     FG +R  VT+V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAF LF+LDW+VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM++YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QERQG+ERPGWF      ++L YD+YG+Y  + HK+Y Y  +L  +YTF+F  +H VI KECL  R  AA+FNMSYFGKFYL G D +KA DW+F+A+ N+P GS +YTCM N+ GGTE+DLT + +        +  P   G  YYLAVGGAV Q+  S IN +L++++F C+L+D S+D+ +LSIQGP SR ILQ + D D SNE+FPFST +L++  G   RA+RLSFVGE+GWELH+ +     +Y +++  G  HG+VNAGYRAIDSLSIEKGYRHWHADLR DD+PLEAGL FTCKLKT   FLGR ALE Q   GL+++L   +++E++ + GLEAI RNG+ VG +R ADFG  ++K I YGY+    G  V+  ++++GDY +E+MG  Y+A  H K+ FDP+NKR+KG+Y
Sbjct:   30 REARPTTEKS-VPYQCTLKEEAQGASVVPQGPSQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGVVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRQVVSHDLEEETGLHTGWIQNGGLFIASNQQRLDEYKRLMSLGKAYGIESHVLSPAETKDLYPLMNVDDLYGTLYVPRDGTMDPAGTCTTLTRAAVARGAQVIENCAVTGIRVRTDD----FGVRR--VTAVETQHGSIQTPCVVNCAGVWASSVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWDEVSDKFAFGLFDLDWDVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIVHGRPEKDMYSYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERQGWERPGWFNPQETAQVLDYDYYGAYGHQAHKDYAYSRLLGDEYTFDFPPHHCVIQKECLACRTAAAVFNMSYFGKFYLLGADARKAPDWLFSADVNRPPGSTVYTCMLNQRGGTESDLTVSCLAPGAQASPL-APAFEGDGYYLAVGGAVAQHNWSHINTVLQDQEFRCQLMDCSEDLGMLSIQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAGHLVRAIRLSFVGELGWELHVPQASCLPVYRAVMAAGAKHGLVNAGYRAIDSLSIEKGYRHWHADLRSDDSPLEAGLAFTCKLKTSVPFLGREALEKQRATGLRRRLVCLTVEEEVPMFGLEAIWRNGQVVGHVRRADFGFTVNKTIAYGYIRDPSGGPVSLDFVKNGDYALERMGVTYAAQVHLKSPFDPDNKRVKGIY 919          
BLAST of Sarcosine dehydrogenase vs. UniProt/SwissProt
Match: sp|Q9UL12|SARDH_HUMAN (Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 502/895 (56.09%), Postives = 653/895 (72.96%), Query Frame = 1
Query:  130 SATNAKSGVPYKNTHKNDGNQTK-----SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            +   A+  VPY+ T K +G  T       ++ LP +A+VV+IGGG  GC  LYHLAKLG++  VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++  ++ + LE ETG++TG+IQNGGLF+AS  +RL+EY+RL +LGK + + S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA++ +   V  + V  +     FG +R  V  V T  GSI+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW VF  +I GAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM  YDIRRF   +TD+  WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELL QGC++QER G+ERPGWF    P  +L YD+YG+Y    H++Y YR +L  +YTF F  +H+ I KECL  R  AA+F+MSYFGKFYL G D +KA DW+F+A+ ++P GS +YTCM N  GGTE+DLT + +  S     +  P   G  YYLA+GGAV Q+  S I  +L++++  C+LID S+D+ ++SIQGP SR ILQ + D D SNE+FPFST KL++  G   RA+RLSFVGE+GWELHI K     +Y +++  G  HG++NAGYRAIDSLSIEKGYRHWHADLRPDD+PLEAGL FTCKLK+   FLGR ALE Q   GL+++L  F++++K+ + GLEAI RNG+ VG +R ADFG  IDK I YGY+    G  V+  +++SGDY +E+MG  Y A  H K+ FDP NKR+KG+Y
Sbjct:   32 AGPTAEKSVPYQRTLK-EGQGTSVVAQGPSRPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDD----FGVRR--VAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPL-APAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGHLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLEAIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQAHLKSPFDPNNKRVKGIY 918          
BLAST of Sarcosine dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8GAI3|MABO1_PAENI (4-methylaminobutanoate oxidase (formaldehyde-forming) OS=Paenarthrobacter nicotinovorans OX=29320 GN=abo PE=1 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 8.318e-113
Identity = 253/869 (29.11%), Postives = 418/869 (48.10%), Query Frame = 1
Query:  199 SNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEG-IQNMPNVRDHDSSVYLRLQGDAMGIGGYEPH--PIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWF--CNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSAL--ENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKG 2784
            S+  LP     V++GGG+ G S  YHL+  G  +T+L+ES+ + +GT+WH +GLV   R + T  +L  Y  +    LE  +G++  + + G L VA T  R++E      +     + +E L     K+L+PL     + G L  P DG I+P     AL K A  LG ++ + V V  V            RQ   V  V+T+ G +  + V+L+ G W+  +A TAGVKVPL   +H +V S  I+G +  +P  RD D+S Y+R +   + +G +EP   P   +  P   F+ F  +W  F      A   VP L   G    +  PESFTPD    +GE+ E+  LF+   +NS G++ + G G+++A W+  G P  D  A D++RFS    +N +++  R+ E   + Y++ + + +   GR++ +  L   L + G  + E  G ER  W+    T P                           DY++      + + +E    RE   +F++S F KF + GPD  +      TA+ +      +YT   N+  G E D T T +   L    V  P  T             Q  ++++  I   K     + D +  +  + + GPKSR++L  IS  D+S+E+  ++  ++++I      +LR+SFVGE+G+EL+ + D A ++ +++ + G+  G+  AGY A+DSL  EKG+RH   D+ P D P  AGL FT  +     FLG+ AL   +      +         + + +H  E +  NG  VG + S  +GH + +A+G         + +      SGD+E++  G+ Y A   ++  +DP+ +R++G
Sbjct:   18 SHDPLPTHVRTVVVGGGIIGASIAYHLSAAGENDTLLLESNVLGSGTSWHAAGLVTGARGTTTMTKLAKYGLDFYSRLEQMSGLDVSFQRCGSLSVARTAGRVDELLYAKDVADQQGVRTEWLTEDRYKELWPLATYSGVAGALLLPDDGHINPGHATVALAKLAHSLGTQIRENVAVHKVL-----------RQGDLVVGVLTDQGIVHCDRVILACGLWTRDLAATAGVKVPLYAAEHIHVRSAEIDGAVPELPVYRDLDNSYYIRHEAGRLLVGAFEPDGLPRPVEEIPSNGFAEFGPEWEHFAPIRAKAEGVVPALASAGFDRFLNAPESFTPDANFAVGETSELSNLFVAAGFNSQGIIFAPGIGKELAEWVISGTPGFDSSAVDVQRFSGH-QNNRNYLKARTKEGLGRLYAMHWPNLQMETGRNVRRTPLHARLAELGACFGEVNGGERANWYGAPGTSPTY-------------------------DYSYGRPNWFDRVAEEHKAAREGVVLFDLSPFAKFEVAGPDALEVCQMAATADIDVETDKAVYTLFLNDRAGIELDGTITRL--GLDRFLVVTPSFT------------QQKTAAYLKRIARGKA--AAVFDCTAALATIGVMGPKSRELLSRISPEDWSDEAQRYTHGRMVEIADGYAYSLRVSFVGELGYELYPSADMAVNVLDALWEAGQDLGLKLAGYHALDSLRSEKGFRHLGHDIGPIDDPYSAGLRFTISMDKPGGFLGKDALLKLDPTAPDHRTVYVALEDPDPVFVHD-ETVYCNGLPVGRMTSGSYGHTLGRAVGI--------AALEPDADLSGDFEVQCKGRLYPAKVSRRPFYDPKGERLRG 824          
BLAST of Sarcosine dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8NCN5|PDPR_HUMAN (Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2)

HSP 1 Score: 369.007 bits (946), Expect = 9.240e-112
Identity = 268/901 (29.74%), Postives = 439/901 (48.72%), Query Frame = 1
Query:  109 IQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKS----LPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPL--IAKTAGVKVPLCTLKHAYVISERIEG--IQNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYL--TGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKI---NGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGL-----EAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGST-----VTSGYLESGDYEIEKMGKRYSAN 2736
            + +YR LS    +   P      +  N T + ++    LP  A VVI GGG++G S  YHL+K+G  + VL+E   + AG+T   +G++   R    E ++  YS +L   LE ETG+ TGY + G +F+A T++RL   +R+     +  I SEI+ P +  +L  L+N  D+ G ++ P D V+  A    AL   A+  G ++ D   VL+V V K            +VT V T+ G I+    V  AG W+    ++    V +PL   +H Y+++  +E     + P + D D  +Y+R     +  GG+E  P PIF + K        + DW+ F   +   + R+P LE   I   V  PE+FTPD + +MGESP V+G F+    NSAG+   GG G+ +A W+ HG PS +++  D++RF   +  +  ++  R  E     Y +     +   GR +    L+D L  QG  + E+ GFERP +F     +LL                     LE   TF      +++  E    +E   + +MS F KF +  TG    + + ++F+ + + PVG I++T M NE GG E D +   ++                ++++        +  +++   +  K  N  L DV+     L++ GP++  +L  +S    + + FP    K + +   NG+  R + ++  GE G+ L+I  +YA  +YN ++ VG+ +G+ NAGY A+ SL IEK +  W  D+    TPLE G     KL+   +F+GR AL  Q +NG+ K+L++F L +      L     E I RNG+YVG   S+ + + +++ +  G+V      T     VT+ ++  G+YEI+  G R+ A 
Sbjct:    1 MMFYRLLSIVGRQRASPGWQNWSSARNSTSAAEARSMALPTQAQVVICGGGITGTSVAYHLSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYYQLEQETGIQTGYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHVPEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKG-----------QVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRFGA-LQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPDKDLL--------------------ALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKR--------------SFFMISPTDQQVHCWAWLKKHM-PKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGYANGI--RVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDSDLDLWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEYEIDIAGYRFQAK 852          
BLAST of Sarcosine dehydrogenase vs. TrEMBL
Match: F7GBN5 (Sarcosine dehydrogenase OS=Monodelphis domestica OX=13616 GN=SARDH PE=4 SV=2)

HSP 1 Score: 1078.16 bits (2787), Expect = 0.000e+0
Identity = 516/890 (57.98%), Postives = 672/890 (75.51%), Query Frame = 1
Query:  136 TNAKSGVPYKNTHKNDGNQTKS--NKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMK-SLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            T  KS VPY+ T K + +   S   + LPKSADVV++GGG  GC  LYHLAKLG+TN VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++ +++   LE ETG++TG+IQNGGLF+AS  +RL+EY+RL +LGK + I S +L P+ETK+L+PLMN +D++G LY P DG +DPAG C+ LI+ AT  GA++ +   V  ++V  +     FG +R  V +V T+ GSI+T+CVV  AG W+  + K AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAF LF+LDW+VF  +I GAINRVPVLEKTGIKSTVCGPES+T DHKPLMGE+PE++G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +TDNH WI ERSHE+YAKNYS+++ HDEPLAGR+M +D L +ELLQQGC++QER G+ERPGWF    P  +LPYD+YG+YE + H++Y+Y  +L  +YTF+F  +H+VI KECL+ R   A+F+MSYFGKFYL GP+ +KA DW+F+A+ +KP GS +YTCM N  GGTE+DLT + +        +  P   G  YYLAVGGA  QY  S I  +L++K+FNC+LID S++M ++SIQGP+SR +LQ + +TD SNE+FPFST KL+K  G   +A+RLSFVGEMGWELHI K     +Y +++K G  HG++NAGYRAIDSLSIEKGYRHWHADLR DDTPLEAGL FTCKLK++  FLGR ALE Q  +GL ++L  F++ +K+ + GLEAI RN + VG +R ADFG  I+K I YGY+   +G   +  +++SGDY +E+MG  Y A  H K+ FDP+NKR+KG+Y
Sbjct:   32 TTEKS-VPYQRTLKENKDSVGSGPTRPLPKSADVVVVGGGSLGCQTLYHLAKLGLTNIVLLERDKLTSGTTWHTAGLLWQLRPSDVEVELLAHTRQVVSHDLEKETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGIESHVLTPAETKELYPLMNVEDLYGTLYVPQDGTMDPAGTCTTLIRAATARGAQVVENCPVTGIQVRTDD----FGVRR--VAAVDTDYGSIQTSCVVNCAGVWASTLGKMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYESNPIFWDKVSDKFAFGLFDLDWDVFTQHIEGAINRVPVLEKTGIKSTVCGPESYTADHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTDNHHWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLQQGCVFQERHGWERPGWFNPQGPAPILPYDYYGAYEHQPHEDYKYNRLLGNEYTFDFPPHHDVIQKECLSCRNAVAVFDMSYFGKFYLVGPEARKAADWLFSADVHKPPGSTVYTCMLNHRGGTESDLTVSRLALDSETFPL-TPSFEGDGYYLAVGGATAQYNWSHITTVLQDKKFNCQLIDCSEEMGMISIQGPQSRAVLQEVLETDLSNEAFPFSTHKLVKAAGHLVQAMRLSFVGEMGWELHIPKASCVPVYKAVMKAGAKHGIINAGYRAIDSLSIEKGYRHWHADLRSDDTPLEAGLAFTCKLKSNIPFLGREALEKQKASGLLRRLVCFTVDKKVPMFGLEAIWRNEKVVGHIRRADFGFTINKTIAYGYIQNPEGGPASLEFVKSGDYALERMGVTYPAQAHVKSPFDPDNKRVKGIY 913          
BLAST of Sarcosine dehydrogenase vs. TrEMBL
Match: A0A3Q3LUE0 (Sarcosine dehydrogenase OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 1068.14 bits (2761), Expect = 0.000e+0
Identity = 511/897 (56.97%), Postives = 673/897 (75.03%), Query Frame = 1
Query:  115 YYRALSATNAKS-GVPYKNTHK-NDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLP-YDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y R+ S+   K   VPY+ T K +DG  T   K LP+SADVV+IGGG  GC  +YHLAK+G+TN VL+E   +TAGTTWHT+GL+W LRPSD E++LL+++  ++ K LE ETG++TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA + +   V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+P + + AGVKVPL  + HAYV+++RIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAFSLF+LDW+VF  +I GAINRVPVLE+ GIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCGR++AHWI HGRP  DM+ YDIRRF   +TDN DWI ERSHE+YAKNYS+++  DEPLA R+M KD     L++QGC++QER G+ERPGWF   KP  +  YD+YG+YE ++H NY+Y  +L  +YTF+F  +H+VI  ECL+ R   A+FNMSYFGKFYLTGPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++    N  +  P+  G  YYLA+GGAV ++  + I  +L+++ F+C+L D S+DM ++SIQGPKSR++LQ + DTD SNE+FPFST K++   G P RA+RLSFVGE+GWELHI KD    +Y++++  G  HG++N+GYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLK+   F GR  L+ Q + GL++++  F+++EK+ + GLEAI R+G  VG LR A+FG +IDK IGYGY+   DG  V++ +++SG++ +E+MG  Y A  H K+ FDPENKR+KG+Y
Sbjct:   26 YARSYSSEPTKEKSVPYEKTLKQDDGASTGPTKPLPRSADVVVIGGGSLGCQTIYHLAKMGLTNVVLLERDRLTAGTTWHTAGLLWQLRPSDVEVELLAHTRNVISKDLEEETGLHTGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNIDDLYGTLYVPKDGTMDPAGTCTTLTRAASARGAVVIENCPVTGIKVQTDD----LGVKR--VKAVKTPHGTIETPCVVNCAGVWAPKLGEMAGVKVPLIAMHHAYVVTQRIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEHNPIFWEEVSDKFAFSLFDLDWDVFMQHIEGAINRVPVLEQIGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGRELAHWIIHGRPEKDMYGYDIRRFHHSLTDNKDWIRERSHESYAKNYSVVFPFDEPLASRNMRKDPFHQVLMEQGCVFQERHGWERPGWFNKDKPAPVKDYDYYGAYEVKKHVNYKYNELLGKEYTFDFPPHHDVIKNECLSCRHSVAVFNMSYFGKFYLTGPDAKKAADWLFTADVNKKPGSTVYTCMLNKRGGVESDLTVSRLEPGAANLPL-APESIGDAYYLAIGGAVAEHNWNHIRTVLQDQGFHCQLTDHSEDMGMISIQGPKSREVLQEVLDTDLSNEAFPFSTHKVVNAAGRPVRAVRLSFVGELGWELHIPKDSCLPVYHAVMAAGTKHGIINSGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKSSIQFQGRDRLQKQKEEGLRRRIVCFTIEEKVPMFGLEAIFRSGVPVGHLRRAEFGFFIDKTIGYGYIRNPDGGVVSADFIKSGEFTLERMGVTYKAKAHLKSPFDPENKRVKGIY 915          
BLAST of Sarcosine dehydrogenase vs. TrEMBL
Match: A0A151MFR5 (Sarcosine dehydrogenase, mitochondrial OS=Alligator mississippiensis OX=8496 GN=SARDH PE=4 SV=1)

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 512/896 (57.14%), Postives = 667/896 (74.44%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKS-NKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTK--PELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            + + +A   +  VPY  T K++ +Q +   K LPK ADVV++GGG  GC  +YHLAK+GVTN VL+E   +T+GTTWHT+GL+W LRPSD E++LL+++  ++ + LE ETG++TG+IQNGGLF+AS ++RL+EY+RL +LGK++ + S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + AT  GA + +   V  ++V  +     FG QR  VT+V T+ G+I+T CVV  AG W+  + + AGV VPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAF LF+LDW+VF  +I GAINRVP LEKTGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   +T+N+ WI ERSHE+YAKNYS+++ +DEPLAGR+M KD L +ELLQQGC++QER G+ERPGWF NT+    +L YD+YG+Y+++ H+ Y Y ++L  +YTF+F  +HN I KECL  R   A+F+MSYFGKFYL GP+  KA DW+FTA+ +K  GS +YTCM N+ GG E+DLT + I  S  ++    P   G  YYLAVGGAV Q+  S I  +L++ +F CKL+D S+++ ++SIQGP SR +LQ + DTD SNE+FPFS+ KL K+ G   RA+RLSFVGEMGWELH+ K     +Y +++K G  H + NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLK+   FLGR ALE Q   G+ ++L  F+++EK+ L GLEAI RNG+ VG +R ADFG  I+K I YGY+  LDG  V+  Y++ GDY +E+MG  Y A  H K+ FDPENKR+KGVY
Sbjct:   40 FSSATAQTTEKSVPYHKTLKDESSQAQGPTKPLPKLADVVVVGGGSLGCQTIYHLAKMGVTNAVLLERDRLTSGTTWHTAGLLWQLRPSDVEVELLAHTRNVVSRDLEEETGLHTGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGVESYVLSPAETKDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLTRAATARGALVIENCPVTGIQVRADD----FGVQR--VTAVETSYGTIQTPCVVNCAGVWARALGQMAGVSVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYESNPIFWEEVSDKFAFGLFDLDWDVFMQHIEGAINRVPALEKTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERSHESYAKNYSVVFPYDEPLAGRNMRKDPLHEELLQQGCVFQERHGWERPGWF-NTQGAAPILDYDYYGAYDQKPHEAYAYNHLLGDEYTFDFPPHHNTIKKECLTCRNAVAVFDMSYFGKFYLVGPEASKAADWLFTADVSKLPGSTVYTCMLNKRGGVESDLTVSRI--SPGSQASLAPAFEGDGYYLAVGGAVAQHNWSHIMRVLQDMKFQCKLLDCSEELGMISIQGPLSRTVLQELLDTDLSNEAFPFSSHKLAKVAGCMVRAMRLSFVGEMGWELHVPKRDCVRVYQAVMKAGAQHSIANAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKSGIRFLGREALEAQKATGVSRRLVCFTVEEKVPLFGLEAIWRNGQVVGHIRRADFGFAINKTIAYGYIRNLDGGPVSLEYVKGGDYMLERMGVTYPARAHTKSPFDPENKRVKGVY 926          
BLAST of Sarcosine dehydrogenase vs. TrEMBL
Match: A0A3Q1K7K0 (Sarcosine dehydrogenase OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 513/891 (57.58%), Postives = 667/891 (74.86%), Query Frame = 1
Query:  130 SATNAKSGVPYKNTHKN-DGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC-NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            S    + GVPY+ T K  D   T  +K LP+SADVV+IGGG  GC  +YHLAK+GVTN VL+E   +TAGTTWHT+GL+W LRPSD E++LL+++  ++ K LE ETG++TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA + +  +V  ++V  +      G +R  V +V T  G+I+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGI+NMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFWD   D FAFSLF+LDW+VF  +I GAINRVPVLE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCGR++AHWI HGRP  DM+ YDIRRF   +TDN  WI ERSHE+YAKNYS+++  DEPLA R+M KD     LL+QGC++QER G+ERPGWF  + +  +  YDFYG+YE +++ NY+Y  +L  +YTF+F  +H+VI  ECL+ R   A+F+MSYFGKFYLTGPD KKA DW+FTA+ NK  GS +YTCM N+ GGTE+DLT + ++    N  +  P+  G  YYLA+GGAV ++  + I  +L+++ F C L D S+DM ++SIQGPKSR++LQ + DTD SNE+FPFST K++   G   RA+RLSFVGE+GWELHI +D    +Y++++  G  HG++N+GYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLK+   F GR  LE Q + GL++++  F++ EKI + GLEAI RNG  VG LR AD+G +IDK IGYGYV   DG  V++ +++SGD+ +E+MG  Y A  H KT FDPENKR+KG+Y
Sbjct:   32 SEPTREKGVPYEKTLKQQDQASTGPSKPLPRSADVVVIGGGSLGCQTIYHLAKMGVTNVVLLERDRLTAGTTWHTAGLLWQLRPSDVEVELLAHTRNVISKDLEEETGLHTGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLTRAASARGATVIENCRVTGIQVRTDD----LGVKR--VKAVETPHGTIETPCVVNCAGVWATKLGEMAGVKVPLVAMHHAYVVTERIEGIKNMPNVRDHDASVYLRLQGDALSVGGYEHNPIFWDEVSDKFAFSLFDLDWDVFMQHIDGAINRVPVLEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGRELAHWIIHGRPEKDMYGYDIRRFHNSLTDNQRWIRERSHESYAKNYSLVFPFDEPLASRNMRKDPFHQALLEQGCVFQERHGWERPGWFNKHGRAPVKNYDFYGAYENKKNVNYKYSELLSKEYTFDFPPHHDVIKNECLSCRHGVAVFDMSYFGKFYLTGPDAKKAADWLFTADVNKKPGSTVYTCMLNKRGGTESDLTVSRLEPGAANLPL-APESNGDAYYLAIGGAVAEHNWNHIRTVLQDQGFRCNLTDHSEDMGMISIQGPKSRELLQEVLDTDLSNEAFPFSTHKVVNAAGHKVRAMRLSFVGELGWELHIPRDSCLPVYHALMAAGAKHGIINSGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKSSIPFQGRDRLEKQKEEGLRRRIVCFTIDEKIPMFGLEAIFRNGVPVGHLRRADYGFFIDKTIGYGYVRNPDGGVVSADFIKSGDFTLERMGVTYKAKAHLKTPFDPENKRVKGIY 915          
BLAST of Sarcosine dehydrogenase vs. TrEMBL
Match: A0A1S3IUE1 (sarcosine dehydrogenase, mitochondrial OS=Lingula unguis OX=7574 GN=LOC106167453 PE=4 SV=1)

HSP 1 Score: 1059.67 bits (2739), Expect = 0.000e+0
Identity = 521/888 (58.67%), Postives = 666/888 (75.00%), Query Frame = 1
Query:  133 ATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFW-DPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKP-ELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            + + +SGVPY+  H+   +   +   +P SADVVI+GGGV GC+ +Y+L K+G TN VL+E   +TAGTTWHT+GLVW LRP+D +IQLL+ S +LM+ LE ETGVN G+I NGGLF+AS +ERL+EY+RL TLGK+F I S +LGPSETKKL+PL+N  D++G +YSP DG IDPAGYC+AL + AT LG ++     V  ++V  +     FG +R  V +V T+ G+IKTNCVV   G W+P I K AGVK PL  ++HAYV++ERIEGIQNMPNVRDHD+SVYL+LQGDA+ +GGYEP+PIFW D K DFAFSLF+LDW+VF V+I GA+NRVP +  TGIKSTVCGPESFTPDHK L+GE+PEV+G F  C +NS GM LS GC +Q+A WI  GRP+LDM+ YDIRRF+E++TDN+ WI ERSHEAYAKNYSI+Y HDEPLA R+M KD L D L + GC+++ERQG+ERPGW+    P + L YD+YGSY+ + H    Y   L+ DYTF+F   H++IGKECL  RE  AIFNMSYFGK+YL GPD +KA DWIF+ +  KP G  +YTCM N+ GG EADLT + I+    + G H P   G  +YLA GG   Q   S I  ++++++FNC LID S DM L+SIQGPKSR++LQ+++D D SNE+FPFST K++ + G   RALRLSFVGEMGWELH+      ++Y++++  G  +G+ NAGYRAIDSLS+EKGYRHWHADLR DDTPLE+ LGFTCKLKTDT FLGR ALE Q K G+KK+++ FS+ + + LHGLEAI R+GE VGFLR A++   + K+IGYGYV   DGS VT+ +++SG Y +E MG  Y A  H K+ FDP+NKR+KG+Y
Sbjct:   28 SQSVQSGVPYE--HQLKDHTKDAPTEVPASADVVIVGGGVIGCATMYYLTKMGQTNVVLLEKDDLTAGTTWHTAGLVWRLRPNDVDIQLLNRSRDLMQELEEETGVNPGWINNGGLFIASRKERLDEYKRLHTLGKVFGIESHVLGPSETKKLYPLLNVDDVYGTVYSPGDGTIDPAGYCTALTRAATRLGGKVLTKCAVTGIDVQTDD----FGTRR--VQAVQTSSGTIKTNCVVNCTGVWAPKIGKMAGVKTPLVAMRHAYVVTERIEGIQNMPNVRDHDASVYLKLQGDALQVGGYEPNPIFWEDVKDDFAFSLFDLDWDVFSVHIEGAVNRVPKIGDTGIKSTVCGPESFTPDHKALLGEAPEVRGFFHGCGFNSLGMNLSAGCAKQLADWIIQGRPTLDMYGYDIRRFTEKLTDNYKWIVERSHEAYAKNYSIVYPHDEPLACRNMRKDALTDTLEEAGCVFEERQGWERPGWYSPQGPAKRLSYDYYGSYDYQLHDPNTYYERLQNDYTFDFPVQHDIIGKECLTCRESVAIFNMSYFGKYYLVGPDAQKAADWIFSNDMQKPEGHTVYTCMLNQAGGVEADLTVSAIEPG--SGGPHAPKFEGRGFYLAAGGGAAQQNYSHIQTVIQDQKFNCHLIDHSDDMALMSIQGPKSRELLQTLTDADLSNEAFPFSTNKVVTVAGHEVRALRLSFVGEMGWELHVPNVSCLAVYHAVMDAGAKYGITNAGYRAIDSLSLEKGYRHWHADLRIDDTPLESLLGFTCKLKTDTPFLGREALERQKKEGIKKRIACFSIDDHVPLHGLEAIWRDGEAVGFLRRAEYAFALGKSIGYGYVRCPDGSAVTADFMKSGVYTLEHMGATYPAKLHLKSPFDPQNKRVKGIY 905          
BLAST of Sarcosine dehydrogenase vs. Ensembl Cavefish
Match: sardh (sarcosine dehydrogenase [Source:NCBI gene;Acc:103038491])

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 494/899 (54.95%), Postives = 652/899 (72.53%), Query Frame = 1
Query:  118 YRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKS-LESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQ-----NMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPE-LLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            Y   +    +  VPY  T K +       K LP++AD V+IGGG  GC  LYHL K+G+TN VL+E   +TAGTTWHT+GL+W LRPSDTE++LL+++  ++ S LE+ETG+ TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN KD++G LY P DG +DPAG C+ L + AT  GA + +  +V  ++V  +      G +R  V  V T+ G+I+T CVV  AG W+  + + AGVKVPL  + HAYV++ERIEGIQ      + ++RDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAFSLF+LDW+VF  +I GAINRVP LE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCG+++AHWI HGRP  DM+ YDIRRF   ++ N+ WI ERSHE+YAKNYS+++  DEPLA R+M KD     L  QGC++QER G+ERPGWF    P  +L YD+YG+Y+ +++ +Y+Y  +L  +YTF+F  +HN I  EC+  R   A+FNMSYFGKFYL+GPD KKA DW+FTA+ NK  GS +YTCM N+ GG E+DLT + ++   P      P+  G  YYLA+GG V Q+  S I  +L+++ FNC L D S+DM ++SIQGPKSR +LQ + D D SNE+FPFST K++   G   RA+RLSFVGE+GWELHI KD    +Y++++  G  +GV NAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCK+KT   FLGRSALE+Q   GL++++  F++ EK+ + GLEAI RNG  VG LR A+FG+ I+K IGYGY+   +G  V+  ++  G++ +E+MG +Y A  H K+ FDPEN+R+KG+Y
Sbjct:   29 YSVQAEHTTEKSVPYAKTLKQEDAHKGPTKPLPRAADAVVIGGGSLGCQTLYHLCKMGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLAHTRRVVSSELEAETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESYVLSPAETKDLYPLMNVKDLYGTLYVPKDGTMDPAGTCTTLSRAATARGATVIENCQVTGIQVHTDD----LGVRR--VRGVETDFGTIETPCVVNCAGVWATKLGEMAGVKVPLIAMHHAYVVTERIEGIQVVFHARLTSMRDHDASVYLRLQGDALSVGGYEQNPIFWEEVSDKFAFSLFDLDWDVFMQHIEGAINRVPALEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLSSNNRWIRERSHESYAKNYSVVFPFDEPLAARNMRKDPFHQVLQDQGCLFQERHGWERPGWFNKDGPAPVLDYDYYGAYDVKKNSDYKYNELLGKEYTFDFPPHHNTIRDECMTCRNAVAVFNMSYFGKFYLSGPDAKKAADWLFTADINKKTGSTVYTCMLNKKGGAESDLTVSRLEPG-PAHLPLTPESNGDVYYLAIGGGVAQHNWSHIQTVLQDECFNCTLTDQSEDMGMISIQGPKSRDLLQEVLDADLSNEAFPFSTHKIVTAAGHKVRAMRLSFVGELGWELHIPKDSCLPVYHAVMAAGAKYGVQNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKMKTSIPFLGRSALESQKAEGLRRRIVCFTIDEKVPMFGLEAIFRNGVPVGHLRRAEFGYAINKTIGYGYIRNPEGEVVSPDFVRGGEFTLERMGVQYKAKAHLKSPFDPENRRVKGIY 920          
BLAST of Sarcosine dehydrogenase vs. Ensembl Cavefish
Match: si:cabz01113374.3 (pyruvate dehydrogenase phosphatase regulatory subunit [Source:NCBI gene;Acc:103042053])

HSP 1 Score: 377.867 bits (969), Expect = 6.908e-116
Identity = 274/878 (31.21%), Postives = 427/878 (48.63%), Query Frame = 1
Query:  211 LPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVK--VPLCTLKHAYVISERIEG--IQNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLT--GPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKI---NGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGL-----EAIVRNGEYVGFLRSADFGHYIDKAIGYGYVG--RLDGS--TVTSGYLESGDYEIEKMGKRYSAN---FHQKTLFDPENKR 2775
            LP  A VVI GGG+ G S  YHLAKLG T  VL+E   + AGTT   +G+V   +P   E Q+ +YS  L + LE ETGV T +++ G L +A  ++R    +RL +  K+  I  +++ P +  KL PL+N  D+ G L+ P D V+ P     AL   A   G ++ +   V +V V K             VT V T+ G I+    V  AG W+  + +++ VK  VPL   +H Y++++ ++     + P V D D  +Y+R     +  GG+E  P PIF + +        + DW+ F   + G + R+P L+   I   V  PESFTPD + LMGE+P V G F+    NS+G+  +GG G+ +A W+ +G PS +++  DI+RF   +  +  ++  R  E     Y +     +   GR +    L+D L  QG  + E+ GFER  +F     +LL  D        Q K            TF      +++G E    +E   + +MS F KF LT  G    + +  +   + N PVG I++T M NE GG E D +                 L+   +++        +  S++   +        L DVS     L++ GP++  +L  +S    + E FP    K + +   NG+  R + ++  GE G+ L+I  +YA  +YN ++ VG+ +G+ NAGY A+ SL IEK +  W  DL    TPLE G  F  K    T+FLGR AL  Q + G+ ++  +  L +      L     E I RNGE VG   S+ + + +++ +  G+V    LDG+   VT  ++  GDYE++  G+RY A    +   +LF  + +R
Sbjct:   53 LPGQARVVICGGGIVGTSVAYHLAKLGWTEIVLLEQGRLGAGTTRLCAGIVSVAKPITIESQMANYSNSLYERLEEETGVKTAFVRTGSLCLAQNQDRFLSLKRLASRLKVLGIACDVIKPKDVAKLHPLVNIHDLVGALHLPGDAVVSPPDVNHALAVAAARHGVQIHERTSVNHVLVEKG-----------HVTGVETDRGPIECEYFVNCAGQWAYELGQSSEVKVSVPLHGCEHFYLLTKPLQEPLPPSTPVVMDMDGRIYVRAWQGGVLSGGFEKNPKPIFTEGRNQLEIQNMQEDWDHFEPMLNGLLRRMPSLDSCEIHQLVNCPESFTPDMRCLMGETPGVHGYFVLAGMNSSGLSFAGGAGKYLADWMTYGYPSANVWPLDIKRFGN-LQSSRTFLRHRVMEVTPLLYELKVPRWDFQTGRQLRTSPLYDRLDTQGARWMEKHGFERAKYFVPAGKDLLALD--------QSK------------TFYKPDWFDIVGAEVKCCKEAVCVIDMSSFTKFELTSSGDQALELLQRLCANDLNVPVGHIVHTGMLNERGGYENDCSVVR--------------LSKNCFFIISPTDQQVHCWSWLKRHMPSDP-QLHLEDVSWKYTALNLIGPRAMDVLSELSYVSMTPEHFPSLFCKEMSVGYANGI--RVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLDSFTTPLECGREFRVKFDKHTDFLGREALLQQRQEGVTRRFIMLVLDDHDTELDLWPWWGEPIYRNGELVGVTTSSAYSYTLERHVCLGFVSPPSLDGTPAVVTPDFINRGDYEVDIAGQRYPAKAKLYPFSSLFAQQRRR 881          
BLAST of Sarcosine dehydrogenase vs. Ensembl Cavefish
Match: si:cabz01113374.3 (pyruvate dehydrogenase phosphatase regulatory subunit [Source:NCBI gene;Acc:103042053])

HSP 1 Score: 377.867 bits (969), Expect = 6.908e-116
Identity = 274/878 (31.21%), Postives = 427/878 (48.63%), Query Frame = 1
Query:  211 LPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVK--VPLCTLKHAYVISERIEG--IQNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLT--GPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKI---NGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGL-----EAIVRNGEYVGFLRSADFGHYIDKAIGYGYVG--RLDGS--TVTSGYLESGDYEIEKMGKRYSAN---FHQKTLFDPENKR 2775
            LP  A VVI GGG+ G S  YHLAKLG T  VL+E   + AGTT   +G+V   +P   E Q+ +YS  L + LE ETGV T +++ G L +A  ++R    +RL +  K+  I  +++ P +  KL PL+N  D+ G L+ P D V+ P     AL   A   G ++ +   V +V V K             VT V T+ G I+    V  AG W+  + +++ VK  VPL   +H Y++++ ++     + P V D D  +Y+R     +  GG+E  P PIF + +        + DW+ F   + G + R+P L+   I   V  PESFTPD + LMGE+P V G F+    NS+G+  +GG G+ +A W+ +G PS +++  DI+RF   +  +  ++  R  E     Y +     +   GR +    L+D L  QG  + E+ GFER  +F     +LL  D        Q K            TF      +++G E    +E   + +MS F KF LT  G    + +  +   + N PVG I++T M NE GG E D +                 L+   +++        +  S++   +        L DVS     L++ GP++  +L  +S    + E FP    K + +   NG+  R + ++  GE G+ L+I  +YA  +YN ++ VG+ +G+ NAGY A+ SL IEK +  W  DL    TPLE G  F  K    T+FLGR AL  Q + G+ ++  +  L +      L     E I RNGE VG   S+ + + +++ +  G+V    LDG+   VT  ++  GDYE++  G+RY A    +   +LF  + +R
Sbjct:   53 LPGQARVVICGGGIVGTSVAYHLAKLGWTEIVLLEQGRLGAGTTRLCAGIVSVAKPITIESQMANYSNSLYERLEEETGVKTAFVRTGSLCLAQNQDRFLSLKRLASRLKVLGIACDVIKPKDVAKLHPLVNIHDLVGALHLPGDAVVSPPDVNHALAVAAARHGVQIHERTSVNHVLVEKG-----------HVTGVETDRGPIECEYFVNCAGQWAYELGQSSEVKVSVPLHGCEHFYLLTKPLQEPLPPSTPVVMDMDGRIYVRAWQGGVLSGGFEKNPKPIFTEGRNQLEIQNMQEDWDHFEPMLNGLLRRMPSLDSCEIHQLVNCPESFTPDMRCLMGETPGVHGYFVLAGMNSSGLSFAGGAGKYLADWMTYGYPSANVWPLDIKRFGN-LQSSRTFLRHRVMEVTPLLYELKVPRWDFQTGRQLRTSPLYDRLDTQGARWMEKHGFERAKYFVPAGKDLLALD--------QSK------------TFYKPDWFDIVGAEVKCCKEAVCVIDMSSFTKFELTSSGDQALELLQRLCANDLNVPVGHIVHTGMLNERGGYENDCSVVR--------------LSKNCFFIISPTDQQVHCWSWLKRHMPSDP-QLHLEDVSWKYTALNLIGPRAMDVLSELSYVSMTPEHFPSLFCKEMSVGYANGI--RVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLDSFTTPLECGREFRVKFDKHTDFLGREALLQQRQEGVTRRFIMLVLDDHDTELDLWPWWGEPIYRNGELVGVTTSSAYSYTLERHVCLGFVSPPSLDGTPAVVTPDFINRGDYEVDIAGQRYPAKAKLYPFSSLFAQQRRR 881          
BLAST of Sarcosine dehydrogenase vs. Ensembl Cavefish
Match: dmgdh (dimethylglycine dehydrogenase [Source:NCBI gene;Acc:103034486])

HSP 1 Score: 350.517 bits (898), Expect = 6.841e-106
Identity = 255/886 (28.78%), Postives = 423/886 (47.74%), Query Frame = 1
Query:  163 KNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQ----NMPNVRDHDSSVYLRLQGDAMGIGGYEPHP--IFWDP------KPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSAL-ENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIK 2781
            + + + +G+     K L  +A+ +IIGGG  G S  YHLAK G    VL+E S +TAG+TWH +GL  +  P     ++  +S +L + LE+ETG   G+ Q G + +AST  R++E +   T          ++GP +  +LFPL+N   +   LY+P DG IDP     AL  GA   GA++     V  +  + +               V T  G+I+ N +V + G W+  + +  G   P   + H YV++  +  ++     +P +RD + S YLR + D +  G YE     +  D        P F   LFE D +    ++  A+  VPVL+   I + V GP ++TPD  P++G    V+  +    +   G++ +GG G+ ++ WI  G P  D+   D  R+ +  T    ++  ++ E+Y  N  + Y  +E  +GR   +     ELL+  C      G+E+P +F        P D  G           YR       +F  +     +G+EC    EK  + ++S FGKF + G D+ K +D +F AN+   VG    + M    G   A++T T+              L+   + L  G     +   +I     +  +  ++ +V+  + +L + GP SR++LQ ++  D S+ +F F   K I++ G+  RA+R+S+ GE+GWEL++      ++Y +I++ G+  G+ N G  A+ SL +EKG+R W A++  D  PLEAGL +  KL    +F+G+ AL E ++K   +K   L    + I   G E I   G+ VG   S  + +  ++++ +GY   L     T G       E+E +GK+Y A   Q+ L   E  R +
Sbjct:   42 RRSEERNGSVGALGKRLQDTAETLIIGGGCVGVSLAYHLAKAGQKGVVLLEKSELTAGSTWHAAGLTTYYHPGINLKKIHYHSIKLYEQLEAETGQAVGFHQPGSVRIASTSARVDEMKYQMTRTHWHPTQQFLIGPEKVHQLFPLLNMDKVLAGLYTPGDGHIDPYSLTMALAAGARMYGAQIYTPAPVTGLSPTSDGK-----------WDVQTPHGTIRANRIVNATGFWARELGQMIGYPHPTIPVHHQYVVTATVPEVKALKTELPVIRDLEGSYYLRQERDGLLFGPYEREEKMVLQDSWVRDGVPPGFGKELFESDLDRIMDHVEMAMEMVPVLKHADIINIVSGPITYTPDLLPMIGPHQGVRNYWTAIGFGY-GIIHAGGVGKFLSDWIMTGEPPYDLIECDPNRYGKWTTV--PYLCAKARESYGFNNVVGYPKEERFSGRPTSRVSGLYELLKDKCSMGFHAGWEQPHYFYK------PGDEVG-----------YRP------SFRRTNWFGPVGRECKLVMEKVGVIDLSPFGKFMVKGKDSHKLLDRLF-ANTLPKVGLTNISHMLTPRGRVYAEVTITQ--------------LSPGEFLLITGSGSELHDLRWIEREAADGGYEVEISNVTDGIGVLGVAGPNSRKVLQKLTSEDLSDAAFKFLHCKSIQLAGVKLRAIRISYTGELGWELYVDMPQLAAVYQAIMEAGQEEGIDNFGTYAMGSLRLEKGFRGWGAEMNCDTNPLEAGLDYFIKLNKPADFIGKQALQEIKSKGLTRKLAYLIMDTDNIDPEGNETIWHEGKVVGNTTSGAYSYSAEQSLAFGY---LPVKLATIGQ----KVEVELLGKKYPATVVQEPLVLTEPTRTR 868          
BLAST of Sarcosine dehydrogenase vs. Ensembl Cavefish
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:103022813])

HSP 1 Score: 56.6102 bits (135), Expect = 6.738e-8
Identity = 61/243 (25.10%), Postives = 106/243 (43.62%), Query Frame = 1
Query: 1717 LNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFT---ANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVS-QDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFT 2430
            L+TR   +IF++S+  +  + G D  K ++ +     A      G++  +   N  GG   DL  T+ D              G  Y ++  G   +  S+ +   L E +     +D+   +  L+++QGP   ++LQ     D S     F T  L  + G+P CR  R  + GE G E+ + +D   ++   ++    +  V  AG  + DSL +E G   +  D+    TP+EA L +T
Sbjct:   57 LHTRHHCSIFDVSHMLQTKVYGKDRVKFMESLVVGDIAELKDNQGTL--SLFTNTKGGIMDDLIVTKTDQ-------------GYLYVVSNAGCADKD-SAHMQARLREFKAAGHDVDLEYLEESLIALQGPSMARVLQEGVGDDLSK--LTFMTSVLTPVFGIPGCRVTRCGYTGEDGVEISVPRDSVVALTERLLA---NDEVKLAGLGSRDSLRLEAGLCLYGNDIDETTTPVEAALVWT 278          
BLAST of Sarcosine dehydrogenase vs. Ensembl Sea Lamprey
Match: dmgdh (dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-080227-8])

HSP 1 Score: 341.273 bits (874), Expect = 1.283e-103
Identity = 246/884 (27.83%), Postives = 412/884 (46.61%), Query Frame = 1
Query:  193 TKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGI----QNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIF-----W----DPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMK-DVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTS----LPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXX-XXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLF--DPENKRIK 2781
            T  + S+  SA+ V+IGGG  G S  YHLA+ G +  VL+E S +TAG+TWH +GL  +  P     ++  YS +L + LE ETG   G+ Q G + +A+T ER++E+    T  +       ++GP + ++LFPL+N   +   +Y+P DG IDP     AL  GA   G R+     V  +  +                 V T  G+I+   V+   G W+  + +  G++ PL  + H YV++  I  +    + +P +RD + S YLR +   +  G YE          W     PK DF   LFE D      ++  A+ RVPVL+K  I S V GP ++TPD  P++G    +   ++   +   G++ +GG G+ ++ WI  G+P  D+   D  RF +  T  +     R  E+Y  N  + Y  +E +AGR   +   ++  LL +G       G+E+P WF                     +  EYR       +F  +     +G+EC    E   + +++ FGKF L+G D  +  D +F AN+    G    + +    G    +LT   +       +   G    DL     + A GG                  F   + +V+ DM +L + GP SR++L  ++D    +++F F   + + + G    A+R+S+ GE+GWEL+  ++   ++Y+++++ G+  G+ + G  A++SL +EK +R W A++  D  P EAGL    K+  D +F+G+ AL+   + GL + L  L    + +   G E++  NG+ VG   S  + +    ++ + YV            L     E+E +GK Y A   ++ L    P  +R++
Sbjct:    2 TPPSSSVQDSAETVVIGGGCVGVSVAYHLARAGASGVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHHYSIKLYEQLERETGQAVGFHQPGSIRLATTPERVDEFHYQMTRARWNVTPQSLIGPDKIQELFPLLNMDQVLAGIYNPGDGHIDPYSLTMALAAGARQRGVRISQPAPVTGLTPTPQGH-----------WDVHTPHGTIRAQRVINCTGFWAREVGRLVGLEHPLVPIHHQYVVTATIPEVAALPRELPVIRDLEGSYYLRQERQGLLFGPYESAERMKIQEEWLESGVPK-DFGKELFESDLERI-PHMEAAMQRVPVLQKAEIVSVVAGPITYTPDLLPMLGPHVGLANYWVAVGFGY-GIIHAGGVGKYLSDWIMKGQPPFDLIELDPNRFGKWTTPEYALAKAR--ESYGANNIVGYPKEERVAGRPTQRVSGVYHALLHKGASMGFHAGWEQPHWFAPPG-----------------QRAEYRP------SFRRTNWFEAVGRECRLVMEAVGVIDLTPFGKFLLSGKDATRLADRLF-ANALPKEGHTNISHLVTPDGRVYGELTLNHVGPQQMLLVTGSGSELHDLRWIEEHAAAGG------------------FEVSVRNVTDDMGVLGVAGPLSRRVLARLTDAALDDDAFRFLRCRAVHVAGRAVTAVRISYTGELGWELYHQREDTGALYSALMEAGREFGIGDFGAYAMNSLRMEKAFRAWGAEMNCDTNPFEAGLQPFIKVNKDADFIGKEALQRIKREGLTRHLVYLTLDTDDVDPEGNESVWCNGKVVGNTTSGAYSYTAGHSVAFAYV-------PVELSLVGQHVEVELLGKNYPATVAKEPLVLTQPTRQRMQ 820          
BLAST of Sarcosine dehydrogenase vs. Ensembl Sea Lamprey
Match: si:cabz01113374.3 (pyruvate dehydrogenase phosphatase regulatory subunit [Source:HGNC Symbol;Acc:HGNC:30264])

HSP 1 Score: 325.094 bits (832), Expect = 1.587e-97
Identity = 255/879 (29.01%), Postives = 421/879 (47.90%), Query Frame = 1
Query:  211 LPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGC--------LYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTA--GVKVPLCTLKHAYVISERIEGI--QNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNI-----GGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYL--TGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSS--FINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKI---NGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKL--KTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQ-----LHGLEAIVRNGEYVG----FLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSAN 2736
            LP  A VV+ G G+ G S  +HLA+LG T+ +L+E   ++ GTT   +G+V  +R    EI+   YS +L +SLE +TG++TG+ + G + +A T++R+   QR+          + +L   +  ++ P +  +   G         L  P DG + P   C AL   A   G ++ +   V ++ V K       GR    VT+V T+ G ++    V  AG W+  + + +   V VPL   +H Y++++ +     +N+P + D D  VY+R     +  GGYE  P PIF + K    F   E DW+ + + +     G  ++R+P L+   +   V  PE+FTPD + +MGE+P V   F+    NSAG  L+GG G+ +A W+  G PS +++  D+RRF   +  +  ++  R  E     +   + H E   GR +    LFD L  QG  + E+ G+ER  +F    P   P++                  ++   TF      +++  E  + RE  ++ +M+ F KF L   G ++ + +  +   + + PVGSI +T M NE GG E D +   +                T     V     Q+V S  +++  L     + +L DVS     L++ GP+++ +L  +S T  + E FP    K + I   NG+  R + ++  GE G+ L+I  +YA  +YN ++ VGK  G+ NAGY A+ SL IEK +  W  DL P  TPLE G  F  K   K    F+G+ AL  Q + G++++L++  L            G E I+ NG++ G       S D+   +++ +  G+V    G  +T   +   +YE++   +RY A 
Sbjct:    1 LPARARVVVCGAGIVGSSVAFHLAELGWTDVLLLEQGRLSGGTTRMCAGIVSSVRHLPLEIEAADYSLKLYQSLEKDTGISTGFKKTGVISLAQTQDRIISLQRIAAQLNARGTEAMMLTAQQVLEMHPWVRARGGDGGGTGDIVGGLLVPGDGTVSPGDVCRALAHAAVAHGVQIRERTAVNHILVDK-------GR----VTAVETDHGEVECEFFVNCAGQWAYELGQCSDEAVSVPLHPCEHFYLLTQPLSPPFGENLPVILDLDGRVYVREWQGGVLSGGYEKNPKPIFTEGKNQVEFQTMEQDWDHYVLTLAEPLLGALLHRMPGLDGAAVSRLVNCPEAFTPDLRCIMGEAPNVHNYFVLAGMNSAGSTLAGGLGKYLAEWMVTGSPSENVWPLDVRRFGG-LQSSRTFLRHRIMEVVPLTFERKFPHVEFQTGRRLRMSPLFDRLDAQGARWAEKHGYERAKFF--VPPANWPHE------------------VDERGTFFKPSWFDIVRAEVASCREGVSVIDMTSFTKFELRSAGSESLELLQSLCANDLDVPVGSIAHTGMLNEAGGYENDCSAVRV----------------TKGSFLVISPTDQHVRSWRWLSQHLPADG-SVQLEDVSDKYTALNLIGPRAQDVLSELSYTPVTPEHFPSMLCKEMSIGYANGI--RIMSMTHTGEPGFMLYIPTEYALHVYNELMNVGKKFGIRNAGYLALRSLRIEKLFAFWGQDLDPRTTPLECGREFRVKFDKKQGVEFVGQEALLRQREAGVRRRLTMLLLDNHDPEVDPWPWGGEPIICNGDFAGSDARLTTSCDYSFGLERHVCLGFV--CLGQPITPDLIARSEYEVQVAQRRYQAR 826          
BLAST of Sarcosine dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008586.1 (pep scaffold:Pmarinus_7.0:GL476642:854447:864138:1 gene:ENSPMAG00000007773.1 transcript:ENSPMAT00000008586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 287.73 bits (735), Expect = 2.036e-89
Identity = 155/299 (51.84%), Postives = 203/299 (67.89%), Query Frame = 1
Query:  154 VPYKNTHKNDGNQTKS----NKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVI--SERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGG 1029
            VPY  T K DG   K     +K+LP+   VV++GGG  GC  LYHLAK GVT+ VL+E   +TAGTTWHT+GL+W LRPSDTE++LL ++  ++ + LE ETG++TG+IQNGGLF+AS  +RL+EY+RL +LGK + I S +L P++TK L+PLMN  D++G LY P DG +DPAG CS L + AT  GA++ +   V  V V ++      G  R  V +V T  G I T CVV  AG W+  + + AGV VPLC + HAYV+     I   QNMPNVRDHD+SVYLRLQGDA+ +GG
Sbjct:   43 VPYAKTLKEDGGGAKDPGAPSKALPRHTSVVVVGGGSLGCQTLYHLAKAGVTDAVLLERDRLTAGTTWHTAGLLWQLRPSDTEVELLRHTRRVVSEDLERETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGIESHVLSPADTKVLYPLMNVDDLYGTLYVPGDGTMDPAGTCSTLARAATARGAQVIENCAVTGVRVEEDD----MGVAR--VRAVETQHGVIHTPCVVNCAGVWARKLGRMAGVNVPLCAMHHAYVLLFVLSIVVTQNMPNVRDHDASVYLRLQGDALSVGG 335          
BLAST of Sarcosine dehydrogenase vs. Ensembl Sea Lamprey
Match: amt (aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-041010-114])

HSP 1 Score: 63.5438 bits (153), Expect = 1.093e-10
Identity = 67/304 (22.04%), Postives = 130/304 (42.76%), Query Frame = 1
Query: 1630 HKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTAN-SNKPVGSIIYTCMCNEFGGTEADLTYTEIDTS----LPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQ-DMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGK----------SHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTC--KLKTDTNFLGRSALENQ 2484
            H+ +  R V    ++       ++I    L+TRE+ ++F++S+  +  + G D    ++ +  A+ +         + + N+ GG   DL  T+        + N G  + DL                  + +   L E +   + +D+   D  LL++QGP + ++LQ+    D    +F  S +  + + G+  CR  R  + GE G E+ +A ++A  +  ++++  +             V  AG  A DSL +E G   +  D+    TP+EA L +T   + + + NF G   +  Q
Sbjct:   39 HRQHGGRMVGFAGWSMPVQYKESLISSH-LHTRERCSVFDVSHMMQCKVLGRDAVAFMESLTVADVAGLKDDQATLSLLTNDAGGIVDDLIVTKTSKGHLHVVSNAGCADKDL------------------ARMRERLREFKSAGRDVDLEVVDAALLAVQGPATARVLQAGVSEDLGGLAFMHSAE--MSVFGVAGCRVTRCGYTGEDGVEISVAPEHAVGLVETLLQQQRLRRNVGGEEEEEVVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEAALLWTIGKRRRAEGNFPGAGVILGQ 321          
BLAST of Sarcosine dehydrogenase vs. Ensembl Yeast
Match: GCV1 (T subunit of the mitochondrial glycine decarboxylase complex; glycine decarboxylase is required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm [Source:SGD;Acc:S000002426])

HSP 1 Score: 53.9138 bits (128), Expect = 6.047e-8
Identity = 57/244 (23.36%), Postives = 105/244 (43.03%), Query Frame = 1
Query: 1723 TREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNK-PVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEE-KQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFS----NESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNA-GYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTC 2433
            TR  A +F++S+  +  L+GP + K +  +   + N  PVGS   + + N  GG   D   T+           N D     +Y+       +  + F ++ L+     +C+   + +   LL++QGPK++ +L+ +           E F     +    +G   +  R  + GE G+E+ IA + A      ++    ++ V+   G  A DSL +E G   +  +L    TP+EA L +  
Sbjct:   56 TRTNAGLFDVSHMLQSKLSGPHSVKFLQRVTPTDFNALPVGSGTLSVLLNPQGGVVDDTIITK----------ENDD---NEFYIVTNAGCAERDTEFFHDELQNGSTLDCQW-KIIEGRSLLALQGPKAKDVLEPLLSKTAPGKDLKELFFGQRHEFALKDGSLVQIARGGYTGEDGFEISIANEKAVEFAEQLL----ANPVMKPIGLAARDSLRLEAGMCLYGHELDESITPVEAALNWVI 281          
BLAST of Sarcosine dehydrogenase vs. Ensembl Nematostella
Match: EDO32193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT6])

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 494/901 (54.83%), Postives = 648/901 (71.92%), Query Frame = 1
Query:  103 RKIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWD--PKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWF-CNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKG--VHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            R +  + +  AT AK  VPYK     D   + +  S+P  ADVV+IGGG  G S LYHL K+GV N +L+E   +T+GTTWH++GL+W LRPSD E++++ ++ +L KSLE ETGV+ G+I+NGGLF+A+ +ERL+EY+RL TLG  + I S +L P  TK+L+PLMN KD++G LYSP DG IDPAG+ SAL +GAT  GA++ +   V  +    +     FG  R  V+ + T  G IKT  VV   GCW+P +   AGVKVPL  + HAY++SERIEGIQ+MPNVRDHD+SVYL+LQGD + IGGYE +PIFW+     +FAFSLF+LDW+VF V+I GA NRVPV+ +TG+KSTVCGPESFT DHKPLMGE+PE++G +L C +NSAG+ML+GGCGR++A W+ +G P LDM+ YDIRRF   IT N  W++ERSHEAYAKNYS+++ HDEPLAGR+M  D     LL  GC+YQER G+ERPGWF  ++KP+L  YDFYGSY++  H++Y Y+++L  +YTF+F  +H++IG E    R  AA+FNMSYF K+Y++G D +KAVDWIFTAN  K  GS+ YTCMCN+ GG EADLT + ++   P  G     P   G  +Y+A+GG V Q+  S + N++ EK F+ KL +V+ D+ +LS+QGPKSR+IL  ++D D S+E+F FST K+I I G P RALRL+FVGE+GWELHI +D    +Y ++++ G+ HG+VNAGYRAIDSLS EKGY+HWH DLR DDTPLEAGLGFTCKLK DT FLGR ALE Q   G+KK+L  F+L +   L GLEAI RNGE  GF+R  D+G  IDK+I YGYV    G  VT+ +++SG Y +E  G+ +S        FDP+N R+KG Y
Sbjct:   25 RVLARWESTDATEAKPAVPYKTLQSKD---SSTPSSVPAEADVVVIGGGSVGTSTLYHLTKMGVKNVILLERDKLTSGTTWHSAGLLWRLRPSDQEVEIIGHTRDLAKSLEEETGVSPGWIENGGLFIANNKERLDEYKRLMTLGHCYGIDSHVLDPKATKELYPLMNVKDLYGTLYSPGDGTIDPAGWASALTRGATKRGAKVFENCPVTGITTEVDD----FGVLR--VSGIDTVAGHIKTKNVVNCGGCWAPAVGAMAGVKVPLVAMHHAYIVSERIEGIQSMPNVRDHDASVYLKLQGDGLSIGGYEQNPIFWENVSVRNFAFSLFDLDWDVFSVHIEGACNRVPVIAETGVKSTVCGPESFTSDHKPLMGEAPELRGFYLGCGFNSAGIMLAGGCGRELAKWVVNGHPELDMYGYDIRRFHSSITGNQKWLSERSHEAYAKNYSMVFPHDEPLAGRNMRCDPFHQVLLDNGCVYQERHGWERPGWFKPDSKPQLKDYDFYGSYDRPSHEDYLYKDLLSQEYTFDFPPHHDIIGAEAKACRSNAAVFNMSYFAKYYISGLDAQKAVDWIFTANMQKKPGSVTYTCMCNKDGGVEADLTVSVLE---PGDGSTAALPHFDGNGFYVAIGGGVGQHSYSHLTNVIAEKGFDVKLEEVTNDLGMLSVQGPKSREILSKLTDADLSDEAFYFSTHKMINIAGHPVRALRLTFVGELGWELHIPRDSCVPVYRAVMEAGREHGIVNAGYRAIDSLSAEKGYKHWHQDLRHDDTPLEAGLGFTCKLKKDTPFLGREALEKQKAEGIKKRLVCFTLDQHKALLGLEAIRRNGEVCGFIRRGDWGFAIDKSIAYGYVYDPSGKPVTNEFIKSGSYTLESRGEIFSVEAILGAPFDPKNLRVKGQY 913          
BLAST of Sarcosine dehydrogenase vs. Ensembl Nematostella
Match: EDO40332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H8])

HSP 1 Score: 373.244 bits (957), Expect = 8.371e-115
Identity = 264/875 (30.17%), Postives = 437/875 (49.94%), Query Frame = 1
Query:  202 NKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQ----NMPNVRDHDSSVYLRLQGDAMGIGGYEP------HPIFWDPKP-DFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNH--NVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVS-SFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXX-XXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIK 2781
            NK L + A+VVIIGGG  G S  YHLAK G+ + VL+E S +TAG+TWH +GL  +  P      L  YS +L + LE+ETG   G+   G L + +T ER +E +   +          ++ P E +K+ P+MN   + G L++P DG IDP     AL  GA   GA +     V  + + ++      GR       V T+ G I+   V+ +AG W+  I K AGV+ P+  + H Y+++  I  +Q     +P +RD + S YLR++   +  G YE          +WD  P  F   L+E D +    N+  A+ R PVL    I S VCGP +++PD   ++G   E+  +++       G++ SGG G+ ++ WI  G P  D+   D  R+ +  T   ++++ ++ E+Y  N  I++   E   GR M    +++  L+QG       G+E+P WF        P D                   EG Y  +F + +    +G+E      +  + ++S FGKF +TG DTK  +D +F ANS   +G+   + +    G   A++T + +               G  +YL + G+  ++    ++     E  ++    +++  +  L + GPK+R +LQ ++  D S+  F F   K I++ G+P RA+R+S+ GE+GWEL+ +K++   +YN+I++ G+  G+ N G  A+ +L +EKG+R W  ++  D TPLEAGL F  K     NF+GR AL  Q + G+K++L  L          G E+I   G+ VG   +  + + ++ +I + Y+  L+ +T+ S        E+E +G++  A   ++ LFD E  R +
Sbjct:   46 NKKLKEDAEVVIIGGGCLGVSTAYHLAKRGLKDVVLLEKSELTAGSTWHAAGLTTYYNPGINMKHLHYYSIKLFEQLEAETGQEVGFHTPGSLRIFTTPERFDEGRYQMSRHGWHKAPQWLVTPDEIQKMVPIMNMDGVLGGLFNPGDGHIDPYSLTQALAIGARMHGAEIYMPAPVKGLNLRQD------GRW-----DVKTDHGVIRAKHVLNAAGFWAREIGKLAGVEYPVTPIHHQYMVTSSIPEVQALEKEIPVIRDLEGSYYLRMERGGLLTGPYEDMDKMRLQEDWWDGVPAGFGKELYESDLDRLSDNLDYAMARFPVLANADISSVVCGPITYSPDVLAMLGPDIELPNMWVAIG-TGYGIIHSGGIGKYLSDWIIDGEPQYDLNELDPGRYGKWFT--KEYVHTKARESYGLNNQILHPKMERFRGRPMRTSGIYERTLEQGAEMGFHVGWEQPNWFVK------PGD-------------------EGGYKPSFRRTNWFEPVGREVDLVLNRVGVIDVSPFGKFEVTGKDTKIFLDVMF-ANSLPKIGTTNISHLLTPRGRVYAEMTVSAL---------------GEDHYLLLTGSGSEFHDLRWLKKHATEGGYDVTFENLTDKVDTLGVAGPKARDVLQKLTTEDMSHGKFKFLNVKDIEMAGVPVRAIRISYTGELGWELYCSKEHTLKLYNAIMEAGQEFGIDNFGTFAMTTLRVEKGFRAWGLEMNLDTTPLEAGLDFFIKFDKGVNFIGREALLKQKEEGVKRRLCMLTVETTDTDPEGNESIWFGGKVVGNTTTGTYSYTMNTSISFAYL-PLELTTLGS------RVEVEILGQKCPATVVKEPLFDTEPVRTR 858          
BLAST of Sarcosine dehydrogenase vs. Ensembl Nematostella
Match: EDO41600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3V0])

HSP 1 Score: 346.28 bits (887), Expect = 7.973e-106
Identity = 237/812 (29.19%), Postives = 403/812 (49.63%), Query Frame = 1
Query:  370 LRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPL-MNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAK--TAGVKVPLCTLKHAYVISERIEGIQN-MPNVRDHDSSVYLRLQGDAMGIGGYEP--HPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC---NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKIN-GLPCRALRLSFVG--EMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSA---LENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRY--SANFHQKT 2751
            +R +  E QL +Y  +L   LE ETG+ TG+   GG+++A T+ER+  Y+R     + ++I +E++ P   ++L+P+ +N  DI G L+ P +GV +P+  C +L +GA   G R+ + V++ +V                 V  V T+ G IK +  +  AG W+  + +  +  V VP+   +H Y++++ +EG+ + +PN+RD D  +Y R     +  GG+EP   P F +  PD F F L   DW+ F V +   ++RVP L    I+  V GPESFTPD + ++GE+PEV+  F+     S+G+  + G G+ ++ WI  G P++D++  DIRRF     +N  ++ +R  E    +Y + Y + E    R +    L+ +L   G ++ ER G+ERP WF      K EL       ++ K       +RNV        ++  HN +           A+ +M+  G F ++     + +  +   +   P+G I+ T + N+ GG E + T   +  +  N+           Y + V  A      ++I+  +  +  +  L D+    V+L + GP S ++LQ  + TD +++ +P  T K + +      +A + + VG  E GW+L I  +YA  +Y+ + K GK+  + N G  A+D+L +EKGY     +L P   P +AGL     +  +  F+GRSA   L++Q        +++    +     G E I+RNGE VG   SA F   ++  +  GYV    G  V+  Y+  G +EI+  G+RY   A  H+ T
Sbjct:    1 MRSTMAETQLSNYGTDLYSRLEEETGLGTGFKTLGGVYLARTKERMTLYKRNLAKCQAYDIKAELISPQRCQELWPVELNLDDIQGGLWVPEEGVANPSDICQSLARGAIMNGVRIYEKVQLQSVTTDGQY-----------VDGVKTDKGDIKCDIFINCAGQWAREVGQKSSPAVSVPIHACEHFYIVTKTVEGVHSTLPNMRDPDGHIYFREWSGGLMAGGFEPVSKPCFHESVPDKFEFQLLPEDWDHFEVLMEQMLHRVPALHNAEIRQLVNGPESFTPDGQYILGEAPEVRNYFVAAGMCSSGIASAAGVGKALSEWITEGHPTMDLWPVDIRRFGNHF-NNKQFLRDRVRETLGWHYVMRYPYSEKQTARGVKCSPLYAQLDSAGAVWGERMGWERPRWFQLDEEGKTELQVVPSTNAFGKPAF----FRNV-----QVEYAACHNSV-----------ALVDMTSVGLFEIS-----QFMQTLCARDVGVPIGHIVQTALLNKRGGYELECT---VARTAENR-----------YIIMVPTAHTVLAQNWISRHIPNRS-SITLRDIQSGFVVLGVLGPMSAELLQGFTTTDLTSD-YPIDTFKELSLGFASDVKAFKRTNVGDLEQGWQLIIPTEYASGLYSQLTKAGKAMDIRNVGCYAVDALRVEKGYPRLGIELTPFVNPFQAGLESRICMFKNEEFIGRSALLSLQDQPITKRLLFMAMEEHDDTNIPWGGEPILRNGEIVGTTSSASFSFTLNAPVCMGYVSNA-GHPVSDEYIRDGKFEIDVAGQRYPLRAAIHKFT 758          
BLAST of Sarcosine dehydrogenase vs. Ensembl Nematostella
Match: EDO46472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ00])

HSP 1 Score: 340.117 bits (871), Expect = 4.358e-103
Identity = 263/876 (30.02%), Postives = 417/876 (47.60%), Query Frame = 1
Query:  211 LPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAG--VKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEP--HPIFWDPKP-DFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWF---CNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDW---IFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKIN-----GLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLH---GLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIK 2781
            LP  A +VI GGGV GCS  YHLAK G  + VL+E  +++ GTTWH +G++  LR ++ E ++  Y+      LE ETG  TG+ + GGL +A T +R    +R+    + F I  +++ P E K+ FP M   D+ G L+ P +GVI P+  CS+  KGAT       +GVK+      K + + +    R +VT V T+ G I     V  AG W+  +       V +PL  ++H Y+I++ I     +P +RD D  VY R  G  +  GG EP   P+F    P  F F LF+ DW+ F   +G  I+R+P +E+T I+  V GPESFTPD + +MGE+P V+  F+     + G+  + G GR ++ WI  GRP L++   DI+RFS    +N  ++ ER        YSI Y   E    R +   VL+  L + G  + ER G+E P WF    N+K        +G      +   EYR   EG                         + +++  G   +   D    VD    +   +++ P+  +++T M N  GG E   T      + PN+            +L +  A   Y+   I+ +      +  + D+  +  +L + GP SR ++Q ++ T    E FP  T ++I I+      L C + +L+   + GW L +  D   ++Y  +    K+ G  + G+ A+D+++ EKG     A++ P  TPLEAGL    K      F G+ AL  +    L K+L+   +K+    +   G E IV NG+ +G + S+ +     + + +  V + DG  +T+ +L+         GKR   N   + +FD E   +K
Sbjct:    4 LPTQAQIVIGGGGVWGCSVAYHLAKEGWKDIVLLEQGSLSGGTTWHAAGILGKLRGTEVETRISDYAATCYSQLERETGQETGFKKCGGLLLARTRDRFTLLKRMLVKARAFGIELDLISPEEAKEKFPFMRADDVKGALWLPDEGVISPSDLCSSFGKGAT------LNGVKIHQ----KTAIAEVLTDGR-DVTGVRTDKGDISCQIFVNCAGMWARQLGLKCASPVHIPLHPVEHFYIITQPIGASHMLPMLRDPDGHVYFREWGGGICAGGLEPIAKPVFTQGVPRHFEFQLFQEDWDQFECLMGEIIHRIPEMERTEIRQMVNGPESFTPDGRCIMGEAPNVRNYFVAAGACTNGIANAAGVGRLLSEWITKGRPPLNVSCLDIKRFSHH-HNNLSYLRERIRGMVGYQYSIPYPRRECSFARPLKCPVLYTLLDEAGASWGERMGWETPNWFRIDNNSK----TLGTFGRPPWLANVEQEYRACKEG-----------------------VGLVDLTSTGILEIKSQDVHGCVDLLQKLCIDDADIPINGVLHTAMLNHDGGFELQCTLVR---THPNR------------FLLL--AKPSYLVRAISWVTRHAADDVTVTDLQSNCSILGVLGPTSRDLMQPLTQTPLGIEEFPVDTCQVIDIDFACDVTLICSS-QLAASND-GWLLLVPNDVITTLYRKL----KNCGARDVGWYAVDAITEEKGMPGLGAEIHPWITPLEAGLDSADK---KLEFYGKDALAKKRDKPLTKRLAFVKVKQNDDDYFPWGGETIVHNGDVIGMVTSSVYSFAQGRPVCFALVEK-DGEEITADFLQ---------GKRLQMNIAGQ-MFDVEADFVK 803          
BLAST of Sarcosine dehydrogenase vs. Ensembl Nematostella
Match: EDO31336 (Aminomethyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SY95])

HSP 1 Score: 80.4925 bits (197), Expect = 4.613e-16
Identity = 69/266 (25.94%), Postives = 124/266 (46.62%), Query Frame = 1
Query: 1717 LNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSN---KPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKL-IDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTC--KLKTDTNFLGRSALENQAKN 2493
            L+ R+ AAIF++S+  +F L G D  K ++ +  A+        G++  +   N+ GG   DL   ++D  +               Y+         ++  + + L+    N  + +++ +D  L+++QGPK+ Q+LQ   D D S+ +F         + GL   R  R  + GE G+EL + KD    +  S++   ++  V  AG  A DSL +E G   +  D+  D TP+EA L +T   + + + +F G   +  Q K+
Sbjct:   38 LHVRQHAAIFDVSHMLQFKLHGKDRTKFLEDLVVADVQGLQSNTGTL--SLFTNDNGGIRDDLIINKLDDVI---------------YVVSNAGCADKITQHLKDRLDAVSGNLDVALEILEDKALVALQGPKAAQVLQGGVDGDLSHLTFMHGVS--TSVYGLKDVRVTRCGYTGEDGFELSVDKDRVVDLCRSLMSRQEAE-VKLAGLGARDSLRLEAGLCLYGNDIDEDTTPVEAVLVWTIGKRRRAEASFPGAKIILQQIKD 283          
BLAST of Sarcosine dehydrogenase vs. Ensembl Medaka
Match: sardh (sarcosine dehydrogenase [Source:NCBI gene;Acc:101171504])

HSP 1 Score: 1042.34 bits (2694), Expect = 0.000e+0
Identity = 501/889 (56.36%), Postives = 658/889 (74.02%), Query Frame = 1
Query:  136 TNAKSGVPYKNTHKND-GNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELM-KSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPD-FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFC-NTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            TN K+ VPY+ T K + G  +   K LP+SADVV+IGGG  GC  +YH+AK+G+TN VL+E   +TAGTTWHT+GL+W LRPSD E++LL+++  ++ K LE ETG++TG+IQNGGLF+AS ++RL+EY+RL +LGK++ I S +L P+ETK L+PLMN  D++G LY P DG +DPAG C+ L + A+  GA + +   V  ++V  +           +V +V T  G+I+T CVV  AG W+  +   AGVKVPL  + HAYV++ERIEGIQNMPNVRDHD+SVYLRLQGDA+ +GGYE +PIFW+   D FAFSLF+LDW+VF  +I GAINRVPVLE+TGIKSTVCGPESFT DHKPLMGE+PEV+G FL C +NSAGMML GGCGR++AHWI HGRP  DM+ YDIRRF   +TDN+ WI ERSHE+YAKNYS+ +  DEPLAGR+M KD     L +QGC++QER G+ERPGWF  +    +  YDFYG+Y K ++ +Y+Y  +L  +YTF+F  +HNVI  ECL+ R   A+F+MSYFGKFYLTGPD KKA DW+FTA+ NK  GS +YTCM N+ GG EADLT + ++ S  N  +  P+  G  YYLA+GG V ++  + I  +L+++ F C+L D+S+DM ++SIQGPKSR +LQ + DTD SNE+FPFST K++   G   RA+RLSFVGE+GWELHI K+    +Y +++  G  H ++N+GYRAIDSLSIEKGYRHWHADLRPDDTPLEAGL FTCKLK+   F GR  LE Q K GL++++  F++ E + + GLEAI RNG  VG LR +DFG YI+K +GYGY+   DG  V++ +++SG++ +E+MG  Y A  H K+ FDPENKR++G+Y
Sbjct:   35 TNEKN-VPYEMTLKQESGAASGPTKPLPRSADVVVIGGGSLGCQTIYHVAKMGMTNVVLLERDRLTAGTTWHTAGLLWQLRPSDVEVELLAHTRNVISKDLEEETGLHTGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESYVLSPAETKDLYPLMNVDDLYGTLYVPKDGTMDPAGTCTTLTRAASARGATVIENCPVTGIQVRTDDLGV------KKVKAVETAHGTIETQCVVNCAGVWATKLGDMAGVKVPLIAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEQNPIFWEEVNDKFAFSLFDLDWDVFMQHIEGAINRVPVLEQTGIKSTVCGPESFTADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGRELAHWIIHGRPERDMYGYDIRRFHHSLTDNNRWIRERSHESYAKNYSVAFPFDEPLAGRNMRKDPFHQILTEQGCVFQERHGWERPGWFNKDGAAPVKDYDFYGAYGKRKNTSYKYSELLAKEYTFDFPPHHNVIKSECLSCRHGVAVFDMSYFGKFYLTGPDAKKAADWLFTADVNKKPGSTVYTCMLNKRGGAEADLTVSRLEPSAANLPL-APESNGDGYYLAIGGGVAEHNWNHIQTVLQDQGFRCQLTDLSEDMGMISIQGPKSRDVLQEVLDTDLSNEAFPFSTHKVVTAAGHQVRAMRLSFVGELGWELHIPKNSCIPVYQAVMAAGAKHDIINSGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAFTCKLKSSIPFQGRDRLEKQKKEGLRRRIVCFTVNETVPMFGLEAIFRNGVPVGHLRRSDFGFYINKTLGYGYIRNPDGGVVSAEFIKSGEFTLERMGVTYKAEAHLKSPFDPENKRVRGIY 915          
BLAST of Sarcosine dehydrogenase vs. Ensembl Medaka
Match: si:cabz01113374.3 (pyruvate dehydrogenase phosphatase regulatory subunit [Source:NCBI gene;Acc:101161388])

HSP 1 Score: 377.096 bits (967), Expect = 1.453e-115
Identity = 273/887 (30.78%), Postives = 428/887 (48.25%), Query Frame = 1
Query:  187 NQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVK--VPLCTLKHAYVISERIEGI--QNMPNVRDHDSSVYLRLQGDAMGIGGYE--PHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYL--TGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKI---NGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGL-----EAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGS-----TVTSGYLESGDYEIEKMGKRYSAN---FHQKTLFDPENKR 2775
            N +     +P  A VVI GGG+ G S  YHLAKLG T+ VL+E   + AGTT   +G+V   +P   E Q+ SYS  L + LE ETGV TGY++ G L +A  ++RL   +RL +  K+  I   I+ P E  KL PL+N  D+ G L+ PSD V+       AL   A   G ++ +   V  V V K             V +V T+ GSI+ +  V  AG W+  + + + VK  VPL   +H Y++++ ++     +MP V D D  +Y R     +  GG E  P PIF + +        + DW+ F   +   + R+P L+   I   V  PESFTPD + LMGE+P V G ++    NS+G+  +GG G+ +A W+ +G P+ +++  DI+RF   +  +  ++  R  E     Y +     +   GR +    L+D L  QG  + E+ GFERP +F     +LL  D        Q K            TF      +++G E    +E   + +MS F KF L  TG    + +  +   + + PVG I++T M NE GG E D +                 L+   +++        +  S+I   +     +  L +VS     L++ GP++  +L  +S    + + FP    K + +   NG+  R + ++  GE G+ L+I  +YA  +YN ++ VG+ +G+ NAGY A+ SL IEK +  W  DL    TPLE G  F  K   DTNFLGR AL  Q + G+ ++  +  L++      L     E I RNG+  G   S+ + + +++ +  G+V            +T  ++  GDYE++  G+RY A    +   +LF  + +R
Sbjct:   43 NGSSQQPPVPSRARVVICGGGIVGTSVAYHLAKLGWTDVVLLEQGRLGAGTTRLCAGIVSMAKPISIECQMASYSASLYQRLEKETGVKTGYVKTGSLCLAQNQDRLISLKRLASRLKVLGINCSIIKPKEAAKLQPLVNIHDLVGALHLPSDAVVSSPDVNHALAVAAAGHGVQILEQTTVQQVVVEKG-----------HVKAVETDRGSIECDYFVNCAGQWAYELGQASEVKVSVPLHGCEHFYLLTKPLQEPVSPDMPVVIDMDGRIYARPWQGGILSGGLEKNPKPIFTEGRNQLEIQNMQEDWDHFEPILSALLRRMPSLDSAEIHQLVNCPESFTPDMRCLMGETPGVSGYYVLAGMNSSGLTFAGGAGKYLAEWMTYGYPTANVWLLDIKRFGN-LQSSRTFLRHRVMEVMPLLYELKVPRWDFQTGRQLRTSPLYDRLDTQGARWMEKHGFERPKYFIPPGKDLLSLD--------QSK------------TFYKPDWFDIVGAEVKCCKEAVCVIDMSSFTKFELTSTGDQALELLQHLCANDPDVPVGHIVHTGMLNERGGYENDCSVVR--------------LSKNCFFIISPTDQQVHCWSWIKKHMPNDP-HLHLENVSWKYTALNLIGPRAMDVLAELSYVSMTPDHFPSMFCKEMSVGYANGI--RVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLDAFTTPLECGREFRVKFDKDTNFLGREALLQQRQEGVFRRFVMLVLEDHDTELDLWPWWGEPIYRNGQLAGTTTSSAYSYTLERHVCLGFVSPPPDEEGLPKPITPDFINRGDYELDIAGQRYPAKAKLYPFSSLFAQQKRR 880          
BLAST of Sarcosine dehydrogenase vs. Ensembl Medaka
Match: dmgdh (dimethylglycine dehydrogenase [Source:NCBI gene;Acc:101169624])

HSP 1 Score: 353.214 bits (905), Expect = 1.706e-106
Identity = 263/873 (30.13%), Postives = 431/873 (49.37%), Query Frame = 1
Query:  220 SADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPN----VRDHDSSVYLRLQGDAMGIGGYEPHP--IFWDP------KPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGR-SMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNH--NVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSAL-ENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVG-RLD--GSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIK 2781
            +AD VIIGGG  G S  YHLAK G+ + VL+E S +TAG+TWH +GL  +  P     ++   S +L ++LE ETG   G+ Q G + +AST  R++E +   T           + P + ++LFPL+N   +   LY+P DG IDP     AL  GA   GA++ +   V  +    +    +   Q P         G+I+ N +V +AG W+  + +  G   P   + H YV++  +  ++ +      +RD + S YLR + D +  G YE     +  D        P F   LFE D +    +I  A+  VPVL+K  I + V GP ++TPD  P++G    V   +    +   G++ +GG G+ ++ WI++G P  D+   D  R+  + TD   ++  ++ E+Y  N  + Y  +E  AGR +  +  ++D L  +G M     G+E+P WF        P D  G                   Y  +F + +    +G+EC    EK  + +++ FGKF + G D+ K +D +F AN+   VG    + M    G   A++T T+              LT   + L  G     +   +I     E+ ++ ++ +V+  + +L I GP SR +LQ ++D D S+ +F F   K +++ G+P RA+R+S+ GE+GWEL++ ++   ++Y ++++ GK  G+ N G  A+ SL +EKG+R W A++  D  PLEAGL +  KL    +F+G+ AL E +AK   +K   L    ++I   G E I  NG+ VG   S  + +   +++ +GY+   L+  G TV          E+E +GK+Y A   Q+ L   E  R +
Sbjct:  102 TADTVIIGGGCVGVSLAYHLAKSGLKDVVLLEKSELTAGSTWHAAGLTTYYHPGINLKKVHYDSIKLYETLEEETGQAIGFHQPGSVRIASTAARVDEMKYQMTRAHWHVTPQYFITPEKVQELFPLLNMDKVLAGLYTPGDGHIDPYSLTMALAAGARMYGAQIYNPAPVRALTPRSDGKWDV---QTPH--------GTIQANRIVNTAGFWAREVGQMIGFDHPTIPVHHQYVVTATVPEVKALKKELAVIRDLEGSYYLRQERDGLLFGPYEKMEKMVLQDSWVRDGVPPGFGKELFESDLDRIMEHIEMAMEMVPVLKKANIINVVSGPITYTPDLLPMVGPHQGVPNYWTAIGFGY-GVIHAGGIGKFLSDWIRNGEPPYDLIECDPNRYG-KWTDV-PFMCAKARESYGFNNVVGYPKEERFAGRPTSRRSGVYDLLKDKGSM-GFHAGWEQPHWFYK------PGDDIG-------------------YKPSFCRTNWFGPVGRECKLVMEKVGVIDLTPFGKFIVKGKDSLKLLDRLF-ANTMPKVGHTNISHMLTPSGKVYAEVTITQ--------------LTPGEFLLITGSGSELHDLRWIEA-EAERGYDVEISNVTDQIGVLGIAGPNSRSVLQKLTDEDLSDSAFKFLQCKTVQLAGVPVRAIRISYTGELGWELYMEQENMVAVYRAMMEAGKDQGIDNFGTYAMASLRLEKGFRGWGAEMNCDTNPLEAGLDYFIKLNKPADFIGKKALKEIKAKGLKRKLSYLAVQTDEIDPEGNETIWHNGKVVGNTTSGAYSYSSQQSLAFGYLPVELNSVGQTV----------EVELLGKKYPATVIQEPLVLTEPTRTR 908          
BLAST of Sarcosine dehydrogenase vs. Ensembl Medaka
Match: dmgdh (dimethylglycine dehydrogenase [Source:NCBI gene;Acc:101169624])

HSP 1 Score: 234.958 bits (598), Expect = 1.145e-64
Identity = 171/578 (29.58%), Postives = 288/578 (49.83%), Query Frame = 1
Query: 1069 FAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGR-SMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNH--NVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSAL-ENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVG-RLD--GSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIK 2781
            F   LFE D +    +I  A+  VPVL+K  I + V GP ++TPD  P++G    V   +    +   G++ +GG G+ ++ WI++G P  D+   D  R+  + TD   ++  ++ E+Y  N  + Y  +E  AGR +  +  ++D L  +G M     G+E+P WF        P D  G                   Y  +F + +    +G+EC    EK  + +++ FGKF + G D+ K +D +F AN+   VG    + M    G   A++T T+              LT   + L  G     +   +I     E+ ++ ++ +V+  + +L I GP SR +LQ ++D D S+ +F F   K +++ G+P RA+R+S+ GE+GWEL++ ++   ++Y ++++ GK  G+ N G  A+ SL +EKG+R W A++  D  PLEAGL +  KL    +F+G+ AL E +AK   +K   L    ++I   G E I  NG+ VG   S  + +   +++ +GY+   L+  G TV          E+E +GK+Y A   Q+ L   E  R +
Sbjct:  303 FGKELFESDLDRIMEHIEMAMEMVPVLKKANIINVVSGPITYTPDLLPMVGPHQGVPNYWTAIGFGY-GVIHAGGIGKFLSDWIRNGEPPYDLIECDPNRYG-KWTDV-PFMCAKARESYGFNNVVGYPKEERFAGRPTSRRSGVYDLLKDKGSM-GFHAGWEQPHWFYK------PGDDIG-------------------YKPSFCRTNWFGPVGRECKLVMEKVGVIDLTPFGKFIVKGKDSLKLLDRLF-ANTMPKVGHTNISHMLTPSGKVYAEVTITQ--------------LTPGEFLLITGSGSELHDLRWIE-AEAERGYDVEISNVTDQIGVLGIAGPNSRSVLQKLTDEDLSDSAFKFLQCKTVQLAGVPVRAIRISYTGELGWELYMEQENMVAVYRAMMEAGKDQGIDNFGTYAMASLRLEKGFRGWGAEMNCDTNPLEAGLDYFIKLNKPADFIGKKALKEIKAKGLKRKLSYLAVQTDEIDPEGNETIWHNGKVVGNTTSGAYSYSSQQSLAFGYLPVELNSVGQTV----------EVELLGKKYPATVIQEPLVLTEPTRTR 825          

HSP 2 Score: 103.605 bits (257), Expect = 3.873e-22
Identity = 74/212 (34.91%), Postives = 110/212 (51.89%), Query Frame = 1
Query:  220 SADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAG 855
            +AD VIIGGG  G S  YHLAK G+ + VL+E S +TAG+TWH +GL  +  P     ++   S +L ++LE ETG   G+ Q G + +AST  R++E +   T           + P + ++LFPL+N   +   LY+P DG IDP     AL  GA   GA++ +   V  +    +    +   Q P         G+I+ N +V +AG
Sbjct:  102 TADTVIIGGGCVGVSLAYHLAKSGLKDVVLLEKSELTAGSTWHAAGLTTYYHPGINLKKVHYDSIKLYETLEEETGQAIGFHQPGSVRIASTAARVDEMKYQMTRAHWHVTPQYFITPEKVQELFPLLNMDKVLAGLYTPGDGHIDPYSLTMALAAGARMYGAQIYNPAPVRALTPRSDGKWDV---QTPH--------GTIQANRIVNTAG 302          
BLAST of Sarcosine dehydrogenase vs. Ensembl Medaka
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:101170344])

HSP 1 Score: 64.6994 bits (156), Expect = 2.314e-10
Identity = 69/270 (25.56%), Postives = 119/270 (44.07%), Query Frame = 1
Query: 1717 LNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTAN-SNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQ---DMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYA-----KSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTC--KLKTDTNFLGRSALENQAK 2490
            ++TRE  +IF++S+  +  + G D  K ++ +  A+ +         +   NE GG   DL  T+ D              G  Y ++  G   +     ++  +   +F    +DV     D  LL++QGP   ++LQ     + +  +F  ST  +  + G+P CR  R  + GE G E+ +++  A     K + NS +K+        AG  A DSL +E G   +  D+    TP+EA L +T   + + D +F G   +  Q K
Sbjct:   82 MHTREHCSIFDVSHMLQTKVHGKDRVKFMESLVVADIAELKTNQGTLSLFTNEKGGIIDDLIVTKTDQ-------------GYLYVVSNAGCAEK---DSVHMKVRLAEFKAAGLDVDLEFLDEALLAVQGPSMSRVLQEGLKDNLNKLTFMTST--VATVFGVPDCRITRCGYTGEDGVEISVSRLRAVELIEKLLANSEVKL--------AGLAARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRKDKDFPGAEIVVPQIK 325          
BLAST of Sarcosine dehydrogenase vs. Planmine SMEST
Match: SMESG000068610.1 (SMESG000068610.1)

HSP 1 Score: 1825.06 bits (4726), Expect = 0.000e+0
Identity = 894/899 (99.44%), Postives = 897/899 (99.78%), Query Frame = 1
Query:   94 PTERKIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            PTE KIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADVVIIGGGVSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFN+YSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGA+HLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEV+SVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKA DWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGLKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY
Sbjct:   11 PTESKIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADVVIIGGGVSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNVYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGASHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVSSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAADWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGLKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 909          
BLAST of Sarcosine dehydrogenase vs. Planmine SMEST
Match: SMESG000068610.1 (SMESG000068610.1)

HSP 1 Score: 1811.58 bits (4691), Expect = 0.000e+0
Identity = 894/920 (97.17%), Postives = 897/920 (97.50%), Query Frame = 1
Query:   94 PTERKIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADXXXXXXXXSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIR---------------------RFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXXXXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 2790
            PTE KIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADVVIIGGGVSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFN+YSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGA+HLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEV+SVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIR                     RFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKA DWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGLKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY
Sbjct:   11 PTESKIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSLPKSADVVIIGGGVSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNVYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGASHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVSSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMPNVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRFINFICLIKIEISVGKDTNSKRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAADWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGLKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDPENKRIKGVY 930          
BLAST of Sarcosine dehydrogenase vs. Planmine SMEST
Match: SMESG000042264.1 (SMESG000042264.1)

HSP 1 Score: 333.569 bits (854), Expect = 4.832e-100
Identity = 236/815 (28.96%), Postives = 401/815 (49.20%), Query Frame = 1
Query:  256 GCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLVWHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNEYQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPAGYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITNVGSIKTNCVVLSAGCWSPLIAKTAGVK--VPLCTLKHAYVISERIEGIQNM----PNVRDHDSSVYLRLQGDAMGIGGYE-PHPI------FWDPKPDFAFSLFELDWNVFGVNIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAYNSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINERSHEAYAKNYSIIYKHDEPLAGRSMMK-DVLFDELLQQGCMYQERQGFERPGWFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSF-INNILEEKQF--NCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLGRSALENQAKNGXXXXXX-XXXXXEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYV 2646
            G SA YHLAK G+ N VL+E S +T+G+TWH +GLV   + S    ++   S  L K LE ETG +  + + G L + ST  R++E +   +     +    ++GP +  +L P +N + I G +Y+P DG IDP     AL  GA   GA +   V+VL V++  +            +  V T  G++ T  ++ ++G W+  ++K  G+   +P+  ++H Y I++ +  ++++    P +RD + S YLR +     +G YE P  +       ++  P+F   LF+ +      NI  AI  VP L    I + V GP ++   + PL+G    +   +    +   G+  SGGCG  I H+I HG P  ++   D  RF    T   ++   ++ E Y  N S  Y  +E  AGR   +   L+D   + G       G+E+P WF  TK E            E +K            +F  S     + +EC    E   + +++ F KF ++G   K+ +D + TAN    V +   T M +  G   ++LT T+               T    +LA+ GA  ++   + + N+  +K +    KL +++    +L I GP+SR+ LQS+ DTD S++++ F   +  KI+ +P   +R+S+ GE+GWE++   +    ++  +   G+++ ++N G  A++SL IEKG+R W  D+  D  P+EAGLGF  K K + +F+G++++    KN +KKKL  L    E +   G E++  N + VG + S  +G  ++K++   Y+
Sbjct:   52 GVSAAYHLAKYGIKNVVLLEKSELTSGSTWHAAGLVTTFQTSINAKKINMNSVNLFKQLEKETGQDVSFHKPGSLRLLSTPLRMDEAKYQMSRHYWNDAEQYLIGPEKVMELCPFLNPQKILGGIYNPGDGHIDPNSLTQALATGARKYGADIYPRVEVLGVQLRNDG-----------LWDVSTKYGTLTTKHLINASGFWAAQVSKMCGISHYIPIVPVQHQYFITKDVPELKSLKCEFPVLRDLEGSYYLRQERQGFLVGPYEEPDRMETCKDWVYEKIPEFDKELFQGNLERIMPNIEKAIEMVPSLANVEISTVVNGPITYNCQNTPLLGPVQGIPNFWQMIGF-GYGIAQSGGCGHYIGHYICHGEPPHELNDLDAERFGRWCTK--EFALAKARETYGLNNSPTYPKEERWAGRPSPRCGPLYDLQKKLGAQMGYVAGWEKPLWFSKTKNE------------EGYKP-----------SFRRSNWFTAVERECRGVIENVGLIDLTSFAKFLISGEKAKEFLD-LATANKIPNVKNTCITHMLSRKGKVYSELTLTQ---------------TEENKFLAITGATSEFHDLWWLENLARQKGYWNEIKLENITDRYGVLGIAGPRSREYLQSLVDTDLSSQNYKFLQFRRCKISDIPVNLIRISYTGELGWEIYCPMECLAKLFQILQNHGQAYNLINFGGYAMNSLRIEKGFRMWGNDMTMDTNPIEAGLGFFVKHKKEVDFIGKASVGEILKNPIKKKLVFLQIDTENVDAEGDESVFLNDKVVGNVTSGSYGFQVNKSLAMAYL 813          
BLAST of Sarcosine dehydrogenase vs. Planmine SMEST
Match: SMESG000012592.1 (SMESG000012592.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.090e-9
Identity = 67/258 (25.97%), Postives = 114/258 (44.19%), Query Frame = 1
Query: 1687 KNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSN---KPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILE-EKQFNCKLIDVSQDMV---LLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCK 2436
            K+H++I       REK  +F++S+  +F + G + KK +  I   + +      GS+  +   NE GG   D+                   T  TYY  V  A     +   N++L  E++F  +  ++  + V   L+++QGPK   +LQ     D S +   F       + G+P CR  R  + GE G E+ ++K  A+ +   ++    +  V+  G  A D+L +E G   +  D+    TP EA L +T K
Sbjct:    6 KSHSIIDSHKW-VREKCGLFDVSHMLQFKIHGENRKKFIHSITVIDMDDFEPDYGSL--SLFTNENGGIMDDVIINN---------------TCGTYYYGVSNA--GCATKIKNHLLAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQ--PGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLL---SNENVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIK 238          
BLAST of Sarcosine dehydrogenase vs. Planmine SMEST
Match: SMESG000012592.1 (SMESG000012592.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.211e-9
Identity = 67/258 (25.97%), Postives = 114/258 (44.19%), Query Frame = 1
Query: 1687 KNHNVIGKECLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSN---KPVGSIIYTCMCNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSFINNILE-EKQFNCKLIDVSQDMV---LLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCK 2436
            K+H++I       REK  +F++S+  +F + G + KK +  I   + +      GS+  +   NE GG   D+                   T  TYY  V  A     +   N++L  E++F  +  ++  + V   L+++QGPK   +LQ     D S +   F       + G+P CR  R  + GE G E+ ++K  A+ +   ++    +  V+  G  A D+L +E G   +  D+    TP EA L +T K
Sbjct:   14 KSHSIIDSHKW-VREKCGLFDVSHMLQFKIHGENRKKFIHSITVIDMDDFEPDYGSL--SLFTNENGGIMDDVIINN---------------TCGTYYYGVSNA--GCATKIKNHLLAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQ--PGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLL---SNENVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIK 246          
The following BLAST results are available for this feature:
BLAST of Sarcosine dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SARDH0.000e+056.09sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
SARDH0.000e+056.09sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
SARDH0.000e+061.26sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
SARDH0.000e+056.85sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
SARDH2.441e-12652.30sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdpr-13.661e-7426.64Pyruvate Dehydrogenase Phosphatase Regulatory subu... [more]
Y37E3.174.560e-6224.55pep chromosome:WBcel235:I:2128590:2145971:1 gene:W... [more]
Y37E3.173.320e-6124.33pep chromosome:WBcel235:I:2128590:2145968:1 gene:W... [more]
gcst-15.990e-1525.55Aminomethyltransferase [Source:UniProtKB/TrEMBL;A... [more]
gcst-15.990e-1525.55Aminomethyltransferase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Sardh0.000e+046.60gene:FBgn0034276 transcript:FBtr0089560[more]
CG36261.261e-8927.75gene:FBgn0029706 transcript:FBtr0070652[more]
CG64152.326e-1323.99gene:FBgn0032287 transcript:FBtr0080108[more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sardh0.000e+056.15sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
sardh0.000e+056.15sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
sardh0.000e+056.15sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
sardh0.000e+056.15sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
sardh0.000e+054.98sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SARDH0.000e+052.50sarcosine dehydrogenase [Source:NCBI gene;Acc:1004... [more]
SARDH0.000e+050.00sarcosine dehydrogenase [Source:NCBI gene;Acc:1004... [more]
SARDH0.000e+050.66sarcosine dehydrogenase [Source:NCBI gene;Acc:1004... [more]
SARDH0.000e+050.72sarcosine dehydrogenase [Source:NCBI gene;Acc:1004... [more]
stil9.193e-10828.41STIL, centriolar assembly protein [Source:Xenbase;... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sardh0.000e+056.33sarcosine dehydrogenase [Source:MGI Symbol;Acc:MGI... [more]
Pdpr2.724e-10730.67pyruvate dehydrogenase phosphatase regulatory subu... [more]
Dmgdh9.968e-10527.87dimethylglycine dehydrogenase precursor [Source:MG... [more]
Pdpr2.850e-7529.89pyruvate dehydrogenase phosphatase regulatory subu... [more]
Sardh6.928e-4852.66sarcosine dehydrogenase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99LB7|SARDH_MOUSE0.000e+056.33Sarcosine dehydrogenase, mitochondrial OS=Mus musc... [more]
sp|Q64380|SARDH_RAT0.000e+056.35Sarcosine dehydrogenase, mitochondrial OS=Rattus n... [more]
sp|Q9UL12|SARDH_HUMAN0.000e+056.09Sarcosine dehydrogenase, mitochondrial OS=Homo sap... [more]
sp|Q8GAI3|MABO1_PAENI8.318e-11329.114-methylaminobutanoate oxidase (formaldehyde-formi... [more]
sp|Q8NCN5|PDPR_HUMAN9.240e-11229.74Pyruvate dehydrogenase phosphatase regulatory subu... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F7GBN50.000e+057.98Sarcosine dehydrogenase OS=Monodelphis domestica O... [more]
A0A3Q3LUE00.000e+056.97Sarcosine dehydrogenase OS=Mastacembelus armatus O... [more]
A0A151MFR50.000e+057.14Sarcosine dehydrogenase, mitochondrial OS=Alligato... [more]
A0A3Q1K7K00.000e+057.58Sarcosine dehydrogenase OS=Anabas testudineus OX=6... [more]
A0A1S3IUE10.000e+058.67sarcosine dehydrogenase, mitochondrial OS=Lingula ... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sardh0.000e+054.95sarcosine dehydrogenase [Source:NCBI gene;Acc:1030... [more]
si:cabz01113374.36.908e-11631.21pyruvate dehydrogenase phosphatase regulatory subu... [more]
si:cabz01113374.36.908e-11631.21pyruvate dehydrogenase phosphatase regulatory subu... [more]
dmgdh6.841e-10628.78dimethylglycine dehydrogenase [Source:NCBI gene;Ac... [more]
amt6.738e-825.10aminomethyltransferase [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dmgdh1.283e-10327.83dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
si:cabz01113374.31.587e-9729.01pyruvate dehydrogenase phosphatase regulatory subu... [more]
ENSPMAT00000008586.12.036e-8951.84pep scaffold:Pmarinus_7.0:GL476642:854447:864138:1... [more]
amt1.093e-1022.04aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GCV16.047e-823.36T subunit of the mitochondrial glycine decarboxyla... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321930.000e+054.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403328.371e-11530.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416007.973e-10629.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464724.358e-10330.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313364.613e-1625.94Aminomethyltransferase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sardh0.000e+056.36sarcosine dehydrogenase [Source:NCBI gene;Acc:1011... [more]
si:cabz01113374.31.453e-11530.78pyruvate dehydrogenase phosphatase regulatory subu... [more]
dmgdh1.706e-10630.13dimethylglycine dehydrogenase [Source:NCBI gene;Ac... [more]
dmgdh1.145e-6429.58dimethylglycine dehydrogenase [Source:NCBI gene;Ac... [more]
amt2.314e-1025.56aminomethyltransferase [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Sarcosine dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068610.10.000e+099.44SMESG000068610.1[more]
SMESG000068610.10.000e+097.17SMESG000068610.1[more]
SMESG000042264.14.832e-10028.96SMESG000042264.1[more]
SMESG000012592.11.090e-925.97SMESG000012592.1[more]
SMESG000012592.11.211e-925.97SMESG000012592.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002142 ID=SMED30002142|Name=Sarcosine dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=2916bp
ACCTCATGTTTTTTTAAATTAGTGAATCTAAAGTTTATGATTGGTGATTG
ATTAAATCTTTAAATGCTAAAATTTTCTAAATTTTTAAAATTTCCAACAG
AAAGGAAAATACAATATTATAGAGCTCTTAGTGCAACCAATGCCAAATCA
GGTGTTCCATACAAAAATACCCATAAAAATGATGGGAATCAGACAAAATC
GAATAAATCCTTGCCAAAAAGCGCTGATGTTGTTATAATTGGTGGAGGTG
TTTCAGGCTGCTCTGCTCTTTATCATCTAGCTAAGTTGGGAGTAACAAAT
ACCGTACTGATTGAGAGCAGTGCTATAACTGCAGGTACAACATGGCACAC
ATCTGGGCTTGTGTGGCATTTAAGGCCATCCGATACAGAAATTCAATTGT
TAAGTTATTCATGGGAATTAATGAAATCTTTGGAAAGTGAAACTGGTGTT
AATACTGGCTACATACAAAACGGTGGCTTGTTTGTAGCATCAACAGAAGA
GCGTTTAAATGAATATCAACGTCTAGGCACTCTTGGAAAGATTTTCAATA
TTTATTCTGAAATTTTGGGACCATCTGAAACAAAAAAACTTTTCCCATTA
ATGAATACAAAAGATATATTTGGATGCTTATACAGTCCTTCTGACGGAGT
AATCGATCCAGCGGGTTATTGCTCGGCATTAATTAAAGGCGCTACCCATC
TTGGAGCTAGATTATGTGATGGGGTTAAAGTTTTAAATGTCGAAGTTTCG
AAGAATTCTACTTCATCTTTATTTGGCCGACAAAGGCCAGAAGTTACTTC
AGTCATTACAAATGTAGGGTCAATTAAAACAAACTGCGTAGTTTTAAGTG
CAGGTTGTTGGTCACCGTTGATTGCGAAAACTGCCGGAGTTAAGGTACCT
CTATGTACCTTGAAACATGCGTACGTTATTTCTGAACGAATTGAAGGTAT
TCAGAATATGCCAAATGTTCGTGATCATGATTCTTCGGTCTATCTGCGAC
TTCAGGGAGATGCAATGGGCATAGGGGGTTATGAACCCCATCCAATATTT
TGGGATCCTAAACCGGATTTCGCTTTTTCATTATTCGAGTTGGATTGGAA
CGTTTTTGGAGTAAATATAGGAGGTGCCATAAATCGCGTGCCAGTCTTAG
AGAAAACTGGTATTAAGTCTACAGTTTGTGGACCCGAATCTTTTACACCC
GATCACAAGCCATTAATGGGTGAAAGCCCAGAAGTTAAAGGACTTTTCTT
AAATTGTGCTTATAACAGTGCCGGAATGATGTTGAGTGGAGGCTGCGGTC
GACAAATAGCTCACTGGATCAAACATGGTCGGCCAAGTTTGGACATGTTT
GCATATGATATTAGACGATTTTCTGAAAGAATAACTGATAATCATGATTG
GATTAACGAAAGAAGCCATGAAGCATATGCCAAAAATTACAGTATTATCT
ACAAACATGATGAACCTCTAGCTGGCAGGTCGATGATGAAAGATGTTCTA
TTTGACGAACTGTTGCAGCAGGGCTGTATGTATCAAGAGCGACAAGGTTT
TGAAAGACCGGGTTGGTTTTGCAATACGAAACCAGAATTATTGCCATATG
ATTTCTACGGAAGCTATGAAAAGGAACAACACAAAAATTACGAATACAGA
AATGTGCTAGAAGGGGACTACACTTTTAATTTCTCGAAAAATCATAATGT
GATTGGCAAAGAGTGCTTGAACACTCGTGAAAAAGCTGCTATATTTAACA
TGTCATATTTTGGTAAATTCTATCTCACTGGGCCTGATACAAAAAAAGCT
GTCGATTGGATTTTTACTGCTAATTCTAACAAGCCAGTTGGGTCAATTAT
ATATACTTGCATGTGTAATGAATTTGGCGGAACTGAAGCAGATCTTACGT
ACACTGAAATTGATACCTCACTACCAAATAAAGGAGTTCATAATCCTGAT
TTAACGGGAACTACATATTACCTAGCAGTTGGTGGAGCTGTTTATCAGTA
TGTTTCAAGTTTTATCAACAACATACTTGAAGAAAAACAATTCAATTGTA
AATTAATAGATGTATCCCAAGATATGGTTTTACTTAGCATTCAAGGTCCC
AAAAGTCGACAGATTTTACAGTCAATATCAGATACAGATTTCTCCAATGA
ATCCTTCCCGTTCTCAACTCAGAAATTAATAAAAATTAATGGTTTGCCAT
GTCGTGCATTACGATTGTCATTTGTTGGTGAAATGGGATGGGAATTACAT
ATTGCGAAGGATTATGCGAAAAGCATTTATAATTCAATAATAAAAGTTGG
GAAATCTCATGGAGTAGTCAATGCTGGATATCGTGCTATAGATTCTCTCA
GTATTGAGAAGGGTTATCGTCATTGGCATGCTGATCTAAGACCCGATGAC
ACTCCTTTAGAAGCTGGGCTTGGATTTACTTGCAAATTAAAAACTGATAC
AAATTTTTTGGGTCGCAGTGCACTTGAAAATCAAGCGAAAAATGGATTGA
AAAAGAAATTATCTCTGTTTTCATTGAAGGAAAAAATACAGTTGCATGGT
CTAGAGGCAATTGTGAGAAATGGTGAATACGTTGGATTTCTGCGCTCTGC
CGATTTTGGTCATTATATCGATAAGGCGATTGGATACGGCTATGTTGGGA
GATTAGATGGGTCAACTGTTACTAGCGGTTATCTAGAATCTGGAGATTAT
GAAATTGAGAAGATGGGCAAACGTTATTCTGCTAATTTCCATCAGAAAAC
TTTATTTGATCCCGAAAATAAAAGAATTAAGGGTGTTTATTGATAGTTAC
ATTTTTAGATTGATTTTATATATTTTTGATTATTCTGATTTTTGTGAAAA
AATTTATTGATTGATTTGATTTTTATATTAATTTTTTTTAAATAAAAATG
GTTTTTTGAAAAAAAA
back to top

protein sequence of SMED30002142-orf-1

>SMED30002142-orf-1 ID=SMED30002142-orf-1|Name=SMED30002142-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=910bp
MLKFSKFLKFPTERKIQYYRALSATNAKSGVPYKNTHKNDGNQTKSNKSL
PKSADVVIIGGGVSGCSALYHLAKLGVTNTVLIESSAITAGTTWHTSGLV
WHLRPSDTEIQLLSYSWELMKSLESETGVNTGYIQNGGLFVASTEERLNE
YQRLGTLGKIFNIYSEILGPSETKKLFPLMNTKDIFGCLYSPSDGVIDPA
GYCSALIKGATHLGARLCDGVKVLNVEVSKNSTSSLFGRQRPEVTSVITN
VGSIKTNCVVLSAGCWSPLIAKTAGVKVPLCTLKHAYVISERIEGIQNMP
NVRDHDSSVYLRLQGDAMGIGGYEPHPIFWDPKPDFAFSLFELDWNVFGV
NIGGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGESPEVKGLFLNCAY
NSAGMMLSGGCGRQIAHWIKHGRPSLDMFAYDIRRFSERITDNHDWINER
SHEAYAKNYSIIYKHDEPLAGRSMMKDVLFDELLQQGCMYQERQGFERPG
WFCNTKPELLPYDFYGSYEKEQHKNYEYRNVLEGDYTFNFSKNHNVIGKE
CLNTREKAAIFNMSYFGKFYLTGPDTKKAVDWIFTANSNKPVGSIIYTCM
CNEFGGTEADLTYTEIDTSLPNKGVHNPDLTGTTYYLAVGGAVYQYVSSF
INNILEEKQFNCKLIDVSQDMVLLSIQGPKSRQILQSISDTDFSNESFPF
STQKLIKINGLPCRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHG
VVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDTNFLG
RSALENQAKNGLKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGH
YIDKAIGYGYVGRLDGSTVTSGYLESGDYEIEKMGKRYSANFHQKTLFDP
ENKRIKGVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002075pigment cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR013977GCV_T_C
IPR032503FAO_M
IPR023753FAD/NAD-binding_dom
IPR027266TrmE/GcvT_dom1
IPR006222GCV_T_N
IPR006076FAD-dep_OxRdtase
IPR029043GcvT/YgfZ_C
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:1901053sarcosine catabolic process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0005515protein binding
GO:0008480sarcosine dehydrogenase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027266GTP-binding protein TrmE/Glycine cleavage system T protein, domain 1GENE3DG3DSA:3.30.1360.120coord: 472..778
e-value: 2.9E-97
score: 327.3
NoneNo IPR availableGENE3DG3DSA:3.30.70.1400coord: 566..804
e-value: 2.9E-97
score: 327.3
NoneNo IPR availableGENE3DG3DSA:3.30.9.10coord: 135..378
e-value: 3.3E-125
score: 420.2
NoneNo IPR availableGENE3DG3DSA:2.40.30.110coord: 810..892
e-value: 6.8E-13
score: 50.0
NoneNo IPR availablePANTHERPTHR13847:SF200SARCOSINE DEHYDROGENASE, MITOCHONDRIALcoord: 35..854
NoneNo IPR availablePANTHERPTHR13847FAD NAD BINDING OXIDOREDUCTASEScoord: 35..854
NoneNo IPR availableSUPERFAMILYSSF103025Folate-binding domaincoord: 474..811
NoneNo IPR availableSUPERFAMILYSSF54373FAD-linked reductases, C-terminal domaincoord: 283..378
IPR032503FAD dependent oxidoreductase, central domainPFAMPF16350FAO_Mcoord: 421..473
e-value: 5.3E-17
score: 61.9
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 56..437
e-value: 3.3E-125
score: 420.2
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 54..439
IPR006222Aminomethyltransferase, folate-binding domainPFAMPF01571GCV_Tcoord: 479..788
e-value: 2.0E-57
score: 194.5
IPR013977Glycine cleavage T-protein, C-terminal barrel domainPFAMPF08669GCV_T_Ccoord: 814..899
e-value: 6.9E-12
score: 45.1
IPR006076FAD dependent oxidoreductasePFAMPF01266DAOcoord: 55..418
e-value: 1.1E-54
score: 186.3
IPR029043Glycine cleavage T-protein/YgfZ, C-terminalSUPERFAMILYSSF101790Aminomethyltransferase beta-barrel domaincoord: 817..907