TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30002141
Length (bp)1397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30002141) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30002141) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30002141) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30002141) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002141

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30002141h1SMcG0019660 dd_Smed_v4_14483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019660 Contig9690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019660 Contig9690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019659 Contig9690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019659 Contig9690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002141h1SMcG0019660 dd_Smed_v4_14483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019660 Contig9690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019660 Contig9690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019659 Contig9690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002141h1SMcG0019659 Contig9690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 96.6709 bits (239), Expect = 6.863e-21
Identity = 65/215 (30.23%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             +   R +++  DK+E L   V  L+ +I    L            ++DLE++    E    + VFIWKI +F++   +A   R   I+S +F+    GY+MCL +   G G   G  + ++F +M+GP D +L WP    VTL L+DQ++      AF+      D  S +  +++P++ MN  SG P F  +  +   N   R++ +FIK IV
Sbjct:  300 AEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLA-----------MADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRP-----DVTSSS--FQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 86.2705 bits (212), Expect = 1.579e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  315 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 86.2705 bits (212), Expect = 2.083e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  373 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 86.2705 bits (212), Expect = 2.083e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  373 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 86.2705 bits (212), Expect = 2.522e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  398 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 560          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 58.5362 bits (140), Expect = 3.194e-9
Identity = 48/202 (23.76%), Postives = 95/202 (47.03%), Query Frame = 2
Query:  758 LKETVNNLQGNID---SVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKR-IYSDSFFVFENGYQMCLYVCPIGLGKS-SGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGS-GYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLNE*KN 1345
            L +++N ++  I+   S  +D +   L + +      E++ +Q      ++I      +  A +N++ R IYS  F+    GY+M     P G G +   +  V+  +M+G +D+IL WP + DVT  ++  D       +  + +     E  E+P  G+ +G+ G+  F+    L K+ +   +  +FI+  V L++ K 
Sbjct:  117 LCQSLNPIRTKINIQQSAYVDKYVGMLQYMSIAESAFEKYGSQHT----FRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERP-EGLRNGTFGFQNFLP---LAKVTEFAADGDIFIQIKVLLSKEKQ 310          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 52.373 bits (124), Expect = 4.664e-7
Identity = 33/131 (25.19%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  758 LKETVNNLQGNIDSVKLDI--FTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQD 1141
            L + + +L+G  + ++ D+  F ++   + R+    E          IWKI+   +   +AK   +  I+S  F     GY+M    C  G G S+G  + +Y  +++G +D  L WP    + + L+DQ+
Sbjct:  222 LCDEITDLKGTYELMERDMGSFNDR---QTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQN 349          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 50.8322 bits (120), Expect = 1.728e-6
Identity = 35/146 (23.97%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  887 VFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGY--QMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIK 1315
              +WKI ++S  +A+A+      + S  F+  + GY  Q  +++   G G+++  V VY  ++ G YD +L WP    +T  L +Q          + +  +   E +++P +  +  G G+P FI  + LL      + + +F++
Sbjct:  323 TLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENT-HVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE-LLHSRPFIKGDTVFLR 466          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 50.8322 bits (120), Expect = 1.748e-6
Identity = 35/146 (23.97%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  887 VFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGY--QMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIK 1315
              +WKI ++S  +A+A+      + S  F+  + GY  Q  +++   G G+++  V VY  ++ G YD +L WP    +T  L +Q          + +  +   E +++P +  +  G G+P FI  + LL      + + +F++
Sbjct:  332 TLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENT-HVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE-LLHSRPFIKGDTVFLR 475          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 99.3673 bits (246), Expect = 6.098e-23
Identity = 68/215 (31.63%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEER-FDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLN 1333
            ++ + R +++  DK+E L   V  L+  +    L +       E RL ++    FD     VFIW+I +F+K   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ +      AF+      D  S +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV L 
Sbjct:   80 MEASNRQHRLDQDKIEALSNKVRQLERQVGVKDLTV----AEMEGRLREMSATTFDG----VFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSNREHIIDAFRP-----DITSSS--FQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVDLT 279          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.073e-22
Identity = 66/209 (31.58%), Postives = 106/209 (50.72%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLN 1333
            R +++  DK+E L   V  L+  +    L I    +  E ++ ++        + VF+WKI +FSK   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ++      AF+      D +S +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV L 
Sbjct:   79 RQHRLDQDKIEILNNKVRQLERTVGLRDLSI----VEMEAKMREMSA---ATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRP-----DISSSS--FQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 273          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.073e-22
Identity = 66/209 (31.58%), Postives = 106/209 (50.72%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLN 1333
            R +++  DK+E L   V  L+  +    L I    +  E ++ ++        + VF+WKI +FSK   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ++      AF+      D +S +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV L 
Sbjct:   79 RQHRLDQDKIEILNNKVRQLERTVGLRDLSI----VEMEAKMREMSA---ATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRP-----DISSSS--FQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 273          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 97.8265 bits (242), Expect = 2.597e-21
Identity = 66/204 (32.35%), Postives = 103/204 (50.49%), Query Frame = 2
Query:  731 KVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            + IS +    +E + NL   +  ++  + T  L        L E      + VFIWKI  FS+   DA   R   ++S +F+  + GY+MC  LY+   G G+ S  + ++F +M+G YD +L WP    VTL L+DQ++      AF+      D +S +  +++PIS MN  SG P F  L  L   +   R++ +FIK IV
Sbjct:  345 EAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGS-HLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP-----DVSSTS--FQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 540          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 97.4413 bits (241), Expect = 2.644e-21
Identity = 64/194 (32.99%), Postives = 99/194 (51.03%), Query Frame = 2
Query:  761 KETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +E + NL   +  ++  + T  L        L E      + VFIWKI  FS+   DA   R   ++S +F+  + GY+MC  LY+   G G+ S  + ++F +M+G YD +L WP    VTL L+DQ++      AF+      D +S +  +++PIS MN  SG P F  L  L   +   R++ +FIK IV
Sbjct:  342 QEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGS-HLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP-----DVSSTS--FQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 98.2117 bits (243), Expect = 2.858e-21
Identity = 57/213 (26.76%), Postives = 112/213 (52.58%), Query Frame = 2
Query:  695 IEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +EG++   +   + +  K+E     VN L+  I S+           +NRL ++E +   Q + +FIW+I NF+ ++ + ++ R   I+S  F+  + GY++CL  ++      + + ++ ++ + MQG YD++L WP Q  + L ++DQ +G+A +   ++ D   +   +++P    N  G GY  F+ L   LK  Q  +N+ L ++C V
Sbjct:  338 LEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSL-----------DNRLGEMESQ---QCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQ-ALKQRQYVKNDTLLVRCSV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 90.5077 bits (223), Expect = 7.081e-19
Identity = 62/207 (29.95%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            R  +   +KVE L   V  L+  +   +L +           ++LE R    E    + VFIWKI  F K   DA   R   ++S  F+  + GY+MCL  Y+   G G+++  + ++F +M+G  D +L WP    VTL L+DQ++    +     +  +  +  +++PIS MN  SG P F ++  L   N   R++ +F+K IV
Sbjct:  285 RQLRAAQEKVEALTTKVRQLERTLGQKELIV-----------AELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNT-HLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR---EHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 88.5817 bits (218), Expect = 2.144e-18
Identity = 60/208 (28.85%), Postives = 102/208 (49.04%), Query Frame = 2
Query:  719 ERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            ER++    +   QL+     L+  +   +L +           ++LE R    E    + VFIWKI  F K   DA   R   ++S  F+  + GY+MCL  Y+   G G+++  + ++F +M+G  D +L WP    VTL L+DQ++    +     +  +  +  +++PIS MN  SG P F ++  L   N   R++ +F+K IV
Sbjct:  257 ERSSHAAEELARQLRAADTRLERTLGQKELIV-----------AELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNT-HLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR---EHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 85.1149 bits (209), Expect = 1.838e-17
Identity = 51/166 (30.72%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  833 FENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLF-RNNQLFIKCIV 1324
             E R + LE+      + VF+WKI + +    DA   R   +YS +F+  + GY++CL +   G G   G  V ++F +M+G YD +L WP +  VT  L+D ++     S    +  +  +  +++PI+ MN  SG P F  +  L      + R N L+I+CI+
Sbjct:  216 LEMRSACLEQ---TSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNR---DSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCII 375          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 84.7297 bits (208), Expect = 6.004e-17
Identity = 53/167 (31.74%), Postives = 91/167 (54.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  V+L L+DQ  G + +     +  + ++  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  366 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQ--GPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 528          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 100.523 bits (249), Expect = 3.025e-22
Identity = 67/212 (31.60%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLE-ERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             +   R +++  DK+E L   V  L+ +I    L +       E ++S+LE   +D     VFIWKI +F++   +A   R   I+S +F+    GY+MCL V   G G   G  + ++F +M+GP D +L WP    VTL L+D ++      AF+      D  S +  +++P+S MN  SG P F  +  +   N   R++ +FIK IV
Sbjct:  300 AEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAM----ADLEQKVSELEVSTYDG----VFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRP-----DVTSSS--FQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 100.138 bits (248), Expect = 3.766e-22
Identity = 67/212 (31.60%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLE-ERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             +   R +++  DK+E L   V  L+ +I    L +       E ++S+LE   +D     VFIWKI +F++   +A   R   I+S +F+    GY+MCL V   G G   G  + ++F +M+GP D +L WP    VTL L+D ++      AF+      D  S +  +++P+S MN  SG P F  +  +   N   R++ +FIK IV
Sbjct:  307 AEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAM----ADLEQKVSELEVSTYDG----VFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRP-----DVTSSS--FQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 86.2705 bits (212), Expect = 1.453e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  372 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 86.2705 bits (212), Expect = 1.453e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  372 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 86.2705 bits (212), Expect = 1.728e-17
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  842 RLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD-----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            RL+D++ RF   E    N V IWKI ++ +   +A   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F IM+G YD +L WP +  VTL L+DQ       G AFK      D NS +  ++KP   MN  SG P F+    +L+     +++ +FIK IV
Sbjct:  397 RLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKP-----DPNSSS--FKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 559          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.116e-21
Identity = 67/212 (31.60%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLE-ERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             +   R +++  DK+E L   V  L+ +I    L +       E ++S+LE   +D     VFIWKI +F++   +A   R   I+S +F+    GY+MCL V   G G   G  + ++F +M+GP D +L WP    VTL L+D ++      AF+      D  S +  +++P+S MN  SG P F  +  +   N   R++ +FIK IV
Sbjct:  300 AEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAM----ADLEQKVSELEVSTYDG----VFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRP-----DVTSSS--FQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.447e-20
Identity = 57/218 (26.15%), Postives = 111/218 (50.92%), Query Frame = 2
Query:  737 ISDKVEQLKETVNNLQGNIDSVKLDIFTEKL-------------------SFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             + +   L+ET+  L+G +  V+ D    +L                   S +NRL ++E +   Q + +FIW+I NF+ ++ + ++ R   I+S  F+  + GY++CL  ++      + + ++ ++ + MQG YD++L WP Q  + L ++DQ +G+A +   ++ D   +   +++P    N  G GY  F+ L   LK  Q  +N+ L ++C V
Sbjct:  324 CTQETRNLRETIEQLEGRL--VRQDHQIRELIAKMETQCTYVNELKHTIRSLDNRLGEMESQ---QCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQ-ALKQRQYVKNDTLLVRCSV 535          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 3.296e-20
Identity = 65/215 (30.23%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             +   R +++  DK+E L   V  L+ +I    L            ++DLE++    E    + VFIWKI +F++   +A   R   I+S +F+    GY+MCL +   G G   G  + ++F +M+GP D +L WP    VTL L+DQ++      AF+      D  S +  +++P++ MN  SG P F  +  +   N   R++ +FIK IV
Sbjct:  300 AEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLA-----------MADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRP-----DVTSSS--FQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.385e-19
Identity = 58/222 (26.13%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  725 ANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKL-------------------SFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +++  S +   L+ET+  L+G +  V+ D    +L                   S E++L D++    +  N VFIWKI+ FS +    ++ +   I+S  F+  + GY++CL  ++      + + ++ ++ + MQG YD++L WP    + L ++DQ +G   +   ++ D   D   +++P +  N  G GY  F+ L+  LK  Q  +N+ LF++C V
Sbjct:  318 SHQDCSQETRNLRETIEQLEGRL--VRQDHQIRELIAKMETQCTYVNELKHTIRSLEDKLLDVD---GHHCNGVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRNPKGFGYVTFMHLN-TLKQRQYVKNDTLFVRCAV 533          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 6.765e-19
Identity = 57/218 (26.15%), Postives = 110/218 (50.46%), Query Frame = 2
Query:  737 ISDKVEQLKETVNNLQGNIDSVKLDIFTEKL-------------------SFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             S +   L+ETV  L+G +  V+ D    +L                   S E++++D++    ++ N VFIW+I+ FS +    ++ +   I+S  F+  + GY++CL  ++      + + ++ ++ + MQG YD++L WP Q  + L ++DQ +  A +   ++ D   D   +++P +  N  G GY  F+ L+  LK  Q  +N+ L ++C V
Sbjct:  322 CSQETRNLRETVEQLEGRL--VRQDHQIRELIAKMETQCTYVNELKHTIHSLEDKVADMDA---HRCNGVFIWRIKGFSGLQKSQEEEKPVVIHSPGFYTGDPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGDYDSLLPWPLQGTIRLSILDQSESTARQDQVEVMDTKPDLLAFQRPTAPRNPKGFGYVTFMHLN-TLKQRQYVKNDTLLVRCSV 533          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I3WEV1 (Tumor necrosis factor receptor-associated factor 3 OS=Pinctada fucata OX=50426 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.798e-21
Identity = 70/218 (32.11%), Postives = 114/218 (52.29%), Query Frame = 2
Query:  698 EGKVDFAERANKVISDKVEQLKETVNNLQGNIDSV--KLDIFTEKLSFEN-RLSDLEERFDNQENKVF----IWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            E +   +ER  ++      Q    V  ++GN  SV  ++     +L  ++ RL++L+ RF   E   +    IWKI+++S+   DA   R   +YS  F+    GY+MC  +Y+   G+G+ +  + ++F IM+G YD +L+WP +  VTL L+DQD G    S T   D +S +  + KP + MN  SG P F+    +L+     R + +FIK IV
Sbjct:  311 ETQASMSERIRQLEGRAPSQGNPAVPAIEGNTGSVVPQVQQHERQLGLQDIRLAELDLRFQVLETASYDGTLIWKIKDYSRRKQDAITGRTLSLYSQPFYTSRTGYKMCARVYLNGDGMGRGT-HLSLFFVIMRGEYDTLLSWPFKQKVTLMLLDQDTGTRHLSDTFRPDPSSSS--FRKPTTEMNVASGCPLFVS-HAVLETRTYVREDTIFIKIIV 524          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3Q0K1I7 (TNF receptor-associated factor 3-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100179623 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.255e-20
Identity = 66/207 (31.88%), Postives = 108/207 (52.17%), Query Frame = 2
Query:  719 ERANKVISDKVE-------QLKETVNNLQGNIDSVK--------------LDIFTEKLS-FENRLSDLEERFDNQENK----VFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFI 1255
            +RAN  ++ KVE       Q+KE  N L+ NI+S                +D F  +L  ++ R++D+++RF   E      V IWKI +FS+   +A   R   +YS  F+    GY+MC  +Y+   G+GK +  + ++F +M+G YD +L WP +  VTL L+DQ  G+  +  +  +  +  +  ++KP S MN  SG P F+
Sbjct:   82 KRANTDLTQKVEEIAREIAQIKEKQNELERNIESTSGSREQMAPENLSQMVDAFERQLGMYDVRIADMDQRFQVIETTSYSGVVIWKIRDFSRRKREAVSGRTLSLYSQPFYTSRYGYKMCARVYLNGDGMGKGT-HMSLFFVVMKGEYDALLPWPFRQKVTLMLLDQ--GMDRRHLSDTFRPDPTSSSFKKPTSDMNIASGCPLFV 285          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2Y9JE68 (TNF receptor-associated factor 2-like OS=Enhydra lutris kenyoni OX=391180 GN=LOC111145476 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.207e-20
Identity = 65/203 (32.02%), Postives = 110/203 (54.19%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEER-FDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            R +++  D++E L   V  L+ +I S+K D+   +L  E ++ ++E   FD     VFIWKI +F++   +A   R   I+S +F+    GY+MCL +   G G   G  + ++F +M+GP+D +L WP    VTL L+DQ++    +     +  +  +  +++PIS MN  SG P F  +  +   N   R++ +FIK IV
Sbjct:  151 RQHRLDQDRIEALSNKVQQLERSI-SLK-DLAMAEL--EQKVHEMEATTFDG----VFIWKICDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPHDALLRWPFNQKVTLMLLDQNNR---EHVIDAFRPDVTSSSFQRPISDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 342          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1A8Q1E0 (TNF receptor-associated factor 2 (Fragment) OS=Nothobranchius rachovii OX=451742 GN=TRAF2 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.011e-20
Identity = 69/214 (32.24%), Postives = 106/214 (49.53%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEER-FDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYD-FNSD--NEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLN 1333
            ++ + R +K+  DK+E L   V  L+  +    L +       E RL ++    FD     VFIW+I +F+K   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ       S   + D F  D  +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV L 
Sbjct:   86 MEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTV----AEMEGRLREMSATTFDG----VFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGSHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQS------SREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDGKNSYIRDDTIFIKAIVDLT 285          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1A8JVG6 (TNF receptor-associated factor 2 (Fragment) OS=Nothobranchius kuhntae OX=321403 GN=TRAF2 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.011e-20
Identity = 69/214 (32.24%), Postives = 106/214 (49.53%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEER-FDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYD-FNSD--NEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLN 1333
            ++ + R +K+  DK+E L   V  L+  +    L +       E RL ++    FD     VFIW+I +F+K   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ       S   + D F  D  +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV L 
Sbjct:   86 MEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTV----AEMEGRLREMSATTFDG----VFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGSHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQS------SREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDGKNSYIRDDTIFIKAIVDLT 285          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 97.0561 bits (240), Expect = 2.400e-21
Identity = 65/206 (31.55%), Postives = 105/206 (50.97%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            R +++  DK+E L   V  L+  +    L I    +  E ++ ++        + VF+WKI +FSK   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ++      AF+      D +S +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV
Sbjct:  263 RQHRLDQDKIEILNNKVRQLERTVGLRDLSI----VEMEGKMREMSA---ATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRP-----DISSSS--FQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 454          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 97.4413 bits (241), Expect = 2.838e-21
Identity = 66/207 (31.88%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEE-RFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            R +++  DK+E L   V  L+  +    L I    +  E ++ ++    +D     VF+WKI +FSK   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ++      AF+      D +S +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV
Sbjct:  376 RQHRLDQDKIEILNNKVRQLERTVGLRDLSI----VEMEGKMREMSAATYDG----VFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRP-----DISSSS--FQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 567          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 95.1301 bits (235), Expect = 1.551e-20
Identity = 62/194 (31.96%), Postives = 99/194 (51.03%), Query Frame = 2
Query:  761 KETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +E + NL   +  ++  +    L        L E      + VF+WKI +FS+   DA   R   ++S +F+  + GY+MC  LY+   G G+ S  + ++F +M+G YD +L WP    VTL L+DQ++      AF+      D +S +  +++PIS MN  SG P F  L  L   +   R++ +FIK IV
Sbjct:  341 QEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGS-HLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP-----DISSTS--FQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 1.115e-17
Identity = 47/150 (31.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  881 NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            N   IWKI ++ +  A+A  ++   +YS  F+    GY+MC  +Y+   G+GK +  + ++F +M+G YD +L WP +  VTL L+DQ  G A K     +  + ++  + +P   MN  SG P F+    +L+     +++ +FIK  V
Sbjct:    3 NGTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQ--GPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 83.5741 bits (205), Expect = 8.648e-17
Identity = 52/172 (30.23%), Postives = 91/172 (52.91%), Query Frame = 2
Query:  842 RLSDLEERFDNQEN----KVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLF-RNNQLFIKCIV 1324
            ++S L++    Q++      F+W+I + S+ + +A   +    YS +F+    G+++C  LY+   G+GK +  + ++F IM+G YD +L+WP +  VT  LIDQ+       AF+   +   F       ++P+S MN  SG P F  L  L      + +++ LFIKC+V
Sbjct:  351 QISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGT-HISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFRPDLRSASF-------QRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVV 514          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 2.081e-20
Identity = 58/224 (25.89%), Postives = 108/224 (48.21%), Query Frame = 2
Query:  695 IEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLS--------FENRLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            + G +D        +  +V  ++E+  ++  +    +L      LS         + RL++++ RF   E    N   +WKI ++++   DA   R   +YS  F+    GY+MC   Y+   G+G+ +  + ++F +M+G YD +L WP +  VTL L+DQ  G A +  +  +  +  +  + +P S MN  SG P F+     L+     +++ +FIK +V
Sbjct:  250 LRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGT-HLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQ--GAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVS-HVALESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 5.124e-16
Identity = 56/224 (25.00%), Postives = 108/224 (48.21%), Query Frame = 2
Query:  707 VDFAERANKVISDK------VEQLKETVNNLQ---GNIDSV--KLDIFTEKLSFENRLSDL-EERFDNQENKVF----IWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCL--YVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +  A+RA +  +D       +  L+E +  L+   GN      +  +  ++L+  + L D  E R    E   +    +WKI ++++   +A   R   +YS  F+    GY+MC   Y+   G+G+ +  + ++F +M+G YD +L WP +  VTL L+DQ  G A +  +  +  +  +  + +P   MN  SG P F+     L+ +    ++ +F++ +V
Sbjct:  193 LHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGT-HLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQ--GAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVS-HVALEGSSYLVDDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 56.9954 bits (136), Expect = 5.438e-9
Identity = 52/241 (21.58%), Postives = 105/241 (43.57%), Query Frame = 2
Query:  719 ERANKVISDKVEQLKETVNNLQGNID---------SVKLDIFTEKLSFENRL-SDLEERFDNQENK----VFIWKIENFSKVIADA----------KQNRNKRIYSDSFFVFENGYQMCLYV-------CPIGLGKSS-------GFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +RA    + ++++L+E    L+  +          S K D     L+   RL   LE R    E++    +F W++E FS+++               +    ++S  F+    GY++CL +        P G    S         + ++ +++QG YD+ L WP +  + + ++DQ +  +    T++ D +     +++P    N  G GY  F+ ++ L   + L R++ L ++C V
Sbjct:  324 DRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVH-VTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYL-RDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.909e-8
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  698 EGKVDFAERANKVISDKVEQ--LKETVNNLQGNID---SVKL----------DIFTEK--LSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAK--QNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQI 1111
            E ++   +R  + ++ +VE+       +  QGNID   + +L          D  TE+  L    RL++LE   +   N +F+WKI++    + +A     R  +I S +FF    GY++ L +C     +S   V  Y  +  GPYD  LAWP Q+
Sbjct:  249 EAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELE---NTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLC-----RSGEHVSAYAMLGPGPYDATLAWPYQL 397          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 90.8929 bits (224), Expect = 1.342e-19
Identity = 46/147 (31.29%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  887 VFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSS-GFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             F+WKI+ F++  A+AK      IYS  F+    GY++C  + P G G +   ++ ++  +M+G YD+IL WP Q  +T+ LIDQD+G+     ++ +D +  +  +++P   +N  SG P F     +L+       N +F+K +V
Sbjct:  381 TFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNI---SETFDPDPCSISFQRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVKVVV 523          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 89.3521 bits (220), Expect = 3.342e-19
Identity = 52/166 (31.33%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  845 LSDLEERFDNQENKVF----IWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            ++DLEER +  +   F    +WKI N +   ++A   R    YS  FF   +GY+MC  +Y+   G+G++   V ++F IM+G +D +L WP +  VTL L+DQD+    +     +  +  +  +++P + MN  SG P F   + L + +   R++ +F+K IV
Sbjct:  316 IADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNH-HVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN---VEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQ-HAYIRDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 81.2629 bits (199), Expect = 1.479e-16
Identity = 47/151 (31.13%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  887 VFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDD----GLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
             +IWKI+ +++   +    +   IYS  F+V   GY+ C  V P G G   G  + ++F +M+G +D +L WP +  VT +L+DQD     G  F+        +  +  +++P S MN  SG P FI     L+     R++ +FIK  V
Sbjct:  379 TYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRP-------DPTSSSFKRPTSNMNIASGCPLFISHTN-LQTRAYVRDDTMFIKIAV 521          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 79.337 bits (194), Expect = 5.890e-16
Identity = 53/180 (29.44%), Postives = 96/180 (53.33%), Query Frame = 2
Query:  815 FTEKLS--------FENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLY---DFNSDNEVY-EKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIK 1315
            F+EKLS         E RL+DLE+   +Q     IW+IE++++ + +AK      ++S +F   ++GY++C  VC  G GK  G  + V+ ++++G +D +L WP    VT  L+DQ+D  A +   +     +  +DNE +  +P    N+  G   F K + ++  N + + + +F+K
Sbjct:  275 FSEKLSEHGTLIEKHEKRLNDLEKIAHSQ----LIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRNYI-KEDTIFLK 449          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 72.7886 bits (177), Expect = 8.654e-14
Identity = 52/189 (27.51%), Postives = 91/189 (48.15%), Query Frame = 2
Query:  758 LKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEV-YEKPISGMNS-GSGYPFFIKLDYLLKMNQLFRNNQLFIK 1315
            L+  V +++ + D    ++  + +  E R  +LE R  N     FIWK++NF +    +       I+S  F+    GY+MCL +   G+    G  V ++ ++MQG +D IL WP    +TL ++DQ D +  +           N + +++P S  N  G GY  F  +D L +  Q  +NN + ++
Sbjct:  293 LERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCN---GTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTE-GQYIKNNSILVR 477          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 98.9821 bits (245), Expect = 9.324e-22
Identity = 66/207 (31.88%), Postives = 105/207 (50.72%), Query Frame = 2
Query:  722 RANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEE-RFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            R +++  DK+E L   V  L+  +    L I    +  E ++ D+    +D     +FIWKI +F+K   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ++      AF+      D +S +  +++P+S MN  SG P F  L  L   N   R+  +FIK IV
Sbjct:  373 RQHRLDQDKIEILSNKVRQLERTVSLRDLSI----VEMEGKMKDMSAATYDG----IFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRP-----DISSSS--FQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIV 564          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 98.9821 bits (245), Expect = 1.019e-21
Identity = 68/212 (32.08%), Postives = 106/212 (50.00%), Query Frame = 2
Query:  707 VDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEER-FDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            ++ + R +K+  DK+E L   V  L+  +    L +       E RL ++    FD     VFIW+I +F+K   DA   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+G  D +L WP    VTL L+DQ +      AF+      D  S +  +++P+S MN  SG P F  L  L   N   R++ +FIK IV
Sbjct:  395 MEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTV----AEMEGRLREMAATTFDG----VFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIIDAFRP-----DVTSSS--FQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIV 591          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 90.8929 bits (224), Expect = 2.185e-19
Identity = 62/216 (28.70%), Postives = 110/216 (50.93%), Query Frame = 2
Query:  749 VEQLKETVNNLQGNIDSVK-----------------LDIFTEKLS-FENRLSDLEERFDNQE----NKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC--LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            + QL++ + +L+G +D+V+                 L+   + LS  E RL+D++ RF   E    N   IWKI ++ +   DA   +   +YS  F+    GY+MC  +Y+   G+GK +  + ++F +M+G YD +L WP +  VTL L+DQ  G + K     +  +  +  + +P++ MN  SG P F+    +L+     +++ +FIK  V
Sbjct:  231 LRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGT-HLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQ--GPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIKVTV 442          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 87.4261 bits (215), Expect = 3.996e-18
Identity = 57/193 (29.53%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  761 KETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +E + NL   I  ++  +  + L        + E      + +F+WKI +FS    +A   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+  YD +L WP    VTL L+DQ++      AF+      D  S +  +++P+S MN  SG P F  L  L   +   R++ +FIK IV
Sbjct:  326 QEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP-----DITSTS--FQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 87.4261 bits (215), Expect = 4.588e-18
Identity = 57/193 (29.53%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  761 KETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSG-FVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGL----AFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 1324
            +E + NL   I  ++  +  + L        + E      + +F+WKI +FS    +A   R   ++S +F+  + GY+MCL +   G G   G  + ++F +M+  YD +L WP    VTL L+DQ++      AF+      D  S +  +++P+S MN  SG P F  L  L   +   R++ +FIK IV
Sbjct:  333 QEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP-----DITSTS--FQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014706.1 (SMESG000014706.1)

HSP 1 Score: 488.419 bits (1256), Expect = 0.000e+0
Identity = 267/267 (100.00%), Postives = 267/267 (100.00%), Query Frame = 2
Query:  536 VQLKEEMSRLVEENKAIGIHINSLKAEIATXXXXXXXXXXXXXXXXXXXXXXXIEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLNE 1336
            VQLKEEMSRLVEENKAIGIHINSLKAEIATLKKENKQEKLEKTLKGLEGKQEEIEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLNE
Sbjct:  242 VQLKEEMSRLVEENKAIGIHINSLKAEIATLKKENKQEKLEKTLKGLEGKQEEIEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLNE 508          

HSP 2 Score: 327.02 bits (837), Expect = 0.000e+0
Identity = 160/167 (95.81%), Postives = 163/167 (97.60%), Query Frame = 1
Query:    1 DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQVREK 501
            DRDICIDRSINIRISQL VKCP+ETCEFTDELSMMEEHLKDCDRKFV CPYSEIGCCKPEVRQNEVN+HLL DSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQV+ K
Sbjct:   79 DRDICIDRSINIRISQLVVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNEVNKHLLNDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQVQLK 245          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014724.1 (SMESG000014724.1)

HSP 1 Score: 301.982 bits (772), Expect = 8.473e-100
Identity = 151/167 (90.42%), Postives = 154/167 (92.22%), Query Frame = 1
Query:    1 DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQVREK 501
            DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLL DSFPHNKLLVEYVNNLRNEIEELKTQMS   TEN CL ENL E RK F Y+QAVHKKEIDILAEENNA KI+INSLNFKI AFKQNEKQEQV+ K
Sbjct:   79 DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLLNDSFPHNKLLVEYVNNLRNEIEELKTQMSTVKTENVCLTENLEECRKDFKYKQAVHKKEIDILAEENNATKIKINSLNFKIDAFKQNEKQEQVKLK 245          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000021123.1 (SMESG000021123.1)

HSP 1 Score: 249.21 bits (635), Expect = 5.162e-77
Identity = 119/188 (63.30%), Postives = 148/188 (78.72%), Query Frame = 1
Query:    1 DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQVREK*NQAFHNFDFIGATEGRNEQA 564
            DRDIC+DRSINIRISQL VKCP+ETC+FTDELSMME+HLKDCDRKF+ CPYSEIGCCKP++R++EVN+HL  +SFPHNKLLV+YVNNLRNE+E L +++S   TEN CL + L +S K+F +QQ   K+EID L +ENN+MKIQINSLN K+   KQ+EKQ  V+E+          +G  EGR E+ 
Sbjct:   79 DRDICVDRSINIRISQLIVKCPMETCDFTDELSMMEKHLKDCDRKFIGCPYSEIGCCKPDIRKDEVNKHLFNESFPHNKLLVDYVNNLRNEMEALNSKISAITTENICLAKTLAKSNKKFEFQQRTFKREIDKLTKENNSMKIQINSLNIKMTVLKQDEKQVLVQER----------LGLLEGRQEKT 256          

HSP 2 Score: 224.942 bits (572), Expect = 8.290e-68
Identity = 132/281 (46.98%), Postives = 183/281 (65.12%), Query Frame = 2
Query:  545 KEEMSRLVEENKAIGIHINSLKAEIATXXXXXXXXXXXXXXXXXXXXXXXIEGKVDFAERANKVISDKVEQL-------KETVNNLQGNIDSVKLD----------IFTEKLSFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCLNE 1336
            K E+ +L +EN ++ I INSL  ++  LK++ KQ  +++ L  LEG+QE+ E  V     AN  I+  V++L       KE V +L   ID +  D          I T K S+E ++  ++ + DN  NK FIWK+E+F++V+ + K    K I SD FFV ENGY+M LY  P GLGKS+GF G+YFNI++GPYD++L WPCQIDVT ELI+Q+   +F S  KL++ N D+  Y+KP +  N+G GYP+FIKLDYLLK NQL +N+QLFIKC VCLN+
Sbjct:  206 KREIDKLTKENNSMKIQINSLNIKMTVLKQDEKQVLVQERLGLLEGRQEKTEESVGKLNEANTTINGTVDRLTNDMNSLKEDVGSLNNEIDDLTEDVSKLEDSVDEINTSKESYEMKIDKIQVQLDNLSNKEFIWKLEDFTEVVENCKTKSTKMIISDFFFVSENGYKMGLYAYPKGLGKSAGFFGIYFNIIKGPYDDLLCWPCQIDVTFELINQETKCSFISKKKLFENNPDHTAYQKPTTEKNNGLGYPYFIKLDYLLKQNQLIKNDQLFIKCFVCLNK 486          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014700.1 (SMESG000014700.1)

HSP 1 Score: 229.95 bits (585), Expect = 4.487e-72
Identity = 115/164 (70.12%), Postives = 131/164 (79.88%), Query Frame = 1
Query:    1 DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQV 492
            DRDICIDRSINIRISQL+VKCP+ETCEFTDELSMMEEHLKDCDRKFV CPYSEIGC KPEVRQNEVNEHLL DSF HNKLLVEYVNNLRNEIEELKTQMS   TEN CLIE+L +   +   +Q+  K+E+  L ++N    IQI  LN KI    Q+ + +++
Sbjct:   45 DRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCSKPEVRQNEVNEHLLNDSFLHNKLLVEYVNNLRNEIEELKTQMSLVKTENICLIESLEKRGDKSGLEQSKLKEELSALVKDNAVKDIQIKDLNNKINTLIQDRRNDEI 208          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014700.1 (SMESG000014700.1)

HSP 1 Score: 229.565 bits (584), Expect = 1.720e-71
Identity = 115/164 (70.12%), Postives = 131/164 (79.88%), Query Frame = 1
Query:    1 DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQV 492
            DRDICIDRSINIRISQL+VKCP+ETCEFTDELSMMEEHLKDCDRKFV CPYSEIGC KPEVRQNEVNEHLL DSF HNKLLVEYVNNLRNEIEELKTQMS   TEN CLIE+L +   +   +Q+  K+E+  L ++N    IQI  LN KI    Q+ + +++
Sbjct:   79 DRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCSKPEVRQNEVNEHLLNDSFLHNKLLVEYVNNLRNEIEELKTQMSLVKTENICLIESLEKRGDKSGLEQSKLKEELSALVKDNAVKDIQIKDLNNKINTLIQDRRNDEI 242          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF26.863e-2130.23TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF31.579e-1734.88TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.083e-1734.88TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.083e-1734.88TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.522e-1734.88TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-23.194e-923.76TNF Receptor Associated Factor (TRAF) homolog [So... [more]
trf-14.664e-725.19TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf41.728e-623.97gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.748e-623.97gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unm_sa8086.098e-2331.63un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
BX901915.12.073e-2231.58pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.12.073e-2231.58pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf2b2.597e-2132.35Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.644e-2132.99Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egf2.858e-2126.76epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
TRAF27.081e-1929.95TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF22.144e-1828.85TNF receptor associated factor 2 [Source:NCBI gene... [more]
hspb61.838e-1730.72heat shock protein family B (small) member 6 [Sour... [more]
ssh26.004e-1731.74slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf23.025e-2231.60TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf23.766e-2231.60TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf31.453e-1734.88TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.453e-1734.88TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.728e-1734.88TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE2.116e-2131.60TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q28DL4|TRAF6_XENTR1.447e-2026.15TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q12933|TRAF2_HUMAN3.296e-2030.23TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q6DJN2|TRF6B_XENLA4.385e-1926.13TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3MV19|TRF6A_XENLA6.765e-1926.15TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I3WEV13.798e-2132.11Tumor necrosis factor receptor-associated factor 3... [more]
A0A3Q0K1I73.255e-2031.88TNF receptor-associated factor 3-like isoform X2 O... [more]
A0A2Y9JE684.207e-2032.02TNF receptor-associated factor 2-like OS=Enhydra l... [more]
A0A1A8Q1E05.011e-2032.24TNF receptor-associated factor 2 (Fragment) OS=Not... [more]
A0A1A8JVG65.011e-2032.24TNF receptor-associated factor 2 (Fragment) OS=Not... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a2.400e-2131.55TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a2.838e-2131.88TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b1.551e-2031.96TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.115e-1731.33pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf18.648e-1730.23TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.12.081e-2025.89pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.15.124e-1625.00pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf65.438e-921.58TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.11.909e-828.66pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352371.342e-1931.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.342e-1931.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.479e-1631.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328515.890e-1629.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487738.654e-1427.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.29.324e-2231.88TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8081.019e-2132.08TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf32.185e-1928.70TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b3.996e-1829.53TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b4.588e-1829.53TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014706.10.000e+0100.00SMESG000014706.1[more]
SMESG000014724.18.473e-10090.42SMESG000014724.1[more]
SMESG000021123.15.162e-7763.30SMESG000021123.1[more]
SMESG000014700.14.487e-7270.12SMESG000014700.1[more]
SMESG000014700.11.720e-7170.12SMESG000014700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002141 ID=SMED30002141|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1397bp
GATCGAGATATTTGCATTGATAGATCAATTAATATCCGAATATCCCAATT
GTCTGTCAAATGTCCAATTGAAACGTGCGAATTTACGGATGAATTGAGCA
TGATGGAGGAACATTTGAAAGATTGCGATAGGAAATTTGTCAGTTGTCCA
TATTCTGAGATCGGATGTTGCAAACCGGAAGTCAGACAGAATGAAGTCAA
CGAACATCTTTTAAAGGATAGTTTTCCTCACAACAAATTATTGGTGGAAT
ATGTCAATAACTTACGGAACGAGATCGAAGAATTAAAGACCCAAATGTCA
AAGACGAATACGGAAAACTTTTGTCTTATTGAGAACTTAGGGGAGAGCAG
GAAAAGGTTTATATACCAACAAGCAGTGCATAAGAAAGAGATTGATATTC
TAGCAGAGGAAAACAACGCAATGAAAATTCAAATTAATTCTTTAAATTTT
AAAATAGGAGCATTCAAACAAAACGAGAAACAAGAACAAGTACGAGAAAA
ATGAAATCAAGCTTTTCACAATTTTGACTTTATAGGTGCAACTGAAGGAA
GAAATGAGCAGGCTGGTAGAGGAGAATAAAGCTATAGGAATCCATATAAA
TTCTTTAAAAGCCGAAATAGCAACATTAAAAAAAGAAAATAAACAAGAGA
AATTAGAAAAGACATTGAAAGGACTGGAAGGAAAACAGGAGGAAATCGAG
GGAAAAGTGGACTTCGCGGAAAGAGCAAATAAAGTGATTAGTGATAAGGT
GGAACAGTTGAAGGAAACTGTGAATAATTTACAGGGAAACATAGACAGTG
TGAAGCTTGATATCTTCACAGAAAAGCTCTCATTCGAAAACAGGTTAAGC
GACCTAGAGGAACGATTTGACAATCAAGAAAACAAAGTATTCATATGGAA
AATCGAAAATTTCTCGAAAGTTATCGCAGATGCCAAACAAAATAGAAACA
AAAGGATTTATAGTGATTCATTTTTTGTGTTTGAAAATGGCTACCAAATG
TGCCTTTATGTGTGCCCGATTGGATTGGGAAAATCATCAGGTTTCGTCGG
CGTTTATTTCAATATTATGCAAGGTCCATATGACAACATTTTGGCTTGGC
CGTGCCAGATTGATGTGACTTTGGAATTGATAGATCAAGATGACGGATTG
GCGTTCAAATCTAGCACAAAATTGTACGATTTTAACTCCGATAATGAAGT
ATATGAGAAACCGATTTCTGGCATGAATAGCGGCTCAGGGTACCCTTTCT
TCATAAAGCTAGATTATTTATTAAAGATGAACCAATTATTCAGGAATAAT
CAATTATTTATTAAATGTATTGTTTGTTTGAATGAATGAAAAAATTTAGA
TATTTTGCTATTCTTATATTTATTTTTCTGAAAATATTATTTGTGGG
back to top

protein sequence of SMED30002141-orf-1

>SMED30002141-orf-1 ID=SMED30002141-orf-1|Name=SMED30002141-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MSRLVEENKAIGIHINSLKAEIATLKKENKQEKLEKTLKGLEGKQEEIEG
KVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSD
LEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMC
LYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLA
FKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQ
LFIKCIVCLNE*
back to top

protein sequence of SMED30002141-orf-2

>SMED30002141-orf-2 ID=SMED30002141-orf-2|Name=SMED30002141-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
DRDICIDRSINIRISQLSVKCPIETCEFTDELSMMEEHLKDCDRKFVSCP
YSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELKTQMS
KTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNF
KIGAFKQNEKQEQVREK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0046330positive regulation of JNK cascade
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
GO:0042981regulation of apoptotic process
GO:0070534protein K63-linked ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 15..86
NoneNo IPR availableCOILSCoilCoilcoord: 91..111
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 29..257
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 19..112
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 112..239
e-value: 1.5E-13
score: 61.1
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 110..257
score: 18.754
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 55..258
e-value: 3.8E-44
score: 152.6
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 110..259
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 29..257