slc36a-2

Overview
Nameslc36a-2 (AKN21655.1)
Smed IDSMED30002138
Length (bp)1613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc36a-2 (SMED30002138) t-SNE clustered cells

Violin plots show distribution of expression levels for slc36a-2 (SMED30002138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc36a-2 (SMED30002138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc36a-2 (SMED30002138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002138SMESG000010021.1 SMESG000010018.1 Contig4590GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002138SMESG000060771.1 Contig4590GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30002138SMESG000060771.1 dd_Smed_v4_2596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002138SMESG000060771.1 dd_Smed_v4_2596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc36a-2 vs. Ensembl Human
Match: SLC36A4 (solute carrier family 36 member 4 [Source:HGNC Symbol;Acc:HGNC:19660])

HSP 1 Score: 204.142 bits (518), Expect = 1.515e-58
Identity = 134/430 (31.16%), Postives = 230/430 (53.49%), Query Frame = 1
Query:  133 ISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKK-----------------VRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDN 1368
            I+E     ++ E +E+ L+ V++   L D   IS    LM+L+KGNIGTG+L +P  IK AGI LG + ++ +G +S +  HIL+RC+  L  ++   ++TL Y++TV    E  P S LQ+     + + + F++ITQ+GFC  Y++F+++N+K   E     K                 V L I     +  ++ + +I+ LK +  ++  AN+S  + +++I  Y +  + D    P    +    + FG  +FAFE I +VLP++N+MK  +R+      +N  M  V  LY  +   G++ F +  +GSITLNL         ++ L+ F I V+Y +Q Y+P    +++I      +  +   Q  +  I   L+ I +   AI IP LD++++ +GA+SSS LALILPP++ +++   E+ N
Sbjct:   27 INEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRF--KKSTLGYSDTVSFAMEVSPWSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLRIYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMKESKRF---PQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQSVKILYSFGIFVTYSIQFYVP----AEIIIPGITSKFHTKWKQICEFGIRSFLVSI-TCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEHYN 446          
BLAST of slc36a-2 vs. Ensembl Human
Match: SLC36A1 (solute carrier family 36 member 1 [Source:HGNC Symbol;Acc:HGNC:18761])

HSP 1 Score: 202.216 bits (513), Expect = 3.500e-58
Identity = 134/419 (31.98%), Postives = 237/419 (56.56%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVED--------HFSKKVRL------EIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-----FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLS 1401
                S++ +    L++L+KGNIGTG+L +P  +K AGI +G + ++ +G ++ +   IL++CA     +  ++++ +DY +TV    E  P S L+ +    + + + F+I+TQ+GFCC Y +F++DN K  +E         H ++ V L       +   + +  L+ + +I+NL+ ++  ++ ANI+ ++ ++MI  + +  I D +  P   P+    + FG  IF+FE I +VLP++NKMK P ++     ++   MV V  LY ++G  G+L+FG N QGSITLNL +   WL   ++ L+   I  +Y LQ Y+P      F  S+  +  E       LV  + ++ +   +V  + ++AI IP LDL+++L+G++SSS LALI+PP++ V + YSE  +    FK  ++S
Sbjct:   40 RFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRR--LNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPL---ILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNC--WLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCE-------LVVDLFVRTV---LVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALIS 441          
BLAST of slc36a-2 vs. Ensembl Human
Match: SLC36A1 (solute carrier family 36 member 1 [Source:HGNC Symbol;Acc:HGNC:18761])

HSP 1 Score: 202.216 bits (513), Expect = 3.500e-58
Identity = 134/419 (31.98%), Postives = 237/419 (56.56%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVED--------HFSKKVRL------EIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-----FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLS 1401
                S++ +    L++L+KGNIGTG+L +P  +K AGI +G + ++ +G ++ +   IL++CA     +  ++++ +DY +TV    E  P S L+ +    + + + F+I+TQ+GFCC Y +F++DN K  +E         H ++ V L       +   + +  L+ + +I+NL+ ++  ++ ANI+ ++ ++MI  + +  I D +  P   P+    + FG  IF+FE I +VLP++NKMK P ++     ++   MV V  LY ++G  G+L+FG N QGSITLNL +   WL   ++ L+   I  +Y LQ Y+P      F  S+  +  E       LV  + ++ +   +V  + ++AI IP LDL+++L+G++SSS LALI+PP++ V + YSE  +    FK  ++S
Sbjct:   40 RFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRR--LNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPL---ILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNC--WLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCE-------LVVDLFVRTV---LVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALIS 441          
BLAST of slc36a-2 vs. Ensembl Human
Match: SLC36A2 (solute carrier family 36 member 2 [Source:HGNC Symbol;Acc:HGNC:18762])

HSP 1 Score: 202.216 bits (513), Expect = 4.444e-58
Identity = 138/437 (31.58%), Postives = 246/437 (56.29%), Query Frame = 1
Query:  166 EMNEETLID--VEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE-------DHFSKKV---------RLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-----FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLS 1401
            E  + T +D    E   L  +  I+   AL++L+KGN+GTGIL +P  +K AGI +G L ++ +G ++ +  HIL++CAQ    +  +++  +DY +TV    E  P+  LQ +    + + + F+IITQ+GFCC Y++F++DN+K  VE       + +S +          RL ++      +LL +  I+NL+I+   ++ ANIS ++ +++I+ Y    I D ++ P    +    + FG  IF+FE+I +VLP++NKMK    +     +++  M  V  LY  M   G+L+FG++ + SI+LNL +   WL   ++ L++  IL +Y LQ Y+P      F  S++         + +L   + ++++   +V  + ++AI IP LDL+++L+G++S + LALI+PP++ V + YSE  +    FK  ++S
Sbjct:   31 ENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKR--LNKPFMDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVL--IRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHF---PAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNC--WLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRV-------STRWALPLDLSIRLV---MVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALIS 448          
BLAST of slc36a-2 vs. Ensembl Human
Match: SLC36A3 (solute carrier family 36 member 3 [Source:HGNC Symbol;Acc:HGNC:19659])

HSP 1 Score: 184.111 bits (466), Expect = 2.040e-51
Identity = 127/404 (31.44%), Postives = 222/404 (54.95%), Query Frame = 1
Query:  199 EDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVF-MIITQIGFCCAYMLFISDNIKSFVED-HFSKKV---RLEIVGAAVMGLLLCM----------CWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
            E+ H +  + +S    L++L+K NIGTG+L +P  IK AG+ +G + ++ +G L+ +   ILL CAQ L  +  + +  ++Y E      E  P+   R   +    T  F ++ITQ+GFC  Y +F++DN++  VE  H +  +   R  +    ++ +   M           +I+NLK+++  +  ANI+ +  + +I  Y + GI   +  P    +   L+ FG  IF FE + +VLP++N+MK+P+++   + V+   M  V+ LY  +G  G++KFG +TQ SITLNL +   WL   ++ ++   I  +Y LQ ++P    +++I      Q   S    + L +   L+ + + V AI IP LDL+++L+G++SSS LALI+P ++ +V  YSE+
Sbjct:   32 ENVHPAGEAGLSMMQTLIHLLKCNIGTGLLGLPLAIKNAGLLVGPVSLLAIGVLTVHCMVILLNCAQHLSQR--LQKTFVNYGEATMYGLETCPNTWLRAHAVWGRYTVSFLLVITQLGFCSVYFMFMADNLQQMVEKAHVTSNICQPREILTLTPILDIRFYMLIILPFLILLVFIQNLKVLSVFSTLANITTLGSMALIFEYIMEGIPYPSNLPLMANWKTFLLFFGTAIFTFEGVGMVLPLKNQMKHPQQF---SFVLYLGMSIVIILYILLGTLGYMKFGSDTQASITLNLPNC--WLYQSVKLMYSIGIFFTYALQFHVP----AEIIIPFAISQVSESWALFVDLSVRSALVCL-TCVSAILIPRLDLVISLVGSVSSSALALIIPALLEIVIFYSED 423          
BLAST of slc36a-2 vs. Ensembl Celegans
Match: slc-36.2 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:O17275])

HSP 1 Score: 216.083 bits (549), Expect = 4.061e-64
Identity = 126/396 (31.82%), Postives = 222/396 (56.06%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQ--TLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLL----CMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
             + DS +I+++ AL+++IK  +GTG+L++P   K++GI LG++L+  +  +  Y T  L+      T + +       +DY   +    E GP+ ++ +  L K + N+ M + Q GFCC Y +F++DN+K F    F +   + I  A  + LLL     +C I+ LK +A +A  AN   I+ +++++       Q     P F    ++ + FG V+FAFE + +VLPI+N+M  P  ++T  GV+NT+ + V+ +Y  +GF+GFL++G + + ++TLNL   P +   I+ +FV  ILVSY LQ Y+P+    K IK+      +  ++  I+        V+ +  MA  IPHL L ++L+G+++ + L L+ PP+I ++  YS+ +   W
Sbjct:   32 RVRDSRSITADQALIHMIKVMMGTGMLSLPLAFKHSGIWLGLILLCFICLICIYCTRQLIFGQHYITFIKR----EQRMDYANVMRSAVELGPAWIRGHGYLFKQMVNINMFVAQFGFCCVYFVFMADNLKQF----FDQTSSIHISQAGWIALLLIPISALCTIRELKALAPLAAVANFVYIIAVVIVLADLFSDWQPLDSLPAFGAVENLPLFFGTVMFAFEGVAVVLPIENQMNEPIHFITPNGVLNTSCILVLLVYMTVGFFGFLRYGNDIKDTLTLNLPQTPFYQ-AIKVMFVLCILVSYPLQFYVPMERVEKWIKRKVVEAKQEPMIYAIRFG-----GVLLTCAMAQLIPHLALFISLVGSVAGTSLTLVFPPLIELLCSYSKQELTKW 413          
BLAST of slc36a-2 vs. Ensembl Celegans
Match: slc-36.2 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:O17275])

HSP 1 Score: 216.083 bits (549), Expect = 4.061e-64
Identity = 126/396 (31.82%), Postives = 222/396 (56.06%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQ--TLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLL----CMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
             + DS +I+++ AL+++IK  +GTG+L++P   K++GI LG++L+  +  +  Y T  L+      T + +       +DY   +    E GP+ ++ +  L K + N+ M + Q GFCC Y +F++DN+K F    F +   + I  A  + LLL     +C I+ LK +A +A  AN   I+ +++++       Q     P F    ++ + FG V+FAFE + +VLPI+N+M  P  ++T  GV+NT+ + V+ +Y  +GF+GFL++G + + ++TLNL   P +   I+ +FV  ILVSY LQ Y+P+    K IK+      +  ++  I+        V+ +  MA  IPHL L ++L+G+++ + L L+ PP+I ++  YS+ +   W
Sbjct:   32 RVRDSRSITADQALIHMIKVMMGTGMLSLPLAFKHSGIWLGLILLCFICLICIYCTRQLIFGQHYITFIKR----EQRMDYANVMRSAVELGPAWIRGHGYLFKQMVNINMFVAQFGFCCVYFVFMADNLKQF----FDQTSSIHISQAGWIALLLIPISALCTIRELKALAPLAAVANFVYIIAVVIVLADLFSDWQPLDSLPAFGAVENLPLFFGTVMFAFEGVAVVLPIENQMNEPIHFITPNGVLNTSCILVLLVYMTVGFFGFLRYGNDIKDTLTLNLPQTPFYQ-AIKVMFVLCILVSYPLQFYVPMERVEKWIKRKVVEAKQEPMIYAIRFG-----GVLLTCAMAQLIPHLALFISLVGSVAGTSLTLVFPPLIELLCSYSKQELTKW 413          
BLAST of slc36a-2 vs. Ensembl Celegans
Match: Y43F4B.7 (pep chromosome:WBcel235:III:13307502:13313389:1 gene:WBGene00012804.1 transcript:Y43F4B.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.7)

HSP 1 Score: 193.356 bits (490), Expect = 1.840e-55
Identity = 119/391 (30.43%), Postives = 224/391 (57.29%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLL----CMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLI-KKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEND 1365
             L   ++++   A ++++K  +GTG+L++P   K++G+ LG++L + +  +  Y    ++  A  + ++ G  R  +DY   + G  E GP  ++R     K L NV M I+Q+GFCC Y +F++DN+    ED F+    + +  A  M LLL     +C I+ L I+A  A+ AN+  ++ + +++ + +  ++  +  P F    D+ + FG V+FAFE + +++PI+N+M+ P  +++  GV+N++ + V+ +++  GFYG+L  G + + + TLNL   P +   I+ +FV  I++SY LQ Y+P+    K I +K+   +      Q + + I     VI +  +A  IPHL L ++L+GA S + +AL+ PP I +++ Y++N+
Sbjct:   42 RLPTENSLTPEQAFIHMVKAMLGTGLLSLPLAFKHSGLFLGLILTVLICLICLYCMRQVVFAAHFVCNRNG--RDLIDYANIMRGAVEMGPPWIKRNGYFFKQLVNVNMFISQLGFCCVYFVFMADNL----EDFFNNNTSIHLSKAVWMLLLLIPMLSICSIRRLSILAPFAMAANVVYVVAVAVVLFFFLSDLRPISSLPWFGKATDLPLFFGTVMFAFEGVAVIMPIENRMQSPHAFISWNGVLNSSCLVVLAIFSVTGFYGYLSLGNDVKDTATLNLPMTPFYQT-IKLMFVACIMISYPLQFYVPMERIEKWITRKIPVDK------QTLYIYIARYSGVILTCAIAELIPHLALFISLIGAFSGASMALLFPPCIELLTSYAKNE 419          
BLAST of slc36a-2 vs. Ensembl Celegans
Match: slc-36.2 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:O17275])

HSP 1 Score: 184.882 bits (468), Expect = 1.903e-53
Identity = 104/318 (32.70%), Postives = 178/318 (55.97%), Query Frame = 1
Query:  436 LDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLL----CMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            +DY   +    E GP+ ++ +  L K + N+ M + Q GFCC Y +F++DN+K F    F +   + I  A  + LLL     +C I+ LK +A +A  AN   I+ +++++       Q     P F    ++ + FG V+FAFE + +VLPI+N+M  P  ++T  GV+NT+ + V+ +Y  +GF+GFL++G + + ++TLNL   P +   I+ +FV  ILVSY LQ Y+P+    K IK+      +  ++  I+        V+ +  MA  IPHL L ++L+G+++ + L L+ PP+I ++  YS+ +   W
Sbjct:    1 MDYANVMRSAVELGPAWIRGHGYLFKQMVNINMFVAQFGFCCVYFVFMADNLKQF----FDQTSSIHISQAGWIALLLIPISALCTIRELKALAPLAAVANFVYIIAVVIVLADLFSDWQPLDSLPAFGAVENLPLFFGTVMFAFEGVAVVLPIENQMNEPIHFITPNGVLNTSCILVLLVYMTVGFFGFLRYGNDIKDTLTLNLPQTPFYQ-AIKVMFVLCILVSYPLQFYVPMERVEKWIKRKVVEAKQEPMIYAIRFG-----GVLLTCAMAQLIPHLALFISLVGSVAGTSLTLVFPPLIELLCSYSKQELTKW 308          
BLAST of slc36a-2 vs. Ensembl Celegans
Match: skat-1 (Probable amino acid transporter skat-1 [Source:UniProtKB/Swiss-Prot;Acc:P34479])

HSP 1 Score: 141.739 bits (356), Expect = 1.496e-36
Identity = 109/427 (25.53%), Postives = 202/427 (47.31%), Query Frame = 1
Query:  166 EMNEETLIDVEED------------PHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGL--LLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLF----VFSILVSYLLQIYIPVFICSKLI---KKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWR 1380
            E   E  + VE D            P       I+   A++ L K     G  ++P   K  G+ +  ++   +  L+ Y  HIL+R +Q L  K   DR+ LDY      V ++   R L+   K +    NV ++  Q+G C   +LFISDN+ + V DH       +++  A + L  +L       ++I++  A+ +++  ++G  +IM Y++     + + P  T F   +   G+ ++AFE   ++LPI+NK+  P  ++   GV++T M+       A+GF+G+  FG++   +IT N        +P + L+    VF +L S LL   I +++   +     + +      ++ + +  K      V+ +Y+MA+ IP L++M+ L+G  S +  ALI PP   +++ ++     DW+
Sbjct:    4 EEGRERAVTVEGDAESMNDGRALVQPPARSGDVITPTRAVLTLSKSMFNAGCFSLPYAWKLGGLWVSFVMSFVIAGLNWYGNHILVRASQHLAKK--SDRSALDYGHFAKKVCDYSDIRFLRNNSKAVMYFVNVTILFYQLGMCSVAILFISDNLVNLVGDHLGGTRHQQMILMATVSLFFILLTNMFTEMRIVSFFALVSSVFFVIGAAVIMQYTVQQPNQWDKLPAATNFTGTITMIGMSMYAFEGQTMILPIENKLDNPAAFLAPFGVLSTTMIICTAFMTALGFFGYTGFGDSIAPTITTN--------VPKEGLYSTVNVFLMLQS-LLGNSIAMYVVYDMFFNGFRRKFGARFPNVPKWLSDKGFRVFWVLVTYLMAVLIPKLEIMIPLVGVTSGALCALIFPPFFEMITFWT-----DWK 414          
BLAST of slc36a-2 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0079653)

HSP 1 Score: 257.684 bits (657), Expect = 1.748e-79
Identity = 150/422 (35.55%), Postives = 249/422 (59.00%), Query Frame = 1
Query:  130 QISELKSITSNGEMNEE-TLIDVEEDP-HLSDSSNISSN-AALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLK--DAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR-DW 1377
             +    S+ ++G  ++E    D   +P H  D  + +SN   L++L+KGNIGTGILAMP   K AG+ +G+   + +GA+ T+  H+L+ C+  L  ++   + +LD++E     FE GP  L+RY  L + +   F+ ITQIGFCC Y LF++ NIK  V DH+  K+ ++I    ++G ++ +  ++NLK +  V++ A +  + G+ +   Y ++ + D         +  + + FG  I+AFE I +VLP++N M+ PE +    GV+NT MV V CLY A+GF+G+LK+GE+ +GSITLNL   D  S L+ I      +I +SY LQ Y+PV I    ++        ++  + +   ++  ++V F++++A  IP+L  +++L+GA+SSS LALI PPII V++ Y+    R +W
Sbjct:   38 NVHSEDSLAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRF--QQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKD-VMDHY-YKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRIS--MAVAIFLSYTLQFYVPVNIVEPFVRS----HFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNW 449          
BLAST of slc36a-2 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0303470)

HSP 1 Score: 257.684 bits (657), Expect = 1.748e-79
Identity = 150/422 (35.55%), Postives = 249/422 (59.00%), Query Frame = 1
Query:  130 QISELKSITSNGEMNEE-TLIDVEEDP-HLSDSSNISSN-AALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLK--DAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR-DW 1377
             +    S+ ++G  ++E    D   +P H  D  + +SN   L++L+KGNIGTGILAMP   K AG+ +G+   + +GA+ T+  H+L+ C+  L  ++   + +LD++E     FE GP  L+RY  L + +   F+ ITQIGFCC Y LF++ NIK  V DH+  K+ ++I    ++G ++ +  ++NLK +  V++ A +  + G+ +   Y ++ + D         +  + + FG  I+AFE I +VLP++N M+ PE +    GV+NT MV V CLY A+GF+G+LK+GE+ +GSITLNL   D  S L+ I      +I +SY LQ Y+PV I    ++        ++  + +   ++  ++V F++++A  IP+L  +++L+GA+SSS LALI PPII V++ Y+    R +W
Sbjct:   38 NVHSEDSLAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRF--QQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKD-VMDHY-YKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRIS--MAVAIFLSYTLQFYVPVNIVEPFVRS----HFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNW 449          
BLAST of slc36a-2 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0303471)

HSP 1 Score: 257.684 bits (657), Expect = 1.748e-79
Identity = 150/422 (35.55%), Postives = 249/422 (59.00%), Query Frame = 1
Query:  130 QISELKSITSNGEMNEE-TLIDVEEDP-HLSDSSNISSN-AALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLK--DAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR-DW 1377
             +    S+ ++G  ++E    D   +P H  D  + +SN   L++L+KGNIGTGILAMP   K AG+ +G+   + +GA+ T+  H+L+ C+  L  ++   + +LD++E     FE GP  L+RY  L + +   F+ ITQIGFCC Y LF++ NIK  V DH+  K+ ++I    ++G ++ +  ++NLK +  V++ A +  + G+ +   Y ++ + D         +  + + FG  I+AFE I +VLP++N M+ PE +    GV+NT MV V CLY A+GF+G+LK+GE+ +GSITLNL   D  S L+ I      +I +SY LQ Y+PV I    ++        ++  + +   ++  ++V F++++A  IP+L  +++L+GA+SSS LALI PPII V++ Y+    R +W
Sbjct:   38 NVHSEDSLAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRF--QQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKD-VMDHY-YKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRIS--MAVAIFLSYTLQFYVPVNIVEPFVRS----HFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNW 449          
BLAST of slc36a-2 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0079655)

HSP 1 Score: 258.07 bits (658), Expect = 2.543e-79
Identity = 150/417 (35.97%), Postives = 248/417 (59.47%), Query Frame = 1
Query:  145 KSITSNGEMNEE-TLIDVEEDP-HLSDSSNISSN-AALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLK--DAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR-DW 1377
             S+ ++G  ++E    D   +P H  D  + +SN   L++L+KGNIGTGILAMP   K AG+ +G+   + +GA+ T+  H+L+ C+  L  ++   + +LD++E     FE GP  L+RY  L + +   F+ ITQIGFCC Y LF++ NIK  V DH+  K+ ++I    ++G ++ +  ++NLK +  V++ A +  + G+ +   Y ++ + D         +  + + FG  I+AFE I +VLP++N M+ PE +    GV+NT MV V CLY A+GF+G+LK+GE+ +GSITLNL   D  S L+ I      +I +SY LQ Y+PV I    ++        ++  + +   ++  ++V F++++A  IP+L  +++L+GA+SSS LALI PPII V++ Y+    R +W
Sbjct:   65 DSLAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRF--QQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKD-VMDHY-YKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRIS--MAVAIFLSYTLQFYVPVNIVEPFVRS----HFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNW 471          
BLAST of slc36a-2 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0303469)

HSP 1 Score: 256.914 bits (655), Expect = 3.871e-79
Identity = 149/426 (34.98%), Postives = 252/426 (59.15%), Query Frame = 1
Query:  115 INDDKQISELKSITSNGEMNEETLIDVEEDP-HLSDSSNISSN-AALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLK--DAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR-DW 1377
            ++ +  ++   + + +G+ +E    D   +P H  D  + +SN   L++L+KGNIGTGILAMP   K AG+ +G+   + +GA+ T+  H+L+ C+  L  ++   + +LD++E     FE GP  L+RY  L + +   F+ ITQIGFCC Y LF++ NIK  V DH+  K+ ++I    ++G ++ +  ++NLK +  V++ A +  + G+ +   Y ++ + D         +  + + FG  I+AFE I +VLP++N M+ PE +    GV+NT MV V CLY A+GF+G+LK+GE+ +GSITLNL   D  S L+ I      +I +SY LQ Y+PV I    ++        ++  + +   ++  ++V F++++A  IP+L  +++L+GA+SSS LALI PPII V++ Y+    R +W
Sbjct:   39 VHSEDSLAVHAAASGSGD-DEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRF--QQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKD-VMDHY-YKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRIS--MAVAIFLSYTLQFYVPVNIVEPFVRS----HFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNW 453          
BLAST of slc36a-2 vs. Ensembl Zebrafish
Match: slc36a4 (solute carrier family 36 member 4 [Source:ZFIN;Acc:ZDB-GENE-050309-239])

HSP 1 Score: 195.667 bits (496), Expect = 8.485e-56
Identity = 121/402 (30.10%), Postives = 223/402 (55.47%), Query Frame = 1
Query:  223 SNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE-DHFSKK--------------------VRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP-IQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSE 1359
              I+    L++L+KGNIGTG+L +P  +K AGI LG + ++ +G +  +  HIL+ C+  L ++  + R+ L Y+ETV    E   S+ L+R     + L N F+++TQ+GFC  Y +F+++NIK  +E  H +                      + L +    ++  ++ + +I++L+ +A ++  AN+   + +I I  Y +  + D  + P  + +      FG  IFAFE I +VLP++N+M+ P+R+      +N  M  ++ LY  +   G+L+F ++ +GSITLNL    SW    ++ L+ F + VS+ +Q ++P    ++++    C + + S  +   L  +  L+V  + V A+ IP LDL+++L+GA+SSS LAL+ PP++ +++  S+
Sbjct:   41 QGITFTQTLLHLLKGNIGTGLLGLPLAVKNAGIVLGPVSLVLMGVVCVHCMHILVNCSHQLSER--LKRSPLGYSETVAAAMELSSSQCLRRSAHFGRHLVNFFLVLTQLGFCSVYFVFLAENIKQVMEGTHMNSTAETVLLSSNSSEASVASSVAIDLRLYMVFLLPFIIVLTFIRDLRNMAALSAIANLCMAISLIFIFSYILNDLSDPRRLPYASTWRKFPFFFGTAIFAFEGIGVVLPLENQMREPKRF---PQALNIGMGFIIVLYVTLATLGYLRFRDDIKGSITLNLPHD-SWSNQLVKVLYSFGVFVSFAVQFFVP----AEILLPPMCERVRKSWRRVADLS-LRALLVCLTCVTAVLIPRLDLVISLVGAVSSSALALVFPPLVELIAFPSQ 431          
BLAST of slc36a-2 vs. Ensembl Zebrafish
Match: slc36a4 (solute carrier family 36 member 4 [Source:ZFIN;Acc:ZDB-GENE-050309-239])

HSP 1 Score: 195.667 bits (496), Expect = 8.485e-56
Identity = 121/402 (30.10%), Postives = 223/402 (55.47%), Query Frame = 1
Query:  223 SNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE-DHFSKK--------------------VRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP-IQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSE 1359
              I+    L++L+KGNIGTG+L +P  +K AGI LG + ++ +G +  +  HIL+ C+  L ++  + R+ L Y+ETV    E   S+ L+R     + L N F+++TQ+GFC  Y +F+++NIK  +E  H +                      + L +    ++  ++ + +I++L+ +A ++  AN+   + +I I  Y +  + D  + P  + +      FG  IFAFE I +VLP++N+M+ P+R+      +N  M  ++ LY  +   G+L+F ++ +GSITLNL    SW    ++ L+ F + VS+ +Q ++P    ++++    C + + S  +   L  +  L+V  + V A+ IP LDL+++L+GA+SSS LAL+ PP++ +++  S+
Sbjct:   41 QGITFTQTLLHLLKGNIGTGLLGLPLAVKNAGIVLGPVSLVLMGVVCVHCMHILVNCSHQLSER--LKRSPLGYSETVAAAMELSSSQCLRRSAHFGRHLVNFFLVLTQLGFCSVYFVFLAENIKQVMEGTHMNSTAETVLLSSNSSEASVASSVAIDLRLYMVFLLPFIIVLTFIRDLRNMAALSAIANLCMAISLIFIFSYILNDLSDPRRLPYASTWRKFPFFFGTAIFAFEGIGVVLPLENQMREPKRF---PQALNIGMGFIIVLYVTLATLGYLRFRDDIKGSITLNLPHD-SWSNQLVKVLYSFGVFVSFAVQFFVP----AEILLPPMCERVRKSWRRVADLS-LRALLVCLTCVTAVLIPRLDLVISLVGAVSSSALALVFPPLVELIAFPSQ 431          
BLAST of slc36a-2 vs. Ensembl Zebrafish
Match: slc36a1 (solute carrier family 36 member 1 [Source:ZFIN;Acc:ZDB-GENE-061117-1])

HSP 1 Score: 188.734 bits (478), Expect = 2.259e-53
Identity = 140/448 (31.25%), Postives = 235/448 (52.46%), Query Frame = 1
Query:  124 DKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFG---PSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAV--------------MGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPI-QPLFVFSILVSYLLQIYIPVFICSKLIKK--LECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDV 1407
            D+  +E + I S G    E          +   +  S    +++L+KGNIGTG+L +P  ++ AG+ +G L ++ +G ++ +  ++L++CA  L  K G  +  L Y + V    E+G    S L R+    + + N+F+ ITQ+GFCC Y +F+SDN+K  VE   +          AV              +  ++ + +I+NLK +A ++  ANI     +++I  Y +  I +    P      D  + FG  IFAFE I +VLP++NKM+ P  +     V+   M  V  LY ++G  G++ FGE  +GSITLNL     WL  I + L+ F I ++Y LQ Y+   I   LI      C   + +L+  + +++    +V  +  +AI IP LDL+++L+G++SSS LALI+PP++ +++ ++E D + W F   +L  V
Sbjct:   17 DESPTEDEPIHSPGSRQTEY-------ERIGGRTGSSVLQTIIHLLKGNIGTGLLGLPLAVRNAGLLVGPLSLLIMGIVAVHCMNLLVKCAHHLSAKLG--KPFLSYGDAV----EYGMENVSWLSRHSIWGRHVVNLFLNITQLGFCCVYFVFLSDNVKQVVETANATTGNCHNNETAVPVPSYDSRLYMVFFLPFIILLVFIRNLKYLAPLSFAANICMCASLVLIYYYCLTNIPNPINLPLAGRGADYPLFFGTAIFAFEGIGVVLPLENKMQNPRNFTK---VLYLGMGIVTFLYISLGTIGYIGFGEEIRGSITLNLPLC--WLYQIVKLLYSFGIYITYALQFYVSAEI---LIPPAVARCGP-RWALMVDLSIRVA---LVGLTCALAILIPELDLVISLVGSVSSSALALIIPPLLQIITFHNE-DMKPWVFAKDILISV 438          
BLAST of slc36a-2 vs. Ensembl Zebrafish
Match: slc36a4 (solute carrier family 36 member 4 [Source:ZFIN;Acc:ZDB-GENE-050309-239])

HSP 1 Score: 163.31 bits (412), Expect = 1.165e-44
Identity = 97/324 (29.94%), Postives = 176/324 (54.32%), Query Frame = 1
Query:  223 SNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE-DHFSKK--------------------VRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP-IQPLFVFSILVSYLLQIYIP 1125
              I+    L++L+KGNIGTG+L +P  +K AGI LG + ++ +G +  +  HIL+ C+  L ++  + R+ L Y+ETV    E   S+ L+R     + L N F+++TQ+GFC  Y +F+++NIK  +E  H +                      + L +    ++  ++ + +I++L+ +A ++  AN+   + +I I  Y +  + D  + P  + +      FG  IFAFE I +VLP++N+M+ P+R+      +N  M  ++ LY  +   G+L+F ++ +GSITLNL    SW    ++ L+ F + VS+ +Q ++P
Sbjct:   41 QGITFTQTLLHLLKGNIGTGLLGLPLAVKNAGIVLGPVSLVLMGVVCVHCMHILVNCSHQLSER--LKRSPLGYSETVAAAMELSSSQCLRRSAHFGRHLVNFFLVLTQLGFCSVYFVFLAENIKQVMEGTHMNSTAETVLLSSNSSEASVASSVAIDLRLYMVFLLPFIIVLTFIRDLRNMAALSAIANLCMAISLIFIFSYILNDLSDPRRLPYASTWRKFPFFFGTAIFAFEGIGVVLPLENQMREPKRF---PQALNIGMGFIIVLYVTLATLGYLRFRDDIKGSITLNLPH-DSWSNQLVKVLYSFGVFVSFAVQFFVP 358          
BLAST of slc36a-2 vs. Ensembl Zebrafish
Match: slc32a1 (solute carrier family 32 member 1 [Source:ZFIN;Acc:ZDB-GENE-061201-1])

HSP 1 Score: 67.3958 bits (163), Expect = 1.875e-11
Identity = 85/387 (21.96%), Postives = 167/387 (43.15%), Query Frame = 1
Query:  217 DSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI--KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXN--DVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFS-ILVSYLLQIYIPVFICSKLIKK-------LECHQNKSSLVQ-KIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIIN 1338
            D   I++  A  N+     G  +L +P  I + G  LG+ LII    +  Y   IL+ C     +   + R    Y +              R+  L   + NV  II  +  C  Y++ +S N+   SF     S++    I  AA    LL   ++KNLK +++ ++   ++  +  I+++ Y +   +D+         +     ++ GI++F++ +   +  ++  M+ P  +     ++N   +    L        +L + + T+  IT NL   PS +  +  LF+ S  L+SY L  +  V +  K   +        +C+     L    + L+     +V+F+ +MAI +PH  L++ L G+++ + L  +LP + +
Sbjct:  117 DKPRITAWEAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLIIFAAVVCCYTGKILIACLYEENEDGQLVRVRDSYVDIANACCA------PRFPALGGHVVNVAQIIELVMTCILYVV-VSGNLMYNSFPTLPVSQRSWAIIATAA----LLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWDKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQKPSEFHC---MMNWTHIAACILKGLFALVAYLTWADETKEVITDNL---PSSIRAVVNLFLVSKALLSYPLPFFAAVEVLEKTFFQDGGRAFFPDCYGGDGRLKSWGLSLRCA---LVVFTMLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFH 482          
BLAST of slc36a-2 vs. Ensembl Xenopus
Match: jph1 (junctophilin 1 [Source:Xenbase;Acc:XB-GENE-954753])

HSP 1 Score: 207.994 bits (528), Expect = 1.641e-60
Identity = 137/401 (34.16%), Postives = 228/401 (56.86%), Query Frame = 1
Query:  217 DSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE------DHFSKKVRLEIVGA--------AVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR 1371
            DSS+ +    L++L+KGNIGTG+L++P  +K AGI LG L ++ +G ++ +   +L++CA  L  +    R  +DY + +    +  PS+ LQR+    + +   F+I+TQ+GFCC Y +F++DNIK  VE      +  S    L +V +        + +  L+ + +I NL+ ++  ++ AN+S +  +IMI  Y    I D T     + +    + FG  IFAFE I +VLP++NKMK P ++     V+   M  V  LY +MG  G+L+FG + Q SITLNL +   W    ++ L+ F I +++ LQ Y+   I    +  L  H      V+ + L +   L+ I + V+AI IPHL L+++L+G++SSS LALI+PP++ +++ Y+E  +R
Sbjct:   46 DSSSTTWYQTLIHLLKGNIGTGLLSLPLAVKNAGIVLGPLSLVFMGIIAVHCMDLLVKCAHHLCQRN--QRPFVDYGDALMYSMQGSPSQWLQRHSVWGRRIVGFFLILTQLGFCCVYFVFLADNIKQVVEAANGTTNDCSSNETLVLVESMDSRLYILSFLPFLILLVFITNLRYLSIFSLLANLSMLGSVIMIYQYIGRDIPDPTSLSFVSSWRSYALFFGTAIFAFEGIGVVLPLENKMKIPHQFPV---VLYVGMGIVTILYISMGTLGYLRFGSSIQASITLNLPNC--WFYQSVKLLYSFGIFITFALQFYVAAEIIVPAV-TLHVHDR---WVRCMDLTVRAALVCI-TCVLAILIPHLGLVISLVGSVSSSALALIIPPLLEILTYYTEGLSR 434          
BLAST of slc36a-2 vs. Ensembl Xenopus
Match: jph1 (junctophilin 1 [Source:Xenbase;Acc:XB-GENE-954753])

HSP 1 Score: 208.379 bits (529), Expect = 1.846e-60
Identity = 137/401 (34.16%), Postives = 228/401 (56.86%), Query Frame = 1
Query:  217 DSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE------DHFSKKVRLEIVGA--------AVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR 1371
            DSS+ +    L++L+KGNIGTG+L++P  +K AGI LG L ++ +G ++ +   +L++CA  L  +    R  +DY + +    +  PS+ LQR+    + +   F+I+TQ+GFCC Y +F++DNIK  VE      +  S    L +V +        + +  L+ + +I NL+ ++  ++ AN+S +  +IMI  Y    I D T     + +    + FG  IFAFE I +VLP++NKMK P ++     V+   M  V  LY +MG  G+L+FG + Q SITLNL +   W    ++ L+ F I +++ LQ Y+   I    +  L  H      V+ + L +   L+ I + V+AI IPHL L+++L+G++SSS LALI+PP++ +++ Y+E  +R
Sbjct:   46 DSSSTTWYQTLIHLLKGNIGTGLLSLPLAVKNAGIVLGPLSLVFMGIIAVHCMDLLVKCAHHLCQRN--QRPFVDYGDALMYSMQGSPSQWLQRHSVWGRRIVGFFLILTQLGFCCVYFVFLADNIKQVVEAANGTTNDCSSNETLVLVESMDSRLYILSFLPFLILLVFITNLRYLSIFSLLANLSMLGSVIMIYQYIGRDIPDPTSLSFVSSWRSYALFFGTAIFAFEGIGVVLPLENKMKIPHQFPV---VLYVGMGIVTILYISMGTLGYLRFGSSIQASITLNLPNC--WFYQSVKLLYSFGIFITFALQFYVAAEIIVPAV-TLHVHDR---WVRCMDLTVRAALVCI-TCVLAILIPHLGLVISLVGSVSSSALALIIPPLLEILTYYTEGLSR 434          
BLAST of slc36a-2 vs. Ensembl Xenopus
Match: SLC36A4 (solute carrier family 36 (proton/amino acid symporter), member 4 [Source:NCBI gene;Acc:100493349])

HSP 1 Score: 207.994 bits (528), Expect = 6.089e-60
Identity = 131/415 (31.57%), Postives = 229/415 (55.18%), Query Frame = 1
Query:  157 SNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGA-----------AVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP-IQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
            S+G  +E   +   +  H      ++    L++L+KGNIGTG+L +P  IK AG+ LG + ++  G +S +  +IL+RC+  L  +Y   +  L Y+ETVG   E GPS  LQR     + + + F+++TQ+GFC  Y +F+++NIK  +E   + K++   +G            + + L++ + +I++LK ++ ++  AN+S  + +I++  Y I  + D    P  T +    + FG  IFAFE I +VLP++N+M+  + +   +  +N  M  V  LY ++   G+  FG+  +GSITLNL    SWL   ++ L+ F I V+Y +Q Y+P  I    +      Q    L+ +  ++     +V  +   A+ IP LDL+++ +GA+SSS LALILPP++ +++   E+
Sbjct:   64 SDGFGDEHQYLQRRQ--HSDSKDGLTFFQTLIHLLKGNIGTGLLGLPLAIKNAGLLLGPISLLFFGIISIHCMNILVRCSHFLCQRY--KKTNLGYSETVGLALEVGPSGFLQRRASFGRSMVDWFLVVTQLGFCSVYFVFLAENIKQVLEVFLATKLQQPGIGGIWTLDLRIYMFSFLPLIIPLVFIRDLKNLSLLSFLANLSMAISLIIVYQYVIRNLSDPRALPLGTSWKTYPLFFGTAIFAFEGIGVVLPLENRMRDKKDF---SKALNIGMAIVTALYISLATLGYFCFGDQIKGSITLNLPQD-SWLYQVVKILYSFGIYVTYAIQYYVPAEIILPAVTSRV--QKTRKLLCEFTMRF---FLVCLTCAFAVLIPRLDLVISFVGAVSSSTLALILPPLVEIITFQKEH 465          
BLAST of slc36a-2 vs. Ensembl Xenopus
Match: SLC36A4 (solute carrier family 36 (proton/amino acid symporter), member 4 [Source:NCBI gene;Acc:100493349])

HSP 1 Score: 207.994 bits (528), Expect = 7.123e-60
Identity = 131/415 (31.57%), Postives = 229/415 (55.18%), Query Frame = 1
Query:  157 SNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGA-----------AVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP-IQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
            S+G  +E   +   +  H      ++    L++L+KGNIGTG+L +P  IK AG+ LG + ++  G +S +  +IL+RC+  L  +Y   +  L Y+ETVG   E GPS  LQR     + + + F+++TQ+GFC  Y +F+++NIK  +E   + K++   +G            + + L++ + +I++LK ++ ++  AN+S  + +I++  Y I  + D    P  T +    + FG  IFAFE I +VLP++N+M+  + +   +  +N  M  V  LY ++   G+  FG+  +GSITLNL    SWL   ++ L+ F I V+Y +Q Y+P  I    +      Q    L+ +  ++     +V  +   A+ IP LDL+++ +GA+SSS LALILPP++ +++   E+
Sbjct:   69 SDGFGDEHQYLQRRQ--HSDSKDGLTFFQTLIHLLKGNIGTGLLGLPLAIKNAGLLLGPISLLFFGIISIHCMNILVRCSHFLCQRY--KKTNLGYSETVGLALEVGPSGFLQRRASFGRSMVDWFLVVTQLGFCSVYFVFLAENIKQVLEVFLATKLQQPGIGGIWTLDLRIYMFSFLPLIIPLVFIRDLKNLSLLSFLANLSMAISLIIVYQYVIRNLSDPRALPLGTSWKTYPLFFGTAIFAFEGIGVVLPLENRMRDKKDF---SKALNIGMAIVTALYISLATLGYFCFGDQIKGSITLNLPQD-SWLYQVVKILYSFGIYVTYAIQYYVPAEIILPAVTSRV--QKTRKLLCEFTMRF---FLVCLTCAFAVLIPRLDLVISFVGAVSSSTLALILPPLVEIITFQKEH 470          
BLAST of slc36a-2 vs. Ensembl Xenopus
Match: slc32a1 (solute carrier family 32 member 1 [Source:NCBI gene;Acc:448348])

HSP 1 Score: 66.6254 bits (161), Expect = 4.617e-11
Identity = 84/384 (21.88%), Postives = 167/384 (43.49%), Query Frame = 1
Query:  226 NISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI--KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXN--DVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLF-VFSILVSYLLQIYIPVFICSKLIKKL-------ECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINV 1341
             I++  A  N+     G  +L +P  I + G  LG+ LII    +  Y   IL+ C     +     R    Y +              R+ KL   + NV  II  +  C  Y++ +S N+   SF     S+K    I+  A   +LL   ++KNLK +++ ++   ++  +  ++++ Y +   +D+         +     ++ GI++F++ +   +  ++  M+ P+ +     ++N   +    L        +L + + T+  IT NL   PS +  +  LF V   L+SY L  +  V +  K + +         C+     L  K     +   +V+F+ +MAI +PH  L++ L G+++ + L  +LP + ++
Sbjct:  108 KITAWEAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLIIFAAVVCCYTGKILIACLYEENEDGETVRVRDSYVDIANACCA------PRFPKLGGRVVNVAQIIELVMTCILYVV-VSGNLMYNSFPSLPISQK-SWSIIATA---MLLPCAFLKNLKAVSKFSLLCTLAHFVINVLVIAYCLSRARDWAWDKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQSPKEFHC---MMNWTHIAACILKGLFALVAYLTWADETKEVITDNL---PSTIRAVVNLFLVAKALLSYPLPFFAAVEVLEKSLFQEGARAFFPNCYGGDGRL--KSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHL 471          
BLAST of slc36a-2 vs. Ensembl Mouse
Match: Slc36a4 (solute carrier family 36 (proton/amino acid symporter), member 4 [Source:MGI Symbol;Acc:MGI:2442595])

HSP 1 Score: 204.142 bits (518), Expect = 8.341e-59
Identity = 136/435 (31.26%), Postives = 233/435 (53.56%), Query Frame = 1
Query:  133 ISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFS-----------------KKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            I+E     S+ E  E+TL+ +++   L     IS    L++L+KGNIGTG+L +P  IK AGI LG + ++ +G +S +  HIL+RC+  L  ++   ++TL Y++TV    E  P S LQR     + + + F++ITQ+GFC  Y++F+++N+K   E                     + V L +     + L++ + +I+ LK +  ++  ANIS    +++I  Y +  + D    P    +    + FG  +FAFE I +VLP++N+M+  +R+      +N  M  V  LY ++   G++ F +  +GSITLNL     WL   ++ L+ F I V+Y +Q Y+P   I   +  +L          ++I    I  L+V  +   AI IP LD++++ +GA+SSS LALILPP++ +++ +S++    W
Sbjct:   24 INEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCQRF--KKSTLGYSDTVSFAMEASPWSCLQRQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLGSTPIVSNGSDLSHACERRSVDLRVYMLCFLPLIILLVFIRELKNLFVLSFLANISMAASLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMRESKRF---PQALNIGMAIVTVLYISLATLGYMCFRDEIKGSITLNLPQD-MWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGVTARLHAKW------KRICEFGIRSLLVSITCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILT-FSKDHYNIW 445          
BLAST of slc36a-2 vs. Ensembl Mouse
Match: Slc36a2 (solute carrier family 36 (proton/amino acid symporter), member 2 [Source:MGI Symbol;Acc:MGI:1891430])

HSP 1 Score: 197.978 bits (502), Expect = 1.005e-56
Identity = 140/398 (35.18%), Postives = 236/398 (59.30%), Query Frame = 1
Query:  226 NISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVED--------HFSKKV--------RLEIVG-AAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             I+    L++L+KGN+GTGIL +P  +K AGI +G L ++ +G ++ +  HIL+RCAQ    +  +++  +DY +TV     F P+  LQ +    + + + F+I+TQ+GFCC Y++F++DN+K  VE         H ++ V        RL ++    V+GLL+   +++NL+++   ++ ANIS ++ +++I  Y I  I D +Q P    +    + FG  IF+FE+I +VLP++NKMK    + T   +++  M  +  LY A+G  G+L+FG++ + SITLNL +   WL   ++ L+V  IL +Y LQ Y+P    +++I  L   Q        + L I   L+ + + ++AI IP LDL+L+L+G++SSS LALI+PP++ VV+ Y E 
Sbjct:   48 GITGFQTLVHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGLIACHCMHILVRCAQRFCHR--LNKPFMDYGDTVMHGLAFSPNAWLQNHAHWGRRVVSFFLIVTQLGFCCVYIVFLADNLKQVVEAVNSTTISCHKNETVVLTPTMDSRLYMLSFLPVLGLLV---FVRNLRVLTIFSLLANISMLVSLVIIAQYIIQEIPDASQLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKDARGFPT---ILSLGMSIITTLYIAIGALGYLRFGDDIKASITLNLPNC--WLYQSVKLLYVVGILCTYALQFYVP----AEIIIPLAVSQVSKRWALPVDLSIRLALVCL-TCMLAILIPRLDLVLSLVGSVSSSALALIIPPLLEVVTYYGEG 430          
BLAST of slc36a-2 vs. Ensembl Mouse
Match: Slc36a1 (solute carrier family 36 (proton/amino acid symporter), member 1 [Source:MGI Symbol;Acc:MGI:2445299])

HSP 1 Score: 186.422 bits (472), Expect = 1.674e-52
Identity = 131/404 (32.43%), Postives = 230/404 (56.93%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQR-YKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE----------------DHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             L ++S+++    L++L+KGNIGTG+L +P  +K AG+ LG L ++ +G ++ +   IL++CA  L  +  +++  LDY +TV    E  PS   R +    + + + F+I+TQ+GFCC Y +F++DN K  +E                   +   RL ++  + +  L+ + +I+NL++++  ++ ANIS  + +IMI  + +  I D +  P   P+    + FG  IFAFE I +VLP++NKMK  +++     ++   M  +  LY ++G  G+L+FG N +GSITLNL +   WL   ++ L+   I  +Y LQ Y+    I   ++ ++  H     L+  + ++     +V  + V+AI IP LDL+++L+G++SSS LALI+PP++ VV+ Y E 
Sbjct:   39 RLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRR--LNKPFLDYGDTVMYGLECSPSTWVRNHSHWGRRIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNVTVIPTPTMDSRLYML--SFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPL---ILYLGMAIITVLYISLGSLGYLQFGANIKGSITLNLPNC--WLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPEHFE---LMVDLCVRTA---MVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEVVTYYGEG 427          
BLAST of slc36a-2 vs. Ensembl Mouse
Match: Slc36a1 (solute carrier family 36 (proton/amino acid symporter), member 1 [Source:MGI Symbol;Acc:MGI:2445299])

HSP 1 Score: 186.422 bits (472), Expect = 1.674e-52
Identity = 131/404 (32.43%), Postives = 230/404 (56.93%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQR-YKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE----------------DHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             L ++S+++    L++L+KGNIGTG+L +P  +K AG+ LG L ++ +G ++ +   IL++CA  L  +  +++  LDY +TV    E  PS   R +    + + + F+I+TQ+GFCC Y +F++DN K  +E                   +   RL ++  + +  L+ + +I+NL++++  ++ ANIS  + +IMI  + +  I D +  P   P+    + FG  IFAFE I +VLP++NKMK  +++     ++   M  +  LY ++G  G+L+FG N +GSITLNL +   WL   ++ L+   I  +Y LQ Y+    I   ++ ++  H     L+  + ++     +V  + V+AI IP LDL+++L+G++SSS LALI+PP++ VV+ Y E 
Sbjct:   39 RLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRR--LNKPFLDYGDTVMYGLECSPSTWVRNHSHWGRRIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNVTVIPTPTMDSRLYML--SFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPL---ILYLGMAIITVLYISLGSLGYLQFGANIKGSITLNLPNC--WLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPEHFE---LMVDLCVRTA---MVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEVVTYYGEG 427          
BLAST of slc36a-2 vs. Ensembl Mouse
Match: Slc36a1 (solute carrier family 36 (proton/amino acid symporter), member 1 [Source:MGI Symbol;Acc:MGI:2445299])

HSP 1 Score: 186.422 bits (472), Expect = 1.674e-52
Identity = 131/404 (32.43%), Postives = 230/404 (56.93%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQR-YKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE----------------DHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             L ++S+++    L++L+KGNIGTG+L +P  +K AG+ LG L ++ +G ++ +   IL++CA  L  +  +++  LDY +TV    E  PS   R +    + + + F+I+TQ+GFCC Y +F++DN K  +E                   +   RL ++  + +  L+ + +I+NL++++  ++ ANIS  + +IMI  + +  I D +  P   P+    + FG  IFAFE I +VLP++NKMK  +++     ++   M  +  LY ++G  G+L+FG N +GSITLNL +   WL   ++ L+   I  +Y LQ Y+    I   ++ ++  H     L+  + ++     +V  + V+AI IP LDL+++L+G++SSS LALI+PP++ VV+ Y E 
Sbjct:   39 RLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRR--LNKPFLDYGDTVMYGLECSPSTWVRNHSHWGRRIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNVTVIPTPTMDSRLYML--SFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPL---ILYLGMAIITVLYISLGSLGYLQFGANIKGSITLNLPNC--WLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPEHFE---LMVDLCVRTA---MVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEVVTYYGEG 427          
BLAST of slc36a-2 vs. UniProt/SwissProt
Match: sp|Q4KL91|S36A4_XENLA (Proton-coupled amino acid transporter 4 OS=Xenopus laevis OX=8355 GN=slc36a4 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.831e-64
Identity = 135/430 (31.40%), Postives = 243/430 (56.51%), Query Frame = 1
Query:  118 NDDKQISE-LKSITSNGEMNEETLID---VEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGA----------AVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP-IQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
            +D+K+  E +K +  N + ++ T  +   ++  P L +   ++    L++L+KGNIGTG+L +P  +K AG+ LG + ++  G +S +  +IL+RC+  L  +Y   +A L Y++TVG   E GP  LQR+    + L + F+++TQ+GFC  Y +F+++NIK   E     K++   +G           + + L++ + +I++LK ++ ++ FAN+S  + ++++  Y I  + D    P  T +    + FG  IFAFE I +VLP++N+M+  + +   +  +N  M  V  LY ++   G+  FG+  +GSITLNL    SWL   ++ L+ F I V+Y +Q Y+P  I    +      Q    L+ +  ++     +V  +  +A+ IP LDL+++ +GA+SSS LALILPP++ +++ + EN
Sbjct:   46 SDNKKDEEVMKPLIENEDDSDGTCDEHQYLQRHPDLDNKDGLTFFQTLIHLLKGNIGTGLLGLPLAMKNAGVLLGPISLLFFGIISIHCMNILVRCSHFLCQRY--KKANLGYSDTVGLALEVGPGVLQRHASFGRNLVDWFLVVTQLGFCSVYFVFLAENIKQVFEVFLETKLQQSEIGIWSLDLRIYMFSFLPLIIPLVFIRDLKNLSLLSFFANVSMAISLLIVYQYVIRNLSDPRTLPLGTSWKTYPLFFGTAIFAFEGIGVVLPLENRMRDKKDF---SKALNIGMAIVTTLYISLATLGYFCFGDQIKGSITLNLPQD-SWLYQLVKILYSFGIYVTYAIQYYVPAEIILPAVTSRV--QKTRKLLCEFTMRF---FLVCLTCAVAVLIPRLDLVISFVGAVSSSTLALILPPLVEIITYHKEN 464          
BLAST of slc36a-2 vs. UniProt/SwissProt
Match: sp|Q8CH36|S36A4_MOUSE (Proton-coupled amino acid transporter 4 OS=Mus musculus OX=10090 GN=Slc36a4 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.623e-58
Identity = 136/435 (31.26%), Postives = 233/435 (53.56%), Query Frame = 1
Query:  133 ISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFS-----------------KKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            I+E     S+ E  E+TL+ +++   L     IS    L++L+KGNIGTG+L +P  IK AGI LG + ++ +G +S +  HIL+RC+  L  ++   ++TL Y++TV    E  P S LQR     + + + F++ITQ+GFC  Y++F+++N+K   E                     + V L +     + L++ + +I+ LK +  ++  ANIS    +++I  Y +  + D    P    +    + FG  +FAFE I +VLP++N+M+  +R+      +N  M  V  LY ++   G++ F +  +GSITLNL     WL   ++ L+ F I V+Y +Q Y+P   I   +  +L          ++I    I  L+V  +   AI IP LD++++ +GA+SSS LALILPP++ +++ +S++    W
Sbjct:   24 INEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCQRF--KKSTLGYSDTVSFAMEASPWSCLQRQAAWGRQVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLGSTPIVSNGSDLSHACERRSVDLRVYMLCFLPLIILLVFIRELKNLFVLSFLANISMAASLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMRESKRF---PQALNIGMAIVTVLYISLATLGYMCFRDEIKGSITLNLPQD-MWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGVTARLHAKW------KRICEFGIRSLLVSITRAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILT-FSKDHYNIW 445          
BLAST of slc36a-2 vs. UniProt/SwissProt
Match: sp|Q6YBV0|S36A4_HUMAN (Proton-coupled amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC36A4 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 7.276e-58
Identity = 134/430 (31.16%), Postives = 230/430 (53.49%), Query Frame = 1
Query:  133 ISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKK-----------------VRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDN 1368
            I+E     ++ E +E+ L+ V++   L D   IS    LM+L+KGNIGTG+L +P  IK AGI LG + ++ +G +S +  HIL+RC+  L  ++   ++TL Y++TV    E  P S LQ+     + + + F++ITQ+GFC  Y++F+++N+K   E     K                 V L I     +  ++ + +I+ LK +  ++  AN+S  + +++I  Y +  + D    P    +    + FG  +FAFE I +VLP++N+MK  +R+      +N  M  V  LY  +   G++ F +  +GSITLNL         ++ L+ F I V+Y +Q Y+P    +++I      +  +   Q  +  I   L+ I +   AI IP LD++++ +GA+SSS LALILPP++ +++   E+ N
Sbjct:   27 INEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRF--KKSTLGYSDTVSFAMEVSPWSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLRIYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMKESKRF---PQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQSVKILYSFGIFVTYSIQFYVP----AEIIIPGITSKFHTKWKQICEFGIRSFLVSI-TCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEHYN 446          
BLAST of slc36a-2 vs. UniProt/SwissProt
Match: sp|Q7Z2H8|S36A1_HUMAN (Proton-coupled amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC36A1 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.681e-57
Identity = 134/419 (31.98%), Postives = 237/419 (56.56%), Query Frame = 1
Query:  208 HLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVED--------HFSKKVRL------EIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-----FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLS 1401
                S++ +    L++L+KGNIGTG+L +P  +K AGI +G + ++ +G ++ +   IL++CA     +  ++++ +DY +TV    E  P S L+ +    + + + F+I+TQ+GFCC Y +F++DN K  +E         H ++ V L       +   + +  L+ + +I+NL+ ++  ++ ANI+ ++ ++MI  + +  I D +  P   P+    + FG  IF+FE I +VLP++NKMK P ++     ++   MV V  LY ++G  G+L+FG N QGSITLNL +   WL   ++ L+   I  +Y LQ Y+P      F  S+  +  E       LV  + ++ +   +V  + ++AI IP LDL+++L+G++SSS LALI+PP++ V + YSE  +    FK  ++S
Sbjct:   40 RFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRR--LNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPL---ILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNC--WLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCE-------LVVDLFVRTV---LVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALIS 441          
BLAST of slc36a-2 vs. UniProt/SwissProt
Match: sp|Q495M3|S36A2_HUMAN (Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.134e-57
Identity = 138/437 (31.58%), Postives = 246/437 (56.29%), Query Frame = 1
Query:  166 EMNEETLID--VEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVE-------DHFSKKV---------RLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-----FICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLS 1401
            E  + T +D    E   L  +  I+   AL++L+KGN+GTGIL +P  +K AGI +G L ++ +G ++ +  HIL++CAQ    +  +++  +DY +TV    E  P+  LQ +    + + + F+IITQ+GFCC Y++F++DN+K  VE       + +S +          RL ++      +LL +  I+NL+I+   ++ ANIS ++ +++I+ Y    I D ++ P    +    + FG  IF+FE+I +VLP++NKMK    +     +++  M  V  LY  M   G+L+FG++ + SI+LNL +   WL   ++ L++  IL +Y LQ Y+P      F  S++         + +L   + ++++   +V  + ++AI IP LDL+++L+G++S + LALI+PP++ V + YSE  +    FK  ++S
Sbjct:   31 ENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKR--LNKPFMDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVL--IRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHF---PAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNC--WLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRV-------STRWALPLDLSIRLV---MVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALIS 448          
BLAST of slc36a-2 vs. TrEMBL
Match: A0A0H3YFA5 (Slc36a-2 OS=Schmidtea mediterranea OX=79327 GN=slc36a-2 PE=2 SV=1)

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 459/459 (100.00%), Postives = 459/459 (100.00%), Query Frame = 1
Query:  103 MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVXXXXXXXXXXXXXTASSIYALIKQ 1479
            MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDFTQFPTFTPFNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVLIFLFGLIGFIGGTASSIYALIKQ
Sbjct:    1 MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDFTQFPTFTPFNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVLIFLFGLIGFIGGTASSIYALIKQ 459          
BLAST of slc36a-2 vs. TrEMBL
Match: A0A4Z2CLT6 (Proton-coupled amino acid transporter 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_009581 PE=4 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.801e-112
Identity = 185/420 (44.05%), Postives = 277/420 (65.95%), Query Frame = 1
Query:  124 DKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSK-KVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIM-GIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            D++ +    I SN   N+      + DPH +    I+   ALM+LIKGNIGTGIL+MP V+KYAG+  G+++II  G LSTYL H+LLR A  +  +Y  DR+ +DY ET   V ++GP +L++ K  +K   N F+I+TQ+G CC Y LFI++NI+ F+   F    + + +VG  V  LL+ M +  +++++  ++  ANI   LG+I+I VY    G+    +FP  T FN++L+AF IV+F+FE I+LVLPIQ+KM  P  Y +R GV+ T M+ VVC+ AA+GF+GFL+FGE ++GSITLN+   P W  P++PLF+ ++ VSYLLQ Y+P  I S+L++KL+CH N S+  + I LK++   +VIFSY  A+ IP LDL+L+L+G+++ S LA ILP  + ++  + +  N  W
Sbjct:    9 DQESNPDGDIQSNASENDNH-TSQQRDPH-AMGKKINEYQALMSLIKGNIGTGILSMPVVLKYAGLWTGLVMIIISGILSTYLMHVLLRTANAVQSRYNWDRSKMDYAETAFVVLKYGPEKLRKPKGKLKHTVNGFLIVTQVGSCCVYTLFITENIRYFLMSFFPHLTLNVYLVGFIVCLLLIVMNFKSSMRVVTYLSGLANICTALGMILIFVYLFTSGLYSVERFPAITNFNNLLIAFSIVMFSFEGISLVLPIQSKMLDPSGYGSRFGVLTTGMIVVVCMNAAVGFFGFLRFGEQSEGSITLNIPQVPYWFAPVKPLFIIAMFVSYLLQYYVPAQIFSRLMEKLKCHHNASNQQRYINLKLMRISLVIFSYAAAVLIPRLDLLLSLIGSLAGSTLAFILPATLELIYLWPDRGNISW 426          
BLAST of slc36a-2 vs. TrEMBL
Match: A0A3R7CZ54 (Proton-coupled amino acid transporter 4 OS=Clonorchis sinensis OX=79923 GN=slc36a4 PE=4 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.975e-111
Identity = 176/432 (40.74%), Postives = 285/432 (65.97%), Query Frame = 1
Query:  118 NDDKQISELKSITSNGEMNEETLIDVEE------DPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWI-----KNLKIIARVAIFANISAILGIIMIMVYSIM-GIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            +D+K I+  ++  ++  ++  T+ D+EE      DPH S   N++   +LMN IKGNIGTG+L+MP V++Y+G+  G  +II  G++++YL  +L+R ++++ +KY +D + +DYTETV  VF++GP RL++ K  +K   NVF+I+TQIGF C Y LFI+DN++ F+   F        +   V+ L++C+C I      +++++  ++  AN++ ++G ++I  Y +  G+  FT  P +T    VL+ F IV+F+FE I+LVLPI++KM +PE Y+   GV++  M  ++ L AA GF+G+LKFGE  +G+ITLN+   P W  P+QPLF+ +I  +YLLQ YIP  I ++L++KL CH+  S   + I LK++  L+V+F+YVM I+IP LDLM++L+GA +SS LA ILPP++ +V  + +     W
Sbjct:   34 SDEKHINNQETPPASDVLSVSTVDDLEENIMIVADPH-SLGENLTEPHSLMNFIKGNIGTGVLSMPVVLRYSGLWTGFFMIIFAGSVASYLMRVLVRTSRSVREKYNLDHSKMDYTETVFYVFKYGPPRLRKPKGKIKHTVNVFLIVTQIGFSCVYTLFITDNLRYFLHAFFPDLY----LNFYVVALIVCVCLIPMSLWSSMRVLGHLSAVANLATLIGAVLIFAYLLSSGLLPFTTLPVYTNPRGVLIGFSIVMFSFEGISLVLPIESKMAHPEFYLHPFGVLSVGMTIIISLNAAFGFFGYLKFGEKAEGTITLNIPHYPWWFSPVQPLFIVAIYFTYLLQFYIPASIFARLMEKLRCHREASERRRYINLKVMRALLVMFAYVMVITIPKLDLMISLIGAFASSILAFILPPVLEIVHLWEDRHRIKW 460          
BLAST of slc36a-2 vs. TrEMBL
Match: A0A4S2MM52 (Aa_trans domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000400 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 3.813e-111
Identity = 176/431 (40.84%), Postives = 284/431 (65.89%), Query Frame = 1
Query:  118 NDDKQISELKSITSNGEMNEETLIDVEEDPHL-----SDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWI-----KNLKIIARVAIFANISAILGIIMIMVYSIM-GIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            +D+K +S  ++  +   ++  T+ D+EED  +     +   N++    LMN IKG+IGTG+L+MP V++Y+G+  G  +II  G++++YL  +L+R ++++ +KY +DR+ +DYTETV  VF++GP  L++ K  +K   NVF+I+TQIGF C Y LFI+DN++ F+   F        +   V+ L++C+C I      +++++A ++  AN++ ++G ++I VY +  G+  FT  P +T    VL+ F IV+FAFE I+LVLPIQ+KM +PE Y+   GV++  M  ++ L AA GF+G+LKFGE  +G+ITLN+   P W  P+QPLF+ +I  +YLLQ YIP  I ++L++KL CH+  S   + I LK++  L+V+F+YVM I+IP LDLM++L+GA +SS LA ILPP++ +V  + +     W
Sbjct:    3 SDEKHVSNQETPPATDALSVTTVDDLEEDIMIIADLHNPGENLTERHTLMNFIKGSIGTGVLSMPVVLRYSGLWTGFFMIIFAGSVASYLMKVLVRTSRSVREKYNLDRSKMDYTETVFYVFKYGPPCLRKPKGKIKHTVNVFLIVTQIGFSCVYTLFITDNLRYFLHAFFPDLY----LNFYVIALIVCVCLIPMSLWSSMRVLAYLSAVANLATLIGAVLIFVYLLSSGLLPFTTLPVYTNPRGVLIGFSIVMFAFEGISLVLPIQSKMAHPEFYLHPFGVLSVGMTIIISLNAAFGFFGYLKFGEKAEGTITLNIPHYPWWFSPVQPLFIVAICFTYLLQFYIPASIFARLMEKLRCHREASERRRYINLKVMRALLVMFAYVMVITIPKLDLMISLIGAFASSILAFILPPVLEIVHLWEDRHRIKW 429          
BLAST of slc36a-2 vs. TrEMBL
Match: A0A075AAQ3 (Aa_trans domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_01166 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.726e-110
Identity = 173/432 (40.05%), Postives = 285/432 (65.97%), Query Frame = 1
Query:  118 NDDKQISELKSITSNGEMNEETLIDVEE------DPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWI-----KNLKIIARVAIFANISAILGIIMIMVYSIM-GIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDW 1377
            +D + ++  ++  +   ++  T+ D+EE      DPH +   N++    LMN IKGNIGTG+L+MP V++Y+G+  G  +II  G++++YL  +L+R ++++ +KY +DR+ +DYTETV  VF++GP  L++ K  +K   NVF+I+TQIGF C Y LFI+DN++ F+   F        +   V+ L++C+C I      +++++A ++  AN++ ++G ++I  Y +  G+  F+  P +T    +L+ F IV+F+FE I+LVLPI++KM +PE Y+   GV++  M  ++ L AA GF+G+LKFGE  +G+ITLN+  +P W  P+QPLFV +I  +YLLQ YIP  I ++L++KL CH+  S   + I LK++  L+V+F+YVM I+IP LDLM++L+GA +SS LA ILPP++ +V  + +  +  W
Sbjct:    3 SDKRHVNNQETPPATDALSVSTVDDLEESILIVADPH-NLGENLTEPHTLMNFIKGNIGTGVLSMPVVLRYSGLWTGFFMIIFAGSVASYLMKVLVRTSRSVREKYNLDRSKMDYTETVFYVFKYGPPCLRKPKGKIKHTVNVFLIVTQIGFSCVYTLFITDNLRYFLHAFFPDLY----LNFYVVALIVCVCLIPMSLWSSMRVLAHLSAVANLATLIGAMLIFAYLLSSGLLPFSTLPVYTNPRGILIGFSIVMFSFEGISLVLPIESKMAHPEFYLHPFGVLSVGMTIIISLNAAFGFFGYLKFGEKAEGTITLNIPHSPWWFSPVQPLFVVAICFTYLLQFYIPASIFARLMEKLRCHREASERRRYINLKVMRALLVMFAYVMVITIPKLDLMISLIGAFASSILAFILPPVLEIVHLWEDRHHIKW 429          
BLAST of slc36a-2 vs. Ensembl Cavefish
Match: slc36a4 (solute carrier family 36 member 4 [Source:NCBI gene;Acc:103029827])

HSP 1 Score: 189.504 bits (480), Expect = 1.635e-53
Identity = 121/404 (29.95%), Postives = 221/404 (54.70%), Query Frame = 1
Query:  226 NISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSR-LQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDH-------------FSKKVRLEIVGAAVMGLLL--------------CMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNL-KDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLI--KKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVV 1344
             I+    L++L+KGNIGTG+L +P  ++ AGI LG + ++ +G +  +  H+L+ C+  L +++   ++ L Y++TV    E   S  L+R     + L N F+++TQ+GFC  Y +F+++NIK  VE H             +S          +  GL L               + +I +L+ +A ++  AN+   + +++I  Y +  + D  + P  + ++     FG  IFAFE I +VLP++N+M+ P+R+      ++  M  V+ LY ++   G+++FG++ +GSITLNL  D  S L+ ++ L+ F + VS+ +Q ++P  I    +  +  E ++  + L  +        L+V  + V+AI +P LDL+++L+GA+SSS LAL+ PP++ +V
Sbjct:   38 GITFTQTLLHLLKGNIGTGLLGLPLAVRNAGIVLGPVCLVLMGVVCVHCMHVLVTCSHQLSERF--KKSPLGYSDTVAVAMETSSSHCLRRGAPFGRHLVNFFLVLTQLGFCSVYFVFLAENIKQVVEGHRGNSSGSVSVMMLYSNSTEGGGADDSGAGLELDQRVYMLLLLPLLILLSFITDLRSMAALSAAANVCMAISLVLIFTYILHDVGDPRRLPFVSTWSKFPFFFGTAIFAFEGIGVVLPLENQMREPKRF---PQALDIGMGVVIVLYVSLATLGYIRFGDDIKGSITLNLPHDTWSNLL-VKVLYSFGVYVSFAVQFFVPADILVPAVCERVSEPYRRPADLCTRT-------LLVCITCVVAILVPRLDLVISLVGAVSSSALALVFPPLVELV 428          
BLAST of slc36a-2 vs. Ensembl Cavefish
Match: slc36a1 (proton-coupled amino acid transporter 1 [Source:NCBI gene;Acc:103027906])

HSP 1 Score: 182.185 bits (461), Expect = 4.716e-51
Identity = 136/427 (31.85%), Postives = 232/427 (54.33%), Query Frame = 1
Query:  172 NEETLIDVEEDPH-----------LSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFG---PSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAV--------------MGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPVFIC-SKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             EE+  + EE  H           +   +  S    L++L+KGNIGTG+L +P  +K AG+ +G L +  +G ++ +   IL++C+  L  K G  +  L Y + V    E+G    S L+ + +  + L N+F+IITQ+GFCC Y +F+SDNIK  VE      V  +    AV              +  ++ + + +NLK +A  +  ANI     +++I  + +  I +    P      D  + FG  IFAFE I +VLP++NKM+ P+R+   + V+   M  V  LY ++G  G++ FG +  GSITLNL D   W+   ++ L+ F I ++Y LQ Y+P  I   + + +++    +  L+  + +++    +VI + ++AI IP LDL+++L+G++SSS LALILPP++ +++ ++E 
Sbjct:   16 TEESPTEDEEPVHSPSRMQRQYERIGGRTGSSFFQTLIHLLKGNIGTGLLGLPLAVKNAGLVVGPLSLFVMGIVAVHCMQILVKCSHHLSAKLG--KPFLTYGDAV----EYGMENVSWLRNHSRWGRRLVNIFLIITQLGFCCVYFVFLSDNIKQVVEAANGTTVNCDTNQTAVIVPSYDSRLYMLFILPFIILLVFTRNLKFLAPFSFVANIVMCASLVLIYYFCLTHIPNPIDLPKVGRPIDYPLFFGTAIFAFEGIGVVLPLENKMQKPQRF---SAVLYLGMGIVTFLYISLGTIGYICFGSHIGGSITLNLPDC--WMYQSVKLLYSFGIYITYALQFYVPAEILIPQAVARVD---PRWELLVDLSIRV---GLVILTCLLAILIPELDLVISLVGSVSSSALALILPPLLQIITFHNEG 425          
BLAST of slc36a-2 vs. Ensembl Cavefish
Match: slc36a1 (proton-coupled amino acid transporter 1 [Source:NCBI gene;Acc:103027906])

HSP 1 Score: 182.185 bits (461), Expect = 4.716e-51
Identity = 136/427 (31.85%), Postives = 232/427 (54.33%), Query Frame = 1
Query:  172 NEETLIDVEEDPH-----------LSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFG---PSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAV--------------MGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPVFIC-SKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             EE+  + EE  H           +   +  S    L++L+KGNIGTG+L +P  +K AG+ +G L +  +G ++ +   IL++C+  L  K G  +  L Y + V    E+G    S L+ + +  + L N+F+IITQ+GFCC Y +F+SDNIK  VE      V  +    AV              +  ++ + + +NLK +A  +  ANI     +++I  + +  I +    P      D  + FG  IFAFE I +VLP++NKM+ P+R+   + V+   M  V  LY ++G  G++ FG +  GSITLNL D   W+   ++ L+ F I ++Y LQ Y+P  I   + + +++    +  L+  + +++    +VI + ++AI IP LDL+++L+G++SSS LALILPP++ +++ ++E 
Sbjct:   16 TEESPTEDEEPVHSPSRMQRQYERIGGRTGSSFFQTLIHLLKGNIGTGLLGLPLAVKNAGLVVGPLSLFVMGIVAVHCMQILVKCSHHLSAKLG--KPFLTYGDAV----EYGMENVSWLRNHSRWGRRLVNIFLIITQLGFCCVYFVFLSDNIKQVVEAANGTTVNCDTNQTAVIVPSYDSRLYMLFILPFIILLVFTRNLKFLAPFSFVANIVMCASLVLIYYFCLTHIPNPIDLPKVGRPIDYPLFFGTAIFAFEGIGVVLPLENKMQKPQRF---SAVLYLGMGIVTFLYISLGTIGYICFGSHIGGSITLNLPDC--WMYQSVKLLYSFGIYITYALQFYVPAEILIPQAVARVD---PRWELLVDLSIRV---GLVILTCLLAILIPELDLVISLVGSVSSSALALILPPLLQIITFHNEG 425          
BLAST of slc36a-2 vs. Ensembl Cavefish
Match: slc38a7 (solute carrier family 38 member 7 [Source:NCBI gene;Acc:103025557])

HSP 1 Score: 63.1586 bits (152), Expect = 3.437e-10
Identity = 85/418 (20.33%), Postives = 176/418 (42.11%), Query Frame = 1
Query:  187 IDVEEDPHLSDSS--NISSNAALMNLIKGNIGTGILAMPAVIKYAG-IPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSF----------VEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAI--FANISAILG-----IIMIMVYSI--MGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLI-VIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNR 1371
            +D  + P  S  S    S+ AA+  ++   +G G+L  PA    AG +  G++L +C+         IL  C+Q  V   G       Y E V  V            K++ ++  + + +   G C A+++ I D +             V  H+    R  I   +V+ +L        L I   +    +A+  +++G     I++I+ Y +    I       + T + DV  A   + F F+     +P+ N MK  E      GV+  +M+  + +Y   G  GFL FG N    + ++       +   +   +  ++ SY +  +    +   L  + +  +  + +  + + ++I  L+   F+ ++A+ IP +  +++L+G +++ ++  + P +  + ++ SE+D R
Sbjct:   33 VDSIQAPSQSQQSRGGTSTLAAVFIVVNAALGAGLLNFPAAFNMAGGVTAGVVLQMCMLVFIITGLVILAYCSQ--VSNEGT------YQEVVRAV----------CGKVLGVICEIAIAVYTFGTCIAFLIIIGDQLDKLIGAMTHDSDPVSAHWFTDRRFTITITSVLVIL-------PLSIPKEIGFQKYASTISVIGTWYVTIVVIIKYFLPDKNITPGDIPTSPTSWTDVFNAMPTICFGFQCHVSSVPVFNSMKKAE-IRPWGGVVTVSMIICLFVYTGTGVSGFLSFGSNVSQDVLMSYPSDDVAVAIARAFIIICVVTSYPILHFCGRAVIEGLWLRFKGEEVDTDVAGERRRRLIQTLVWFCFTLLLALFIPDIGRVISLIGGLAACFI-FVFPGLCLIQAKLSEHDVR 423          
BLAST of slc36a-2 vs. Ensembl Cavefish
Match: slc32a1 (solute carrier family 32 member 1 [Source:NCBI gene;Acc:103031061])

HSP 1 Score: 62.3882 bits (150), Expect = 6.248e-10
Identity = 84/387 (21.71%), Postives = 165/387 (42.64%), Query Frame = 1
Query:  214 SDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI--KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXN--DVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLF-VFSILVSYLLQIYIPVFICSKLIKK-------LECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIIN 1338
            +D   I++  A  N+     G  +L +P  I + G  LG+ LII    +  Y   IL+ C     +   + R    Y +              R+  L   + NV  II  +  C  Y++ +S N+   SF     S++    I+   V   LL   ++KNLK +++ ++   ++  +  I+++ Y +   +D+         +     ++ GI++F++ +   +  ++  M+ P  +     ++N   +    L        +L + + T+  IT NL   P  +  +  LF V   L+SY L  +  V +  K   +        +C+     L +   L +   L+V F+  MAI +PH  L++ L G+++ + L  +LP + +
Sbjct:  116 ADKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLIIFAAVVCCYTGKILIACLYEENEDGQLVRVRDSYVDIANACCA------PRFPALGGHVVNVAQIIELVMTCILYVV-VSGNLMYNSFPTLPVSQR-SWAIIATVV---LLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWDKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQKPSEFTC---MMNWTHIAACILKGLFALVAYLTWADATKEVITDNL---PPGIRAVVNLFLVAKALLSYPLPFFAAVEVLEKTFFQDGSRAFFPDCYGGDGRL-KSWGLSLRCGLVV-FTMFMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFH 482          
BLAST of slc36a-2 vs. Ensembl Sea Lamprey
Match: slc36a1 (solute carrier family 36 member 1 [Source:ZFIN;Acc:ZDB-GENE-061117-1])

HSP 1 Score: 175.637 bits (444), Expect = 1.441e-49
Identity = 122/402 (30.35%), Postives = 211/402 (52.49%), Query Frame = 1
Query:  244 ALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGP-SRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDH----------------FSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKI---IPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKL 1389
             L++ +KGN+GTG+L +P  +K+AG+ +G + ++ +  ++      L+RC+  L  K  + R TL Y  TV    E    + L       K + ++F+I TQ+GFCC Y +F++DNIK  VE                  F+   RL ++   ++  ++ + ++KNL+ +A  +  AN+  +  II+I  Y    I            N + + FG+ IFAFE I +VLP++N+M+ P  +    G+    M+ V  LY ++G  G++ FG     S+TLNL  +      ++ LF   I VSY +Q Y+   I +            + + ++ QL +      ++V  +  +A+ IP LDL++AL+G+ISSS LALI+PP++ +V+ + E+  R W++ L
Sbjct:    2 TLLHFLKGNVGTGLLGLPLAVKHAGLVVGPVCLVVMAIVAVDCMLTLVRCSHYLCRK--LKRPTLCYGGTVMHAMEVSNFTWLNSKGSWGKNVISLFLITTQLGFCCVYFVFMADNIKQVVEQRTNGTSESAGEEGAPGGFAMDKRLYML--CLLPFIILLSFVKNLRWLAPFSALANVCMLTSIIIIYYYMSTNIPKKLDVKYVGEANALPLFFGMAIFAFEGIGVVLPLENRMRDPGSFKLLLGM---GMLVVTLLYLSLGTLGYVCFGSKVMPSVTLNLPISNGLYESVKILFSLGIFVSYGVQFYVAAEIIAPFF--------VAKVPRRWQLSVDLLCRAVLVCITCALAMLIPKLDLVIALVGSISSSALALIIPPLLEIVTFWPES-MRPWQYWL 387          
BLAST of slc36a-2 vs. Ensembl Sea Lamprey
Match: slc32a1 (solute carrier family 32 member 1 [Source:ZFIN;Acc:ZDB-GENE-061201-1])

HSP 1 Score: 57.7658 bits (138), Expect = 3.766e-9
Identity = 83/385 (21.56%), Postives = 168/385 (43.64%), Query Frame = 1
Query:  226 NISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI--KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXN--DVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLF-VFSILVSYLLQIYIPV-------FICSKLIKKLECHQNKSSLVQ-KIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINV 1341
             I+S  A  N+     G  +L +P  I + G  LG+ L+     +  Y   IL+ C     +   + R    Y +              R+ +L  ++ N   +I  +  C  Y++ +S N+   SF     S++    ++  AV   LL   +++NLK ++R ++  +++  +   +++ Y +   + +         +     V+ GI++F++ +   +  ++  MK  E +     ++N   V    L +      FL + + TQ  IT NL   P+    +  +F V   L+SY L  +  V       F  ++ +    C+  +  L    + L+    L+VI + +MAI IPH  L++ L G+++ + L+ +LP + ++
Sbjct:  127 QITSWDAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLMTFAAVVCCYTGKILIACLYEEDEDGQLVRVRSSYVDIANACCA------PRFPRLGGVVVNAAQLIELLMTCVLYVV-VSGNLMYNSFPNVPISQR-SWSVLSTAV---LLPCAFLRNLKAVSRFSLLCSLTHFVINFLVIGYCLTRARYWAWDKVKFYIDVKTFPVSIGIIVFSYTSQIFLPSLEGNMKKREEFHC---MMNWTHVVACVLKSMFALLAFLTWADTTQEVITDNL---PATFRAVVNIFLVAKALLSYPLPFFAAVEVFEKSFFADTRDVLFPSCYAVEGRLKSWSLGLRC---LLVISTLLMAIYIPHFALLMGLTGSLTGASLSFLLPCLFHL 490          
BLAST of slc36a-2 vs. Ensembl Yeast
Match: AVT4 (Vacuolar transporter; exports large neutral amino acids from the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs) [Source:SGD;Acc:S000005045])

HSP 1 Score: 99.3673 bits (246), Expect = 2.187e-22
Identity = 105/453 (23.18%), Postives = 203/453 (44.81%), Query Frame = 1
Query:  121 DDKQISELKSITSNGEMNEETLIDVEEDPHL----SDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKV-RLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYS-------IMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQI----------YIPVFI-----CSKLIKKLECHQNKSSLVQKIQ-LKIIPPLIVIFSYVMA--ISIPHLDLMLALLGAISSSYLALILPPIINVV-SRYSENDNRDWRFK 1386
            +D  I +  ++   GE     L+   +  H+    S     S+    + L+K  IGTG+L +P      G+   + ++   G  S +  +IL++   +                   GV  FG   L+ Y   M+I+    ++ITQ+GF  AYM+F + N+++F+++ F   V  L  +      + + + +I+N+  ++  ++ AN   + G++++++++       +MG                L   G  IFAFE I L++P+Q+ M+ PE++     V+   ++T   L+ ++   G+L +G N Q  I LNL  +  ++  IQ  +  +I++S  LQ+          + P F         L  ++E   N   L  KI+ LK     I++   V        +LD  ++++G+++   L  I P ++++  +   E     WRFK
Sbjct:  259 EDDFIPDSSNMMIRGEDERSALLSRPD--HMKVLPSAKGTTSTKKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYILVQAKSSC------------------GVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFHVGVLPLSYLMVFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLMGTPAMGVVYGLNADRWTLF-IGTAIFAFEGIGLIIPVQDSMRNPEKFPL---VLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFK 687          
BLAST of slc36a-2 vs. Ensembl Yeast
Match: AVT3 (Vacuolar transporter; exports large neutral amino acids from the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters [Source:SGD;Acc:S000001629])

HSP 1 Score: 87.8113 bits (216), Expect = 8.813e-19
Identity = 96/393 (24.43%), Postives = 180/393 (45.80%), Query Frame = 1
Query:  184 LIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKK---VRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVY-----SIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIIN 1338
            L+  E   H   SS +    A++ L+K  +GTG+L +P      G     L ++   AL +Y   + L    T  DK GVD     Y +   G   +GP      K    IL+++   ++QIGF  AY +F + N++ F E+ F  K   + L     A + + + +   +N+  ++  A+ A++  +LG++ + VY     ++ G+   T         D  +  G  IF FE I L++PIQ  MK+P+ +      ++  M  V  ++ + G   +  FG + +  + LN     S+ + +Q L+  +IL+S  LQ++  + I              +  V+ ++      ++V+ S +  +    LD  ++L+G+ +   L  I PP+++
Sbjct:  285 LVSREHGRHPHKSSTVK---AVLLLLKSFVGTGVLFLPKAFHNGGWGFSALCLLSC-ALISYGCFVSL---ITTKDKVGVD----GYGDM--GRILYGP------KMKFAILSSI--ALSQIGFSAAYTVFTATNLQVFSENFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSIYYIAVNGVASDTMLMFNKA--DWSLFIGTAIFTFEGIGLLIPIQESMKHPKHFRPS---LSAVMCIVAVIFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQLLYALAILLSTPLQLFPAIRILENWTFPSNASGKYNPKVKWLKNYFRCAIVVLTSILAWVGANDLDKFVSLVGSFACIPLIYIYPPLLH 651          
BLAST of slc36a-2 vs. Ensembl Yeast
Match: AVT7 (Putative transporter; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters [Source:SGD;Acc:S000001350])

HSP 1 Score: 64.3142 bits (155), Expect = 2.081e-11
Identity = 75/295 (25.42%), Postives = 126/295 (42.71%), Query Frame = 1
Query:  214 SDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMC-WIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDV-----------LVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI 1062
            + SS +SS A   NL+K  +G G LA+P   K  G+ +G++L +     S     +L +C++TL++       TL                +  Y  L  I  ++ MI+   G   +Y++ I D         F  +    I+ +AV+ + LC+   +  LK  + + +FA     L  I I+V+S    +      T    ND+           L  F I+IFAF     + P+ N++K          VIN ++     L+  +G  G+L FG  T G++ LN      W++
Sbjct:    3 ATSSALSSTA---NLVKTIVGAGTLAIPYSFKSDGVLVGVILTLLAAVTSGLGLFVLSKCSKTLINPRNSSFFTL---------------CMLTYPTLAPIF-DLAMIVQCFGVGLSYLVLIGD----LFPGLFGGERNYWIIASAVIIIPLCLVKKLDQLKYSSILGLFA-----LAYISILVFSHFVFELGKGELTNILRNDICWWKIHDFKGLLSTFSIIIFAFTGSMNLFPMINELK-DNSMENITFVINNSISLSTALFLIVGLSGYLTFGNETLGNLMLNYDPNSIWIV 268          
BLAST of slc36a-2 vs. Ensembl Yeast
Match: AVT2 (Putative transporter; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters [Source:SGD;Acc:S000000790])

HSP 1 Score: 57.3806 bits (137), Expect = 2.628e-9
Identity = 90/422 (21.33%), Postives = 177/422 (41.94%), Query Frame = 1
Query:  175 EETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKK-------VRLEIVGAAVMGLL-LCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKY-----PERYVTR-AGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPL-FVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQ--KIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKL 1389
            ++TL++   D    +    S   A MNL    +G GI+  P  IK AGI  G+L  + +G +  +   ++            V   TL    T  G  E     + +  KL+ + TN        G C  Y + I D I   +   FS+        +R  ++   V   +   +   +N++ +++ +  A IS I+ ++ +++   M   D          +D  +    +  +   I+  L   +   +       R V +   + + +++  V   A MG+ GF  F E T+G++ LN        I I  L F F++L ++ ++I++   +   L+ +    +N     Q    Q  +I   +V  +  ++++  +L  +  L+GA ++S +A ILPP  N++     +  + W+ +L
Sbjct:   52 DDTLVN---DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLI------------VINLTLAGKRTYQGTVE---HVMGKKGKLLILFTNGLF---AFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYD--WKGHSLKLSDFFMK-ATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNV-LNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLL---LTSKKKSWKERL 445          
BLAST of slc36a-2 vs. Ensembl Nematostella
Match: EDO47140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNG9])

HSP 1 Score: 170.244 bits (430), Expect = 5.614e-47
Identity = 116/386 (30.05%), Postives = 213/386 (55.18%), Query Frame = 1
Query:  193 VEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYK-KLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVS 1347
            VE D  L   +  SS+A+LM++IKGN+G GI ++P  +  AG   G LL++ V  ++ +   +L++C+    D+ G+    L Y     GV E    +   +K  + +IL N+F++IT  GFC  Y LF++++++   + + S K+ +++    ++  ++ + +I+ LKI+A ++  +N+ A+ G + ++ Y+   + D       T +  + +AFG V+F +E I ++LP++N M  P R+     V+   M  V  LY  MG  G+L  G + QGSITLNL + P ++  ++ +   SI ++Y +Q Y+   I    +K     Q  + LV  I  ++   L+V F+  +AI IP L  M++L+G++ S+ LA   P  +++ +
Sbjct:   50 VELDRSLYMDNTTSSSASLMHVIKGNLGIGIFSLPLAMMNAGTVAGPLLMVAVSVVAVHCMQMLVQCSHAYCDRGGMLH--LGY----AGVAEKCIGQYYPHKAHIGRILINIFLLITMFGFCAIYFLFVAESLQQAFDAYTSFKLDVKLWVLIILVPVILLSFIRTLKILAVLSSVSNVLALFGTVCVLSYAGSTVHD-PSTLPLTQWKTLPLAFGAVVFTYEGIGVILPVENMMAIPRRF---RWVLYAGMSLVTLLYLLMGVLGYLSCGTSCQGSITLNLPNTPFYM-SVKLIIAASIFLTYFIQFYVITSILFPFVKG-RVRQTIAPLVD-IAFRM---LLVCFTACLAIGIPQLGNMISLVGSLGSTSLAFTFPAALHIAT 419          
BLAST of slc36a-2 vs. Ensembl Nematostella
Match: EDO47141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH0])

HSP 1 Score: 164.851 bits (416), Expect = 1.391e-45
Identity = 113/386 (29.27%), Postives = 205/386 (53.11%), Query Frame = 1
Query:  244 ALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFE-FGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFV--EDHFSKKVRLEIVGAA-------------VMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFIC--SKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVS 1347
            +LM+LIKG +G G+  MP  + YAG+ +G  +++ VG +S +  H+L RCA    +K G     +DY +      E + P++      + +++ N F++ TQ+GFCCAY++FI+D+IK  +    H + +  L +  A              V   L+   +I+ LK +  V+  +N+  I GI+  + Y+   + D    P F  ++ + + F + ++A+E I +VLP++N M+ P  +     V+N AM  VV LY  +G  G++      +GS TLNL D P +   ++ L   S+ ++Y LQ Y+PV I   S L +  + +Q  + L  +  L       V+ + V+A  +P L+ ++A++G+++S+ L +  P  +++ S
Sbjct:    3 SLMHLIKGCVGIGVYGMPLAVAYAGLLMGPAILLLVGIVSVHCMHLLKRCAHLHSEKTG--SICMDYAQLAAKCTEVYFPNK----GNVSRVVVNAFLVFTQLGFCCAYVVFITDSIKQAIPPTSHPTPQYFLNVSAADGSVDLDVRIWMVIVFPFLVLFSFIRTLKFLVIVSGISNVITIFGIVGALNYASTTLHDTKSLPLFANWSTLPLTFALSVYAYEGIGVVLPVENMMRTPRDF---TWVLNLAMSVVVILYLVVGTMGYISCAAMCKGSFTLNLPDTPFY-TTLKLLIAGSMFLTYFLQFYVPVEILLPSVLKRVSKKYQTVADLGFRTSL-------VLVTVVLAACVPRLEDVIAVIGSLASTTLCMTFPAAMDIAS 371          
BLAST of slc36a-2 vs. Ensembl Nematostella
Match: EDO49613 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFK0])

HSP 1 Score: 155.606 bits (392), Expect = 4.851e-42
Identity = 107/382 (28.01%), Postives = 208/382 (54.45%), Query Frame = 1
Query:  244 ALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSF--------VEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEND 1365
             L +++K NIG G+L++PA +  AGI +G + +  +  +  +  H+L++C+  L +++   R  L +  +    F+     L     L +++ NVF+ ITQ+GFCC Y +F++DN+K          +++  +   ++ IV   V  +LL   +I +L++++ ++  ANI  ++G+++   Y    + +    P F  +  + + FG+V+F FE I +VLP++N+M  P+ +     V+N  M  ++ ++  MG  G+L   +  +GSITLNL + P +   ++ LF   + +SY +Q Y+P+ I    I+  +C   +   +     +    L+V  +  +A+ IP L   ++L+G+I SS LAL+ P  I++++ YS + 
Sbjct:    3 TLTHILKANIGPGMLSLPAAMMNAGIVVGPVSLFFIALICIHCMHLLVQCSHYLCERFSNQR--LYWKVSCCKSFD-AQGCLVIDSLLYEVVVNVFLCITQLGFCCVYFIFVADNVKQVRTRATYMALDEVVNLDPKIWIVILLVPVILL--SYIHSLRVLSVLSTMANICCLIGLVITFQYLGRNVHNPKLLPEFDGWAALPLFFGMVVFTFEGIGVVLPLENQMARPQHFRL---VLNVGMGIILAIFYLMGVLGYLACEQKCEGSITLNLPNTPLYHT-VRILFSVMVFISYFVQFYVPMEIMQPPIR--QCVGERFHGIADYGFRT---LLVCVTCALALGIPQLSNFISLVGSIGSSALALVFPITIHLLTLYSTHQ 370          
BLAST of slc36a-2 vs. Ensembl Nematostella
Match: EDO35031 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMQ8])

HSP 1 Score: 91.6633 bits (226), Expect = 6.587e-20
Identity = 96/395 (24.30%), Postives = 176/395 (44.56%), Query Frame = 1
Query:  199 EDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI-KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXX-XXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKII-------PPLI-----VIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINV 1341
            E+ H  + +   S  A  N+   N+GTGILAMP VI+  G   G+ ++I V  L  Y   IL+ C      +   ++ T           + G +   +Y +LM  +TN F    Q   C  +++     +  +F +   S+ + + IV  AV+       +++ +K I+ ++I   I ++     ++ YS+    D+     T   F  + +A GIV   F +   +  I+  MKYP  +     ++N     V  +    G   +  FG++T+  +TL+L      L P +    F ++++ LL   +P+F    + +     Q    L++K+  + +       P L+     V+ S V+AI +PH  L++A +G  + S L  I P + +V
Sbjct:   17 EEIH-KEENETHSFQAFFNIFNANMGTGILAMPYVIRLTGY-WGVAIVILVALLGNYTGKILIHCLHENTPEGHFNKFTYA---------DLGEAFWPKYGRLMVHITNFF---EQFSHCTLFLIMCGTVMHHTFPDSGISESLWICIVSFAVVPC----AFVRTMKHISHISILTVIVSMGSSTCVLGYSLYHHDDWKTHNLTSFNFRHMSIAMGIVTVTFSSTAYLPAIERSMKYPAEF---NAMMNFTYTLVTIIKYNYGILVYFAFGKHTEQLMTLSLP-----LGPFRTALDFLVIITALLFYVVPMFTLYDIFEN----QLDIPLLRKVGDQPLKCYNGCTPKLVFRFVFVVLSMVVAIFVPHFGLLMAFVGGFTGSILVYIFPCMFHV 381          
BLAST of slc36a-2 vs. Ensembl Nematostella
Match: EDO41700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C3])

HSP 1 Score: 71.633 bits (174), Expect = 1.410e-13
Identity = 65/279 (23.30%), Postives = 120/279 (43.01%), Query Frame = 1
Query:  511 KILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP--IQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINV 1341
            K + +  ++I+Q GF CAY++FIS+NI +  E                                +   +FA+ + +    ++  +      +         F+ +    GI I+ +E   ++L ++       R   R+ +    +  V  LY   G  G+L FG +T   ITLNL   P  + P  ++    FS+  +Y + ++  V I   L KKL   + KS       L+    L+VI + ++ + IP   +++AL+G+   + LA ILP + ++
Sbjct:   95 KAVVDASIVISQTGFSCAYLIFISENIATMTE--------------------------------SFTNLFADFANVFAYCVVFWFDFKHFDNIGSKRKVINFSGLPFFLGIAIYCYEGAGMILALEASCAKSARSKFRS-IFKLTLFLVTMLYILFGVCGYLSFGPDTDNIITLNL---PPGIFPLLVKSCLCFSLFFTYPVMMFPVVAI---LEKKLFSDEGKSHYYYGTFLR---GLMVIITGIVVLGIPDFSMLMALVGSSCCTLLAFILPALFHL 331          
BLAST of slc36a-2 vs. Ensembl Medaka
Match: slc36a1 (proton-coupled amino acid transporter 1 [Source:NCBI gene;Acc:101174111])

HSP 1 Score: 212.231 bits (539), Expect = 3.736e-62
Identity = 141/435 (32.41%), Postives = 237/435 (54.48%), Query Frame = 1
Query:  118 NDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVED----------HFSKKVRLEIVGAAVMGLLLC-------MCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLI-PIQPLFVFSILVSYLLQIYIPV-FICSKLIKKLECH-QNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSEN 1362
             DD+  SEL ++  +         + E    +   +  S    L++L+KGNIGTG+L +P  +K AG+ LG + ++ +G ++ +   +L++C+  L  K  ++R ++ Y E +    E  P  L+R+    +   N F+IITQ+GFCC Y +F+SDN+K  VE           ++S +  + I        +LC       +  I NLK +A  ++ AN++    ++ I  YS+  I      P      D  + FG  IFAFE I +VLP++NKM+ PE++   + V+   M  V  LY ++G  G++ FG++  GSITLNL +   W+   ++ L+ F I +++ LQ Y+P   I   ++ +L    +   SL  +I       L+VIF+ V+AI IP LDL+++L+G++SSS+LALI PPI+ +++ +SE 
Sbjct:   11 TDDQNPSELDALCPSPPGPTRPQRNYER---IGGRTGTSFFQTLIHLLKGNIGTGLLGLPLAVKNAGLVLGPVSLLIMGVIAVHCMRLLVQCSHYLSAK--MNRPSMTYGEVMQYGMENVP-WLRRHSHWGRRTVNTFLIITQLGFCCVYFVFLSDNVKQVVEAANATTGNCHANYSNQTAVLIPSFDSRLYMLCFLPFIILLVLIPNLKFLAPFSLLANVAMTASLVFIYYYSLTNITYPINLPKVGHAKDYPLFFGTAIFAFEGIGVVLPLENKMQRPEKF---SQVLYLGMGIVTFLYISLGTIGYICFGQHIGGSITLNLPNC--WMYQAVKLLYCFGIFITFALQFYVPAEIIIPSVVARLSGRWETAVSLALRI-------LLVIFTCVLAILIPELDLVISLVGSVSSSFLALIFPPILELIAFHSEG 427          
BLAST of slc36a-2 vs. Ensembl Medaka
Match: ENSORLT00000004711.2 (vesicular inhibitory amino acid transporter [Source:NCBI gene;Acc:101164150])

HSP 1 Score: 64.6994 bits (156), Expect = 1.175e-10
Identity = 88/412 (21.36%), Postives = 175/412 (42.48%), Query Frame = 1
Query:  145 KSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI--KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXN--DVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLF-VFSILVSYLLQIYIPVFICSKLIKK-------LECHQNKSSL-VQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINV 1341
             ++ S G ++EE                I+S  A  N+     G  +L +P  I + G  LG+ LII    +  Y   IL+ C     +     R    Y +              R+  L   + NV  II  I  C  Y++ +S N+   SF     S+K    +  AA    LL   ++KNLK +++ +    ++  +  I+++ Y +   +++         +     ++ GI++F++ +   +  ++  M+ P  +     +++   +T   L        +L + + T+  IT NL   PS +  +  LF V   L+SY L  +  V +  K + +        +C+     L    + L++    +V+F+ +MA+ +PH  L++ L G+++ + L  +LP + ++
Sbjct:   98 SALKSGGSLDEE-------------KPKITSWEAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLIIFAAVVCCYTGKILIACLYEDNEDGLKVRVRDSYVDIANACCA------PRFPALGGHVVNVAQIIELIMTCILYVV-VSGNLMYNSFPSFPVSQKAWSVVATAA----LLPCAFLKNLKAVSKFSFLCTVAHFIINILVIAYCLSRAREWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQKPSEFHC---MMDWTHITACVLKGLFALVAYLTWADATKEVITDNL---PSTIRAVVNLFLVAKALLSYPLPFFAAVEVLEKSLFQDGGRAIFPDCYGPTGQLKTWGLGLRVA---LVVFTLLMAVFVPHFALLMGLTGSLTGAGLCFLLPSLFHL 475          
BLAST of slc36a-2 vs. Ensembl Medaka
Match: slc32a1 (vesicular inhibitory amino acid transporter [Source:NCBI gene;Acc:101165386])

HSP 1 Score: 63.1586 bits (152), Expect = 3.560e-10
Identity = 83/384 (21.61%), Postives = 166/384 (43.23%), Query Frame = 1
Query:  226 NISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNI--KSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXN--DVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKI-----QLK----IIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIIN 1338
             I++  A  N+     G  +L +P  I + G  LG+ LII    +  Y   IL+ C     +   + R    Y +              R+  L   + NV  II  +  C  Y++ +S N+   SF     S+K    I   A + LL C  ++KNLK +++ ++   ++  +  ++++ Y +   +D+         +     ++ GI++F++ +   +  ++  M+ P  +       + A   +  L+A + +   L + + T+  IT NL   P  +  +  LF   ++   LL   +P F   ++ +K   H    +          +LK     +   +V+F+ +MAI +PH  L++ L G+++ + L  +LP I +
Sbjct:  116 KITAWEAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLIIFAAVVCCYTGKILIACLYEEDEDGQLVRVRDSYVDIANACCA------PRFPTLGGHIVNVAQIIELVMTCILYVV-VSGNLMYNSFPNMPISQKSWAII---ATVALLPCA-FLKNLKAVSKFSLLCTLAHFVINVLVVAYCLSRARDWAWDKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQKPSEFHCMMKWTHIAACILKGLFALVAY---LTWADETKEVITDNL---PPGIRAVVNLF---LVAKALLSYPLPFFAAVEVFEKTFFHDGGRAFFPDCYGGDGRLKSWGLTLRCSLVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSIFH 478          
BLAST of slc36a-2 vs. Ensembl Medaka
Match: slc38a10 (solute carrier family 38 member 10 [Source:NCBI gene;Acc:101170796])

HSP 1 Score: 52.7582 bits (125), Expect = 9.907e-7
Identity = 95/389 (24.42%), Postives = 169/389 (43.44%), Query Frame = 1
Query:  247 LMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAIL---GIIMIMVYSIM-----------GIQDX--XXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCL-YAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP--IQPLFVFSILVSYLLQIYIPVFICSKLIKKL--ECHQNKSSLV-----QKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPII 1335
            +MN++   +G  +L MP   K  GI LG LL+     L +++TH    C       + V  A+     T  G+          Y K  K L  + MI   +G C A+ + I+D   +F    F++ + L++ G+  + LL+ +    +L I+  +++  N+ A L     + +M Y++            G+             +  V     I   AF   + VLP  + ++ P   V R   I T+ + VV + Y  +GF+G++ F +N  G++ +N    PS L+   I+  F+ S+ V + + I      C + I  +  E  Q   +         ++ K+I   IV  + +  I IP+++ +L L GA   S +  I P +I
Sbjct:    9 IMNVVNSIVGVSVLTMPFCFKQCGIFLGALLLF----LCSWMTH--KSCM------FLVHTASHTKRRTYAGLA------FHAYGKPGKTLVEMSMIGLMLGTCIAFYVVIADLGSNF----FAQLLGLQVTGSFRVLLLIAV----SLFIVLPLSLQRNMMASLQSFSAMALMFYTLFMFTMVLSSFKHGLLGGWWLGQVNVVRWEGVFRCLPICGMAFACQSQVLPTYDSLEEP--SVKRMSTIFTSALNVVTVFYITVGFFGYVSFTDNIAGNVLMNF---PSNLVTEMIRVGFMMSVAVGFPMMI----LPCRQAINTMLFEQQQKDGTFAAGGYMPPLRFKMITLCIVFGTMLGGILIPNVETILGLTGATMGSLICFICPALI 362          
BLAST of slc36a-2 vs. Ensembl Medaka
Match: slc38a10 (solute carrier family 38 member 10 [Source:NCBI gene;Acc:101170796])

HSP 1 Score: 51.2174 bits (121), Expect = 2.378e-6
Identity = 93/386 (24.09%), Postives = 168/386 (43.52%), Query Frame = 1
Query:  247 LMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIM-----------GI--QDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCL-YAAMGFYGFLKFGENTQGSITLNLKDAPSWLIP--IQPLFVFSILVSYLLQIYIPVFICSKLIKKL--ECHQNKSSLV-----QKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPII 1335
            +MN++   +G  +L MP   K  GI LG LL+     L +++TH    C       + V  A+     T  G+          Y K  K L  + MI   +G C A+ + I+D   +F    F++ + L++ G+  + LL+ +     L +  +  + A++ +    + +M Y++            GI    + +      F  V+    I+   F     VLP  + ++ P   V R   I T+ + VV + Y  +GF+G++ F +N  G++ +N    PS L+   I+  F+ S+ V + + I      C + I  +  E  Q   +         ++ K+I   IV  + +  I IP+++ +L L GA   S +  I P +I
Sbjct:    9 IMNVVNSIVGVSVLTMPFCFKQCGIFLGALLLF----LCSWMTH--KSCM------FLVHTASHTKRRTYAGLA------FHAYGKPGKTLVEMSMIGLMLGTCIAFYVVIADLGSNF----FAQLLGLQVTGSFRVLLLIAVSLFIVLPLSLQRNMMASLQS-FSAMALMFYTLFMFTIVLSSLRYGIISGSWVERVHLWRFKGVIQCLPIIATTFCCHPQVLPTYDSLEEP--SVKRMSTIFTSALNVVTVFYITVGFFGYVSFTDNIAGNVLMNF---PSNLVTEMIRVGFMMSVAVGFPMMI----LPCRQAINTMLFEQQQKDGTFAAGGYMPPLRFKMITLCIVFGTMLGGILIPNVETILGLTGATMGSLICFICPALI 362          
BLAST of slc36a-2 vs. Planmine SMEST
Match: SMESG000060771.1 (SMESG000060771.1)

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 459/459 (100.00%), Postives = 459/459 (100.00%), Query Frame = 1
Query:  103 MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVXXXXXXXXXXXXXTASSIYALIKQ 1479
            MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDFTQFPTFTPFNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVLIFLFGLIGFIGGTASSIYALIKQ
Sbjct:    1 MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDFTQFPTFTPFNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVLIFLFGLIGFIGGTASSIYALIKQ 459          
BLAST of slc36a-2 vs. Planmine SMEST
Match: SMESG000022898.1 (SMESG000022898.1)

HSP 1 Score: 174.096 bits (440), Expect = 4.252e-48
Identity = 119/413 (28.81%), Postives = 225/413 (54.48%), Query Frame = 1
Query:  190 DVEEDPHLSDSS------NISSNAALMNLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKV-------RLEIVGAAVMGLLLCMCWIKNLKIIARVAIFANISAILGIIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIKKLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISSSYLALILPPIINVVSRYSENDNRDWRFKL 1389
            D EED   +  S       I++  A+++++K +IGTG+LA+P+ ++Y+G  LG   I+ +  ++ Y  H+LL   + +  K       LDY  TV   FE    +LQ+Y  +  +L    + + QIGF  +Y +F+S+N K ++ D++S +        + +++   V+  LL   + K L  ++     AN+   + +I+ +VY  +              +  L+ FGIVIF+FE+IN++ P++N ++  ++   + G++N A + V+ +Y  +G  G+L+FG+N   S+ L++     + +  +P ++ SIL+SY LQ ++   + + + KK+E     S+ V++I   +I   I   + ++++SIPH DL ++L+GA S S ++LI P + + V  YS    + WR +L
Sbjct:   51 DEEEDEGFNSESYAHNYVEINNLQAVIHVVKCSIGTGVLALPSALRYSGYLLGSFSILILSMINVYSMHLLLEIVENIRLKNPKKILNLDYETTVKLCFENAEEKLQKYVWVHHVLL-ASLSVAQIGFLSSYQIFVSENTK-YIIDYYSNEQAYNMPIWQYQLIYFLVLTPLL---FFKTLDKLSYFCQLANVLMGISLIISLVYCYLDPLPIQSLKAVVISDSTLLFFGIVIFSFESINIINPVENNLRDKKKMREKCGILNIAFIFVLPVYLVVGVSGYLRFGDNIASSLILSIPIDKWYFMLCKPFYILSILISYGLQGFV---MHNIIWKKIEFRLG-SNKVKRIIDILIRIGIGASTTILSVSIPHFDLFISLIGAFSGSSISLIFPAVCSSVMLYSNKTGKFWRARL 454          
BLAST of slc36a-2 vs. Planmine SMEST
Match: SMESG000022950.1 (SMESG000022950.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.376e-11
Identity = 71/338 (21.01%), Postives = 148/338 (43.79%), Query Frame = 1
Query:  253 NLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQTLV--------DKY---------------GVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIGFCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAV--------------------MGLLLCMCWIKNLKIIARVAIFANISAILG---IIMIMVYSIMGIQDXXXXXXXXXXNDVLVAFGIVIFAFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKFGENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPV 1128
            N+ K  IG   L +P     +GI LG+++++ +G L+ Y    +++C   +V        +KY               G  +  L+   T+G + ++       + K  + +  + ++I+Q GFC  Y +F+ + +   + +  S      +  +++                    + + +    ++ ++ +  ++I AN +   G   I+ +++      +DF  F        V V FGI+   FE I  V+PI+  M       +R   ++  +  VVC++ + G  G L++G NT+  I  NL    +++  I  + +FS++ +Y LQ++ PV
Sbjct:   15 NIFKAFIGCTYLTIPFAFYQSGIGLGIIMLLIIGWLNDYCCVQIVKCKDIIVARLIEQFDNKYKSGNLLEPEAELVRCGHLKDKLEDRITLGHIAKYA------FGKKGQWIVTICLLISQFGFCTGYFVFVGNTLMELIYNLNSNHSDTSLNSSSITYPIFNIKKDHFLIFMLLVPLPIFILFSLLRTVRNMGWISIIANSAIAFGYFSIVGLLINHFSKSEDFELFNF----QSVAVIFGILTAGFEGIGTVIPIETSMIGNRHNFSR--YLHVTLFLVVCVFGSFGILGHLRYGTNTKQIILQNLP-YSTFVNIINLILIFSVVCTYPLQMF-PV 338          
The following BLAST results are available for this feature:
BLAST of slc36a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC36A41.515e-5831.16solute carrier family 36 member 4 [Source:HGNC Sym... [more]
SLC36A13.500e-5831.98solute carrier family 36 member 1 [Source:HGNC Sym... [more]
SLC36A13.500e-5831.98solute carrier family 36 member 1 [Source:HGNC Sym... [more]
SLC36A24.444e-5831.58solute carrier family 36 member 2 [Source:HGNC Sym... [more]
SLC36A32.040e-5131.44solute carrier family 36 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-36.24.061e-6431.82SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-36.24.061e-6431.82SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
Y43F4B.71.840e-5530.43pep chromosome:WBcel235:III:13307502:13313389:1 ge... [more]
slc-36.21.903e-5332.70SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
skat-11.496e-3625.53Probable amino acid transporter skat-1 [Source:Un... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG133841.748e-7935.55gene:FBgn0032036 transcript:FBtr0079653[more]
CG133841.748e-7935.55gene:FBgn0032036 transcript:FBtr0303470[more]
CG133841.748e-7935.55gene:FBgn0032036 transcript:FBtr0303471[more]
CG133842.543e-7935.97gene:FBgn0032036 transcript:FBtr0079655[more]
CG133843.871e-7934.98gene:FBgn0032036 transcript:FBtr0303469[more]
back to top
BLAST of slc36a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc36a48.485e-5630.10solute carrier family 36 member 4 [Source:ZFIN;Acc... [more]
slc36a48.485e-5630.10solute carrier family 36 member 4 [Source:ZFIN;Acc... [more]
slc36a12.259e-5331.25solute carrier family 36 member 1 [Source:ZFIN;Acc... [more]
slc36a41.165e-4429.94solute carrier family 36 member 4 [Source:ZFIN;Acc... [more]
slc32a11.875e-1121.96solute carrier family 32 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jph11.641e-6034.16junctophilin 1 [Source:Xenbase;Acc:XB-GENE-954753][more]
jph11.846e-6034.16junctophilin 1 [Source:Xenbase;Acc:XB-GENE-954753][more]
SLC36A46.089e-6031.57solute carrier family 36 (proton/amino acid sympor... [more]
SLC36A47.123e-6031.57solute carrier family 36 (proton/amino acid sympor... [more]
slc32a14.617e-1121.88solute carrier family 32 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc36a48.341e-5931.26solute carrier family 36 (proton/amino acid sympor... [more]
Slc36a21.005e-5635.18solute carrier family 36 (proton/amino acid sympor... [more]
Slc36a11.674e-5232.43solute carrier family 36 (proton/amino acid sympor... [more]
Slc36a11.674e-5232.43solute carrier family 36 (proton/amino acid sympor... [more]
Slc36a11.674e-5232.43solute carrier family 36 (proton/amino acid sympor... [more]
back to top
BLAST of slc36a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4KL91|S36A4_XENLA1.831e-6431.40Proton-coupled amino acid transporter 4 OS=Xenopus... [more]
sp|Q8CH36|S36A4_MOUSE3.623e-5831.26Proton-coupled amino acid transporter 4 OS=Mus mus... [more]
sp|Q6YBV0|S36A4_HUMAN7.276e-5831.16Proton-coupled amino acid transporter 4 OS=Homo sa... [more]
sp|Q7Z2H8|S36A1_HUMAN1.681e-5731.98Proton-coupled amino acid transporter 1 OS=Homo sa... [more]
sp|Q495M3|S36A2_HUMAN2.134e-5731.58Proton-coupled amino acid transporter 2 OS=Homo sa... [more]
back to top
BLAST of slc36a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFA50.000e+0100.00Slc36a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4Z2CLT62.801e-11244.05Proton-coupled amino acid transporter 4 OS=Schisto... [more]
A0A3R7CZ541.975e-11140.74Proton-coupled amino acid transporter 4 OS=Clonorc... [more]
A0A4S2MM523.813e-11140.84Aa_trans domain-containing protein OS=Opisthorchis... [more]
A0A075AAQ31.726e-11040.05Aa_trans domain-containing protein OS=Opisthorchis... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc36a41.635e-5329.95solute carrier family 36 member 4 [Source:NCBI gen... [more]
slc36a14.716e-5131.85proton-coupled amino acid transporter 1 [Source:NC... [more]
slc36a14.716e-5131.85proton-coupled amino acid transporter 1 [Source:NC... [more]
slc38a73.437e-1020.33solute carrier family 38 member 7 [Source:NCBI gen... [more]
slc32a16.248e-1021.71solute carrier family 32 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc36a11.441e-4930.35solute carrier family 36 member 1 [Source:ZFIN;Acc... [more]
slc32a13.766e-921.56solute carrier family 32 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
AVT42.187e-2223.18Vacuolar transporter; exports large neutral amino ... [more]
AVT38.813e-1924.43Vacuolar transporter; exports large neutral amino ... [more]
AVT72.081e-1125.42Putative transporter; member of a family of seven ... [more]
AVT22.628e-921.33Putative transporter; member of a family of seven ... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471405.614e-4730.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471411.391e-4529.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496134.851e-4228.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350316.587e-2024.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417001.410e-1323.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc36a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc36a13.736e-6232.41proton-coupled amino acid transporter 1 [Source:NC... [more]
ENSORLT00000004711.21.175e-1021.36vesicular inhibitory amino acid transporter [Sourc... [more]
slc32a13.560e-1021.61vesicular inhibitory amino acid transporter [Sourc... [more]
slc38a109.907e-724.42solute carrier family 38 member 10 [Source:NCBI ge... [more]
slc38a102.378e-624.09solute carrier family 38 member 10 [Source:NCBI ge... [more]
back to top
BLAST of slc36a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000060771.10.000e+0100.00SMESG000060771.1[more]
SMESG000022898.14.252e-4828.81SMESG000022898.1[more]
SMESG000022950.11.376e-1121.01SMESG000022950.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30002138
GenBankAKN21655.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002138 ID=SMED30002138|Name=slc36a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1613bp
CAAGTTATACTTTTAATAACACATTTGAATGTTTTATGTAATAATTTATT
TTTAAAATTTCGGAAAATATTTCATACAACTTTGGAATCAACATAAAGGA
AAATGTATGGTTGTATTAATGATGATAAACAAATATCTGAATTGAAATCC
ATAACTTCTAATGGAGAAATGAATGAGGAAACATTAATTGATGTAGAAGA
AGATCCTCATTTGTCAGATTCCAGTAATATAAGCTCTAACGCTGCACTTA
TGAATCTGATTAAAGGTAACATAGGAACGGGAATATTGGCAATGCCAGCG
GTAATTAAATATGCTGGAATACCATTAGGAATGCTATTAATTATTTGTGT
AGGTGCTTTGAGTACGTATCTGACGCATATTTTGCTGCGTTGCGCACAGA
CATTGGTAGACAAATACGGTGTGGATAGGGCCACTCTCGATTACACAGAA
ACTGTTGGTGGAGTATTTGAATTTGGACCATCCCGGCTGCAGCGTTACAA
GAAGTTAATGAAAATTCTCACTAACGTTTTCATGATTATCACACAAATCG
GATTCTGTTGTGCTTATATGCTTTTCATATCAGATAACATTAAATCGTTT
GTCGAAGATCATTTTTCTAAGAAAGTGAGGCTTGAAATTGTGGGAGCAGC
CGTAATGGGTCTGTTATTATGTATGTGTTGGATCAAAAATTTGAAAATTA
TCGCCAGGGTGGCTATATTTGCAAATATAAGTGCAATTTTAGGAATCATC
ATGATAATGGTGTATAGCATCATGGGGATTCAGGATTTCACCCAATTTCC
AACTTTCACTCCGTTTAATGACGTCCTTGTCGCATTTGGAATTGTGATAT
TTGCTTTCGAAGCTATTAATCTGGTGCTTCCAATTCAAAATAAGATGAAA
TACCCCGAAAGGTATGTCACAAGGGCTGGCGTTATAAATACGGCAATGGT
AACTGTTGTATGCTTATATGCTGCCATGGGATTTTATGGATTCCTGAAAT
TTGGAGAAAACACCCAGGGATCTATCACACTGAACCTTAAAGATGCTCCT
AGTTGGCTTATTCCTATTCAACCACTTTTTGTATTTTCTATTTTGGTGTC
TTATCTACTTCAAATCTACATTCCTGTGTTCATTTGCTCGAAATTAATTA
AAAAACTTGAATGCCATCAGAACAAATCATCCCTGGTGCAGAAAATTCAG
CTGAAAATTATACCGCCACTCATTGTCATATTTTCATATGTGATGGCCAT
CTCAATTCCTCATTTGGATTTAATGTTGGCATTACTCGGTGCCATTAGTA
GCTCATATTTAGCTCTGATTCTTCCTCCAATTATCAACGTTGTCTCTCGT
TATTCAGAGAATGACAATCGAGATTGGCGGTTCAAGTTGGGCGTGCTCTC
AGATGTTCTGATATTTTTATTTGGATTGATAGGTTTTATCGGTGGAACAG
CTAGTTCAATATATGCATTGATTAAGCAATAAGTTGTGTATGGATCAAAC
TTGTAAGATGATATTTTTCAATTAGTCCTGATTTGAATATTTGTTTTTTT
AATAAATCTATTTTCTAATATTGACATGCGCTGAATTATCGCTACGGTAA
CCATCATCGGTGT
back to top

protein sequence of SMED30002138-orf-1

>SMED30002138-orf-1 ID=SMED30002138-orf-1|Name=SMED30002138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=460bp
MYGCINDDKQISELKSITSNGEMNEETLIDVEEDPHLSDSSNISSNAALM
NLIKGNIGTGILAMPAVIKYAGIPLGMLLIICVGALSTYLTHILLRCAQT
LVDKYGVDRATLDYTETVGGVFEFGPSRLQRYKKLMKILTNVFMIITQIG
FCCAYMLFISDNIKSFVEDHFSKKVRLEIVGAAVMGLLLCMCWIKNLKII
ARVAIFANISAILGIIMIMVYSIMGIQDFTQFPTFTPFNDVLVAFGIVIF
AFEAINLVLPIQNKMKYPERYVTRAGVINTAMVTVVCLYAAMGFYGFLKF
GENTQGSITLNLKDAPSWLIPIQPLFVFSILVSYLLQIYIPVFICSKLIK
KLECHQNKSSLVQKIQLKIIPPLIVIFSYVMAISIPHLDLMLALLGAISS
SYLALILPPIINVVSRYSENDNRDWRFKLGVLSDVLIFLFGLIGFIGGTA
SSIYALIKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1
IPR013057AA_transpt_TM
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 41..106
e-value: 46.0
score: -0.5
coord: 113..457
e-value: 2.6E-12
score: 43.2
IPR013057Amino acid transporter, transmembrane domainPFAMPF01490Aa_transcoord: 43..453
e-value: 2.6E-66
score: 224.0
NoneNo IPR availablePANTHERPTHR22950AMINO ACID TRANSPORTERcoord: 34..449
NoneNo IPR availablePANTHERPTHR22950:SF150FI17861P1coord: 34..449
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 435..457
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 322..344
NoneNo IPR availableTMHMMTMhelixcoord: 365..387
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 392..414
NoneNo IPR availableTMHMMTMhelixcoord: 276..298