SUMO-activating enzyme subunit

Overview
NameSUMO-activating enzyme subunit
Smed IDSMED30002120
Length (bp)1855
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SUMO-activating enzyme subunit (SMED30002120) t-SNE clustered cells

Violin plots show distribution of expression levels for SUMO-activating enzyme subunit (SMED30002120) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SUMO-activating enzyme subunit (SMED30002120) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SUMO-activating enzyme subunit (SMED30002120) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002120

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002120SMESG000047759.1 SmedASXL_018534SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002120SMESG000047759.1 SmedASXL_018534SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002120SMESG000047759.1 dd_Smed_v4_5851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002120SMESG000047759.1 dd_Smed_v4_5851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002120SMESG000047759.1 dd_Smed_v4_5851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002120SMESG000041611.1 Contig4285GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002120SMESG000047759.1 SMESG000004769.1 SMESG000073442.1 Contig4285GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30002120SMESG000047759.1 Contig10477uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30002120SMESG000047759.1 Contig10477newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SUMO-activating enzyme subunit vs. Ensembl Human
Match: UBA2 (ubiquitin like modifier activating enzyme 2 [Source:HGNC Symbol;Acc:HGNC:30661])

HSP 1 Score: 456.062 bits (1172), Expect = 9.015e-153
Identity = 255/541 (47.13%), Postives = 352/541 (65.06%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE-------NGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDL--SQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV 1608
            +A   VLVVGAGGIGCELLKNLV+  F  I +IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE       + +  D  +++ +  W  S  YD   L   LF D+IR LL+M  LW K  R  P  LD + +    ++   S   +    G+KDQ+   ++++ + F  S   L   +++  D A L+WDKDD  AMDFV +AAN+RM +F  + M +RF+IKSMAGNIIPAIATTNA+IAG+ VL   KIL+G+ D+C  + ++   + R K++       P  +CYVC+ K E+T+   + + +++  L+  I++    M+AP+V I++    I+   ++   E    K L +F + NG+  +  DFLQ+Y  ++ I    +L  D  +E++GD 
Sbjct:   15 VAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTK-EWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRK--RKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFS-MNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRL-NVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDA 550          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Human
Match: UBA2 (ubiquitin like modifier activating enzyme 2 [Source:HGNC Symbol;Acc:HGNC:30661])

HSP 1 Score: 342.428 bits (877), Expect = 5.737e-110
Identity = 198/459 (43.14%), Postives = 286/459 (62.31%), Query Frame = 1
Query:  271 MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE-------NGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDL--SQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV 1608
            M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE       + +  D  +++ +  W  S  YD   L   LF D+IR LL+M  LW K  R  P  LD + +    ++   S   +    G+KDQ+   ++++ + F  S   L   +++  D A L+WDKDD  AMDFV +AAN+RM +F  + M +RF+IKSMAGNIIPAIATTNA+IAG+ VL   KIL+G+ D+C  + ++   + R K++       P  +CYVC+ K E+T+   + + +++  L+  I++    M+AP+V I++    I+   ++   E    K L +F + NG+  +  DFLQ+Y  ++ I    +L  D  +E++GD 
Sbjct:    1 MNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTK-EWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRK--RKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFS-MNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRL-NVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDA 454          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Human
Match: UBA2 (ubiquitin like modifier activating enzyme 2 [Source:HGNC Symbol;Acc:HGNC:30661])

HSP 1 Score: 270.781 bits (691), Expect = 4.982e-86
Identity = 140/274 (51.09%), Postives = 170/274 (62.04%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE-------NGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD 819
            + +A   VLVVGAGGIGCELLKNLV+  F  I                             L AKESVL+F P  NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE       + +  D  +++ +  W  S  YD   L   LF D+IR LL+M  LW K  R  P  LD
Sbjct:   13 EAVAGGRVLVVGAGGIGCELLKNLVLTGFSHID----------------------------LVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTK-EWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRK--RKPPVPLD 255          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Human
Match: UBA3 (ubiquitin like modifier activating enzyme 3 [Source:HGNC Symbol;Acc:HGNC:12470])

HSP 1 Score: 163.31 bits (412), Expect = 1.589e-43
Identity = 91/212 (42.92%), Postives = 126/212 (59.43%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF---NQLFGEPDADQDVVPDQNDPE 624
            VLV+GAGG+GCELLKNL +  F++I VID+DTIDVSNLNRQFLFR +++G+ KA  A E +    PN N+    + +    +N  F++ F I++  LD+  AR ++N M +             S +PLI+GGT G++G  +VIL G TAC EC  +  P Q  +P CTI + P  P HC+ + + L     Q FGE      V  D +DPE
Sbjct:   58 VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKI--QDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGE-----GVPLDGDDPE 262          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Human
Match: UBA3 (ubiquitin like modifier activating enzyme 3 [Source:HGNC Symbol;Acc:HGNC:12470])

HSP 1 Score: 163.696 bits (413), Expect = 1.872e-43
Identity = 91/212 (42.92%), Postives = 126/212 (59.43%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF---NQLFGEPDADQDVVPDQNDPE 624
            VLV+GAGG+GCELLKNL +  F++I VID+DTIDVSNLNRQFLFR +++G+ KA  A E +    PN N+    + +    +N  F++ F I++  LD+  AR ++N M +             S +PLI+GGT G++G  +VIL G TAC EC  +  P Q  +P CTI + P  P HC+ + + L     Q FGE      V  D +DPE
Sbjct:   72 VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKI--QDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGE-----GVPLDGDDPE 276          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Celegans
Match: uba-2 (SUMO-activating enzyme subunit uba-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9NAN1])

HSP 1 Score: 381.333 bits (978), Expect = 5.067e-125
Identity = 232/546 (42.49%), Postives = 319/546 (58.42%), Query Frame = 1
Query:   13 RMDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQK-QYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQN--DPELTNETT----ENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVK---------DQEKFSLRNWCQAFKNSANQLSERM-SQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELK-NDYEI 1596
            + + I +S +LV+GAGGIGCELLKNL +  F+++ VIDLDTID+SNLNRQFLFRKE+V  SKA TA + V +F P + +   HD +   KYN +FF+ +DIVLNALDN+AARNYVNRMC  +N PLI+ G+ GY GQV VI++GKT CYEC  KP Q+  YP CTIRNTPSE IHC VWAK +FNQLFGE D D DV PD +  DP+ T   T    +   + +P  +  R  W  S  YD+  +   LF  +I  L  M+ LW + +R  P              L    ++ TGG           D   ++L    + F     +L E++ ++ D  L +DKD  + M FVAA ANIR  +F I PM ++F+IK+MAGNIIPAIA+TNA++AGI V  A +++ G    C   + +   + RG+I        P   C+VCS+K E+ +   + + +++  L   +L+  L MLAP+V     S +I+  D D  D     K L +  + +G +  C DF Q  E  L IK    L  +D+E+
Sbjct:    7 KHEKIVQSKILVIGAGGIGCELLKNLAVTGFRKVHVIDLDTIDISNLNRQFLFRKEHVSSSKAATATQVVKQFCPQIELTFDHDSIFEKKYNMEFFQAYDIVLNALDNRAARNYVNRMCHAANRPLIDSGSGGYFGQVSVIMRGKTECYECVDKPVQQTTYPGCTIRNTPSEHIHCTVWAKHVFNQLFGEVDIDDDVSPDMDAVDPDNTEAVTTEKEKEAMKEEPAPVGTR-QWAESVDYDAAKVFDKLFLHDIEYLCKMEHLWKQRKRPSP--------------LEFHTASSTGGEPQSLCDAQRDDTSIWTLSTCAKVFSTCIQELLEQIRAEPDVKLAFDKDHAIIMSFVAACANIRAKIFGI-PMKSQFDIKAMAGNIIPAIASTNAIVAGIIVTEAVRVIEGSTVICNSSIATTQSNPRGRIFGGDATNPPNPRCFVCSEKREVFIYV-NPDTMTVGGLCEKVLKQKLNMLAPDVMDSATSRIIVSSDGDTDD--LLPKKLAEVSIEDGAILSCDDFQQEMEIKLFIKKGDRLAGDDFEV 533          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Celegans
Match: uba-1 (UBA (Human ubiquitin) related [Source:UniProtKB/TrEMBL;Acc:Q27481])

HSP 1 Score: 158.688 bits (400), Expect = 1.828e-40
Identity = 80/188 (42.55%), Postives = 111/188 (59.04%), Query Frame = 1
Query:   43 LVVGAGGIGCELLKNLVMWNFK-----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
             VVGAG IGCELLKNL M          I + D+D I++SNLNRQFLFR+ +VG  K+  A  +V  FN +V I+A+ + V     + +N +FF   + V NALDN  AR Y++R C+   +PL+E GTMG +G  QV+    T  Y     P +K+ P CT++N P+E  H + WA+  F   F +P
Sbjct:  521 FVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEISNLNRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELNGVANALDNVDARRYMDRRCVYYRLPLLESGTMGTKGNTQVVYPYLTESYSSSVDPPEKEIPVCTLKNFPNEIQHTIQWAREQFETFFAQP 708          

HSP 2 Score: 63.5438 bits (153), Expect = 3.207e-10
Identity = 32/104 (30.77%), Postives = 61/104 (58.65%), Query Frame = 1
Query:   10 SRMDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVL 321
            S M N+  ++VL+ G G +G E+ KNL++   + +T+ D      S+L+ Q+  R  +VG ++A +  E + + N +VN++     V +++   +F KTFD+V+
Sbjct:  118 SAMVNLRTASVLISGLGSVGVEIAKNLILGGVRHVTIHDTKLAKWSDLSAQYYLRDADVGHNRATSCYERLAELNDSVNVQ-----VSTDELTEEFVKTFDLVV 216          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Celegans
Match: uba-1 (UBA (Human ubiquitin) related [Source:UniProtKB/TrEMBL;Acc:Q27481])

HSP 1 Score: 158.688 bits (400), Expect = 1.828e-40
Identity = 80/188 (42.55%), Postives = 111/188 (59.04%), Query Frame = 1
Query:   43 LVVGAGGIGCELLKNLVMWNFK-----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
             VVGAG IGCELLKNL M          I + D+D I++SNLNRQFLFR+ +VG  K+  A  +V  FN +V I+A+ + V     + +N +FF   + V NALDN  AR Y++R C+   +PL+E GTMG +G  QV+    T  Y     P +K+ P CT++N P+E  H + WA+  F   F +P
Sbjct:  521 FVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEISNLNRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELNGVANALDNVDARRYMDRRCVYYRLPLLESGTMGTKGNTQVVYPYLTESYSSSVDPPEKEIPVCTLKNFPNEIQHTIQWAREQFETFFAQP 708          

HSP 2 Score: 63.5438 bits (153), Expect = 3.207e-10
Identity = 32/104 (30.77%), Postives = 61/104 (58.65%), Query Frame = 1
Query:   10 SRMDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVL 321
            S M N+  ++VL+ G G +G E+ KNL++   + +T+ D      S+L+ Q+  R  +VG ++A +  E + + N +VN++     V +++   +F KTFD+V+
Sbjct:  118 SAMVNLRTASVLISGLGSVGVEIAKNLILGGVRHVTIHDTKLAKWSDLSAQYYLRDADVGHNRATSCYERLAELNDSVNVQ-----VSTDELTEEFVKTFDLVV 216          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Celegans
Match: uba-1 (UBA (Human ubiquitin) related [Source:UniProtKB/TrEMBL;Acc:Q27481])

HSP 1 Score: 158.688 bits (400), Expect = 1.965e-40
Identity = 80/188 (42.55%), Postives = 111/188 (59.04%), Query Frame = 1
Query:   43 LVVGAGGIGCELLKNLVMWNFK-----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
             VVGAG IGCELLKNL M          I + D+D I++SNLNRQFLFR+ +VG  K+  A  +V  FN +V I+A+ + V     + +N +FF   + V NALDN  AR Y++R C+   +PL+E GTMG +G  QV+    T  Y     P +K+ P CT++N P+E  H + WA+  F   F +P
Sbjct:  520 FVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEISNLNRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELNGVANALDNVDARRYMDRRCVYYRLPLLESGTMGTKGNTQVVYPYLTESYSSSVDPPEKEIPVCTLKNFPNEIQHTIQWAREQFETFFAQP 707          

HSP 2 Score: 63.5438 bits (153), Expect = 3.262e-10
Identity = 32/104 (30.77%), Postives = 61/104 (58.65%), Query Frame = 1
Query:   10 SRMDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVL 321
            S M N+  ++VL+ G G +G E+ KNL++   + +T+ D      S+L+ Q+  R  +VG ++A +  E + + N +VN++     V +++   +F KTFD+V+
Sbjct:  117 SAMVNLRTASVLISGLGSVGVEIAKNLILGGVRHVTIHDTKLAKWSDLSAQYYLRDADVGHNRATSCYERLAELNDSVNVQ-----VSTDELTEEFVKTFDLVV 215          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Celegans
Match: uba-1 (UBA (Human ubiquitin) related [Source:UniProtKB/TrEMBL;Acc:Q27481])

HSP 1 Score: 158.688 bits (400), Expect = 1.969e-40
Identity = 80/188 (42.55%), Postives = 111/188 (59.04%), Query Frame = 1
Query:   43 LVVGAGGIGCELLKNLVMWNFK-----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
             VVGAG IGCELLKNL M          I + D+D I++SNLNRQFLFR+ +VG  K+  A  +V  FN +V I+A+ + V     + +N +FF   + V NALDN  AR Y++R C+   +PL+E GTMG +G  QV+    T  Y     P +K+ P CT++N P+E  H + WA+  F   F +P
Sbjct:  436 FVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEISNLNRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELNGVANALDNVDARRYMDRRCVYYRLPLLESGTMGTKGNTQVVYPYLTESYSSSVDPPEKEIPVCTLKNFPNEIQHTIQWAREQFETFFAQP 623          

HSP 2 Score: 63.5438 bits (153), Expect = 3.185e-10
Identity = 32/104 (30.77%), Postives = 61/104 (58.65%), Query Frame = 1
Query:   10 SRMDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVL 321
            S M N+  ++VL+ G G +G E+ KNL++   + +T+ D      S+L+ Q+  R  +VG ++A +  E + + N +VN++     V +++   +F KTFD+V+
Sbjct:   33 SAMVNLRTASVLISGLGSVGVEIAKNLILGGVRHVTIHDTKLAKWSDLSAQYYLRDADVGHNRATSCYERLAELNDSVNVQ-----VSTDELTEEFVKTFDLVV 131          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Fly
Match: Uba2 (gene:FBgn0029113 transcript:FBtr0076734)

HSP 1 Score: 410.994 bits (1055), Expect = 6.779e-135
Identity = 257/606 (42.41%), Postives = 344/606 (56.77%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP--------------------------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEK-----FSLRNWCQAFKNSANQLSERM--SQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGK-IVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIK-VDSEL-KNDYEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRK 1734
            + KS VLVVGAGGIGCE+LKNLV+  F +I +IDLDTID+SNLNRQFLF +E+VGKSKA  A+ES L FNP+  I A HD V S  Y  +FFK FD+VL+ALDN+AARN+VNRMCL +++PLIE GT GY GQV++I +G T CYEC PK  Q+ +P CTIRNTPSEPIHC+VWAK LFNQLFGE   D+D+ PD  DP+   +   +G+  +P                          +++N R  W     YD+  L    FN++I  LL M  LW            K+ + V  D L       +G  KD  K     +S+    Q F NS  +LS      + D  L WDKDD  AMDFVAA AN+R  +F I    +RFEIKSMAGNIIPAIATTNA+ AGISV+ A+K+L  + ++C  V      + R   +V       P  +C+VC+    +TL    T  + +K L+  +L   L ML P+V +Q+  S+ +   ++   E    K L + ++ +G + +C DF QNYE  + I   D+E  +N +E++ D   +      D D+   +    +  DE        TN  GD K
Sbjct:   17 VKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGN-GEPKGDGKEKGEESKEEKEAKEDTANGNIMRINTR-QWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTR---------KAPVPVQWDTL--LPEGSSGDQKDVAKQHHKVWSIEECAQVFANSLKELSANFLKLEGDDTLAWDKDDQPAMDFVAACANVRSHIFDI-ERKSRFEIKSMAGNIIPAIATTNAITAGISVMRAFKVLEAKWEQCKAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKI-DTKRMRIKELRDEVLVKTLNMLNPDVTVQSNGSI-LISSEEGETECNDGKLLSELNIVDGVILKCDDFFQNYELSIIISHFDAERDENLFEVVADASQL---KPKDEDQKEAVK---DKEDEPKSAKKRSTNGEGDSK 600          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Fly
Match: Uba3 (gene:FBgn0263697 transcript:FBtr0087585)

HSP 1 Score: 153.295 bits (386), Expect = 3.618e-40
Identity = 81/196 (41.33%), Postives = 113/196 (57.65%), Query Frame = 1
Query:   28 AKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNI----KAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL-------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFL 558
             K  VL++GAGG+GCELLK+L +  F  + VID+DTI++SNLNRQFLFR+ ++G SKA  A   +    P   +    K I D      ++  F++ F +V+  LD+  AR ++N M L              S +P+I+GGT G++G  +VIL G TAC EC     P Q  YP CTI NTP  P HC+ + K +
Sbjct:   47 TKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKIQD------FDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIEYVKII 236          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Fly
Match: Uba1 (gene:FBgn0023143 transcript:FBtr0088499)

HSP 1 Score: 154.451 bits (389), Expect = 6.756e-39
Identity = 82/192 (42.71%), Postives = 113/192 (58.85%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFK----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNK---YNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLF 573
            + +A S   +VGAG IGCELLKN  M        +I V D+D I+ SNLNRQFLFR  +V K K++TA +++ + NP VN+ A    V +     ++ DFF   D V NALDN  AR Y++R C+ + IPL+E GT+G  G VQVI+   T  Y     P +K  P CT++N P+   H + WA+  F  +F
Sbjct:  600 EKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNVDARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDAFEGVF 791          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Fly
Match: Uba1 (gene:FBgn0023143 transcript:FBtr0339517)

HSP 1 Score: 154.066 bits (388), Expect = 8.007e-39
Identity = 82/192 (42.71%), Postives = 113/192 (58.85%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFK----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNK---YNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLF 573
            + +A S   +VGAG IGCELLKN  M        +I V D+D I+ SNLNRQFLFR  +V K K++TA +++ + NP VN+ A    V +     ++ DFF   D V NALDN  AR Y++R C+ + IPL+E GT+G  G VQVI+   T  Y     P +K  P CT++N P+   H + WA+  F  +F
Sbjct:  417 EKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNVDARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDAFEGVF 608          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0079683)

HSP 1 Score: 90.1225 bits (222), Expect = 8.689e-19
Identity = 45/149 (30.20%), Postives = 78/149 (52.35%), Query Frame = 1
Query:   34 SNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYEC-YPKP 477
            S+VL+VG GG+GC   + L       + ++D D ++ SN +RQ L  ++  G SKA +A+ ++L+ NP+  I+  H  ++         + +D+VL+  DN   R  ++  C+  + PL+ G  +   GQ+ V       CY C +P P
Sbjct:   92 SSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQC-HSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKMDGQLTVYNYANGPCYRCIFPVP 239          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 463.381 bits (1191), Expect = 6.988e-156
Identity = 276/607 (45.47%), Postives = 368/607 (60.63%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE------LTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSDSD----RNGNLNSPPNSVDETADL---------------NDSGTNVSGDRKRKHEDS 1752
            D+++   VLVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLF+K++VGKSKA  AKESVL+F P+ NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL ++IPLIE GT GY GQV VI KG+T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE               DQ   +K      W  S  YD   L   LF D+I  LL+M  LW K  R  P  L+   IN     L      +  G+KDQ+   ++ + Q F++S   L  ++ +  D A LVWDKDD  AMDFV AA+N+RM+VF  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL A KILN   ++C  + ++   + R K++       P   CYVC+ K E+T+   + +   ++ L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +    EL+ D  +E++GD      +  +  +     NGN +S   S    A +               + +    S +RKRKH D+
Sbjct:   14 DSLSSCRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGQTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVSTKEWARSTGYDPIKLFNKLFKDDIMYLLTMDKLWKK--RKAPLPLEWEEIN----QLGSQEQVIGSGLKDQQVLGVQGYAQLFQHSVETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKILNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKL-NVHKTMVQALQDKILKEKFGMVAPDVQIEDGKGTILISSEEGETEANNNKFLSDFGIRNGSRLQADDFLQDYTLLVNVIHSEELEKDVEFEVVGDAPDKAPAPSAPEEGKNIANGNKDSAQPSTSSKAAVEDDDVLLVDSDEEPSSSTMDTESSNRKRKHHDA 612          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 456.833 bits (1174), Expect = 3.254e-153
Identity = 276/617 (44.73%), Postives = 368/617 (59.64%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE------LTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLL----------KILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSDSD----RNGNLNSPPNSVDETADL---------------NDSGTNVSGDRKRKHEDS 1752
            D+++   VLVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLF+K++VGKSKA  AKESVL+F P+ NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL ++IPLIE GT GY GQV VI KG+T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE               DQ   +K      W  S  YD   L             LF D+I  LL+M  LW K  R  P  L+   IN     L      +  G+KDQ+   ++ + Q F++S   L  ++ +  D A LVWDKDD  AMDFV AA+N+RM+VF  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL A KILN   ++C  + ++   + R K++       P   CYVC+ K E+T+   + +   ++ L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +    EL+ D  +E++GD      +  +  +     NGN +S   S    A +               + +    S +RKRKH D+
Sbjct:   14 DSLSSCRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGQTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVSTKEWARSTGYDPIKLFNKVSALSQTSPYLFKDDIMYLLTMDKLWKK--RKAPLPLEWEEIN----QLGSQEQVIGSGLKDQQVLGVQGYAQLFQHSVETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKILNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKL-NVHKTMVQALQDKILKEKFGMVAPDVQIEDGKGTILISSEEGETEANNNKFLSDFGIRNGSRLQADDFLQDYTLLVNVIHSEELEKDVEFEVVGDAPDKAPAPSAPEEGKNIANGNKDSAQPSTSSKAAVEDDDVLLVDSDEEPSSSTMDTESSNRKRKHHDA 622          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 456.833 bits (1174), Expect = 3.813e-153
Identity = 276/617 (44.73%), Postives = 368/617 (59.64%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE------LTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLL----------KILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSDSD----RNGNLNSPPNSVDETADL---------------NDSGTNVSGDRKRKHEDS 1752
            D+++   VLVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLF+K++VGKSKA  AKESVL+F P+ NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL ++IPLIE GT GY GQV VI KG+T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE               DQ   +K      W  S  YD   L             LF D+I  LL+M  LW K  R  P  L+   IN     L      +  G+KDQ+   ++ + Q F++S   L  ++ +  D A LVWDKDD  AMDFV AA+N+RM+VF  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL A KILN   ++C  + ++   + R K++       P   CYVC+ K E+T+   + +   ++ L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +    EL+ D  +E++GD      +  +  +     NGN +S   S    A +               + +    S +RKRKH D+
Sbjct:   14 DSLSSCRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGQTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVSTKEWARSTGYDPIKLFNKVSALSQTSPYLFKDDIMYLLTMDKLWKK--RKAPLPLEWEEIN----QLGSQEQVIGSGLKDQQVLGVQGYAQLFQHSVETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKILNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKL-NVHKTMVQALQDKILKEKFGMVAPDVQIEDGKGTILISSEEGETEANNNKFLSDFGIRNGSRLQADDFLQDYTLLVNVIHSEELEKDVEFEVVGDAPDKAPAPSAPEEGKNIANGNKDSAQPSTSSKAAVEDDDVLLVDSDEEPSSSTMDTESSNRKRKHHDA 622          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 218.779 bits (556), Expect = 6.395e-65
Identity = 151/376 (40.16%), Postives = 210/376 (55.85%), Query Frame = 1
Query:  490 YPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE------LTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLL----------KILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTG-GVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEI 1560
            +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE               DQ   +K      W  S  YD   L             LF D+I  LL+M  LW K  R  P  L+   IN     L+     V G G+KDQ+   ++ + Q F++S   L  ++ +  D A LVWDKDD  AMDFV AA+N+RM+VF  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL A KILN   ++C  + ++   + R K++       P   CYVC+ K E+T+   + +   ++ L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +
Sbjct:    2 FPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVSTKEWARSTGYDPIKLFNKVSALSQTSPYLFKDDIMYLLTMDKLWKK--RKAPLPLEWEEIN----QLAGSQEQVIGSGLKDQQVLGVQGYAQLFQHSVETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKILNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKL-NVHKTMVQALQDKILKEKFGMVAPDVQIEDGKGTILISSEEGETEANNNKFLSDFGIRNGSRLQADDFLQDYTLLVNV 369          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Zebrafish
Match: uba3 (ubiquitin-like modifier activating enzyme 3 [Source:NCBI gene;Acc:406776])

HSP 1 Score: 153.68 bits (387), Expect = 3.879e-40
Identity = 90/216 (41.67%), Postives = 125/216 (57.87%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNI----KAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF---NQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLK+L +  F+ I V+D+DTIDVSNLNRQFLFR ++VG+ KA  A + V    P  ++    K I D       +  F++ F IV+  LD+  AR ++N M L             S IPLI+GGT G++G  +VIL G TAC +C  +  P Q  +P CTI + P  P HCV + + L     + FG+      VV D +DP+
Sbjct:   71 ILVIGAGGLGCELLKDLALSGFRHIHVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAADFVNDRVPGCSVVPHFKKIQD------LDETFYRQFHIVVCGLDSVIARRWMNGMLLSLLIYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCVEYVRMLLWPKEKPFGD-----GVVLDGDDPK 275          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 392.119 bits (1006), Expect = 1.714e-128
Identity = 235/502 (46.81%), Postives = 307/502 (61.16%), Query Frame = 1
Query:  121 IDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP-VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTA--LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDV 1608
            IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FFK F +V+NALDN AARN+VNRMCL + IPLIE GT GY GQV V+ KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE  +    N    D  +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N  I    Q    +  G+KDQ+   + +  Q F  S   L E++ +      LVWDKDD  AMDFV AAAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T        + L + KV +     +ML   V    ++  II     ++      + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV
Sbjct:   28 IDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITAYHDSIMNPDYNVEFFKQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVTVVKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAASAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPVPLEWSSLHNKGILHALQI---IVTGLKDQKVLDVTSCAQLFSKSVETLREQLREKGNGAELVWDKDDPPAMDFVTAAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVT--------VKLNVHKVTV-----QMLQDKV----RTGEIISSALLQLTTANNNRKISEFGIRNSSQLQADDFLQDYTLMINILHSDEMEKDVDFEVVGDV 506          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 388.652 bits (997), Expect = 3.572e-127
Identity = 234/507 (46.15%), Postives = 313/507 (61.74%), Query Frame = 1
Query:  121 IDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTA--LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDV 1608
            IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FFK F +V+NALDN AARN+VNRMCL + IPLIE GT GY GQV V+ KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE   + T+  ++ +       +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N +    +Q  S++  G+KDQ+   + +  Q F  S   L E++ +      LVWDKDD  AMDFV AAAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T        + L + KV +     +ML   V    ++  II     ++      + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV
Sbjct:   23 IDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITAYHDSIMNPDYNVEFFKQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVTVVKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAAWDPTQAAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPVPLEWSSLHNKENCSETQNESSLQ-GLKDQKVLDVTSCAQLFSKSVETLREQLREKGNGAELVWDKDDPPAMDFVTAAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVT--------VKLNVHKVTV-----QMLQDKV----RTGEIISSALLQLTTANNNRKISEFGIRNSSQLQADDFLQDYTLMINILHSDEMEKDVDFEVVGDV 508          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 390.963 bits (1003), Expect = 4.610e-126
Identity = 237/516 (45.93%), Postives = 318/516 (61.63%), Query Frame = 1
Query:   94 MWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTA--LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDV 1608
            +W   EI +IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FFK F +V+NALDN AARN+VNRMCL + IPLIE GT GY GQV V+ KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE   + T+  ++ +       +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N +    +Q  S++  G+KDQ+   + +  Q F  S   L E++ +      LVWDKDD  AMDFV AAAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T        + L + KV +     +ML   V    ++  II     ++      + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV
Sbjct:   27 LW---EIVLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITAYHDSIMNPDYNVEFFKQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVTVVKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAAWDPTQAAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPVPLEWSSLHNKENCSETQNESSLQ-GLKDQKVLDVTSCAQLFSKSVETLREQLREKGNGAELVWDKDDPPAMDFVTAAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVT--------VKLNVHKVTV-----QMLQDKV----RTGEIISSALLQLTTANNNRKISEFGIRNSSQLQADDFLQDYTLMINILHSDEMEKDVDFEVVGDV 518          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 384.8 bits (987), Expect = 1.082e-125
Identity = 232/507 (45.76%), Postives = 308/507 (60.75%), Query Frame = 1
Query:  121 IDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTA--LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDV 1608
            IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FFK F +V+NALDN AARN+VNRMCL + IPLIE GT GY GQV V+ KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE   + T+  ++ +       +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N +I             +KDQ+   + +  Q F  S   L E++ +      LVWDKDD  AMDFV AAAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T        + L + KV +     +ML   V    ++  II     ++      + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV
Sbjct:   34 IDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITAYHDSIMNPDYNVEFFKQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVTVVKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAAWDPTQAAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPVPLEWSSLHNKEIGSC----------LKDQKVLDVTSCAQLFSKSVETLREQLREKGNGAELVWDKDDPPAMDFVTAAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVT--------VKLNVHKVTV-----QMLQDKV----RTGEIISSALLQLTTANNNRKISEFGIRNSSQLQADDFLQDYTLMINILHSDEMEKDVDFEVVGDV 510          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 384.03 bits (985), Expect = 3.619e-125
Identity = 235/516 (45.54%), Postives = 315/516 (61.05%), Query Frame = 1
Query:  109 EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFN-----QLFGEPDADQDVVPDQNDPELTNETTENGDQTDP------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTA--LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDV 1608
            EI +IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FFK F +V+NALDN AARN+VNRMCL + IPLIE GT GY GQV V+ KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LF      QLFGE DADQ+V PD  DPE   + T+  ++ +       +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N +    +Q  S++  G+KDQ+   + +  Q F  S   L E++ +      LVWDKDD  AMDFV AAAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T        + L + KV +     +ML   V    ++  II     ++      + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV
Sbjct:   29 EIVLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITAYHDSIMNPDYNVEFFKQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVTVVKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFKSIVWLQLFGEEDADQEVAPDIADPEAAWDPTQAAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPVPLEWSSLHNKENCSETQNESSLQ-GLKDQKVLDVTSCAQLFSKSVETLREQLREKGNGAELVWDKDDPPAMDFVTAAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVT--------VKLNVHKVTV-----QMLQDKV----RTGEIISSALLQLTTANNNRKISEFGIRNSSQLQADDFLQDYTLMINILHSDEMEKDVDFEVVGDV 523          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Mouse
Match: Uba2 (ubiquitin-like modifier activating enzyme 2 [Source:MGI Symbol;Acc:MGI:1858313])

HSP 1 Score: 457.218 bits (1175), Expect = 1.626e-153
Identity = 271/609 (44.50%), Postives = 376/609 (61.74%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE-------NGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKP----EVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV-EHVISSAVSDSDR---NGNLNSPPNSVDETADLND------------SGTNVSGD---RKRKHED 1749
            ++   VLVVGAGGIGCELLKNLV+  F  I +IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F+P  NI+A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE       + +  D  +++ +  W  S  YD   L   LF D+IR LL+M  LW K +   P    EV  +   N D  +  Q       G+KDQ+   ++++   F  S   L   +++  D A L+WDKDD  AMDFV +AAN+RM +F  + M +RF+IKSMAGNIIPAIATTNA+IAG+ VL   KIL+G+ D+C  + ++   + R K++       P  +CYVC+ K E+T+   + + +++  L+  I++    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ I    +L  D  +E++GD  E V      D+ +   NG+ +    S     + +D            + T+ SGD   RKRK E+
Sbjct:   15 VSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFHPQANIEAHHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTK-EWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEANADQQNEPQL------GLKDQQVLDVKSYASLFSKSIETLRVHLAEKGDGAELIWDKDDPPAMDFVTSAANLRMHIFS-MNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNTNCYVCASKPEVTVRL-NVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNPKKLSDFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDSPEKVGPKQAEDAAKSIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCSGDDKARKRKLEE 614          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Mouse
Match: Uba2 (ubiquitin-like modifier activating enzyme 2 [Source:MGI Symbol;Acc:MGI:1858313])

HSP 1 Score: 204.912 bits (520), Expect = 7.474e-63
Identity = 86/127 (67.72%), Postives = 105/127 (82.68%), Query Frame = 1
Query:  244 NIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE 624
            NI+A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE
Sbjct:    2 NIEAHHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPE 128          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Mouse
Match: Uba2 (ubiquitin-like modifier activating enzyme 2 [Source:MGI Symbol;Acc:MGI:1858313])

HSP 1 Score: 162.925 bits (411), Expect = 7.238e-47
Identity = 68/98 (69.39%), Postives = 79/98 (80.61%), Query Frame = 1
Query:  352 YVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE 645
            +VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE
Sbjct:    1 HVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTE 98          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Mouse
Match: Uba3 (ubiquitin-like modifier activating enzyme 3 [Source:MGI Symbol;Acc:MGI:1341217])

HSP 1 Score: 163.31 bits (412), Expect = 1.114e-43
Identity = 93/213 (43.66%), Postives = 127/213 (59.62%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF---NQLFGEPDADQDVVP-DQNDPE 624
            VLV+GAGG+GCELLKNL +  F++I VID+DTIDVSNLNRQFLFR ++VG+ KA  A E +    PN N+    + +    +N  F++ F I++  LD+  AR ++N M +             S +PLI+GGT G++G  +VIL G TAC EC  +  P Q  +P CTI + P  P HC+ + + L     Q FG      D VP D +DPE
Sbjct:   58 VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKI--QDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFG------DGVPLDGDDPE 262          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Mouse
Match: Uba3 (ubiquitin-like modifier activating enzyme 3 [Source:MGI Symbol;Acc:MGI:1341217])

HSP 1 Score: 163.696 bits (413), Expect = 1.300e-43
Identity = 93/213 (43.66%), Postives = 127/213 (59.62%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF---NQLFGEPDADQDVVP-DQNDPE 624
            VLV+GAGG+GCELLKNL +  F++I VID+DTIDVSNLNRQFLFR ++VG+ KA  A E +    PN N+    + +    +N  F++ F I++  LD+  AR ++N M +             S +PLI+GGT G++G  +VIL G TAC EC  +  P Q  +P CTI + P  P HC+ + + L     Q FG      D VP D +DPE
Sbjct:   72 VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKI--QDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFG------DGVPLDGDDPE 276          
BLAST of SUMO-activating enzyme subunit vs. UniProt/SwissProt
Match: sp|Q9Z1F9|SAE2_MOUSE (SUMO-activating enzyme subunit 2 OS=Mus musculus OX=10090 GN=Uba2 PE=1 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.137e-152
Identity = 271/609 (44.50%), Postives = 376/609 (61.74%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE-------NGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKP----EVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV-EHVISSAVSDSDR---NGNLNSPPNSVDETADLND------------SGTNVSGD---RKRKHED 1749
            ++   VLVVGAGGIGCELLKNLV+  F  I +IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F+P  NI+A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE       + +  D  +++ +  W  S  YD   L   LF D+IR LL+M  LW K +   P    EV  +   N D  +  Q       G+KDQ+   ++++   F  S   L   +++  D A L+WDKDD  AMDFV +AAN+RM +F  + M +RF+IKSMAGNIIPAIATTNA+IAG+ VL   KIL+G+ D+C  + ++   + R K++       P  +CYVC+ K E+T+   + + +++  L+  I++    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ I    +L  D  +E++GD  E V      D+ +   NG+ +    S     + +D            + T+ SGD   RKRK E+
Sbjct:   15 VSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFHPQANIEAHHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTK-EWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEANADQQNEPQL------GLKDQQVLDVKSYASLFSKSIETLRVHLAEKGDGAELIWDKDDPPAMDFVTSAANLRMHIFS-MNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNTNCYVCASKPEVTVRL-NVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNPKKLSDFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDSPEKVGPKQAEDAAKSIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCSGDDKARKRKLEE 614          
BLAST of SUMO-activating enzyme subunit vs. UniProt/SwissProt
Match: sp|Q7SXG4|SAE2_DANRE (SUMO-activating enzyme subunit 2 OS=Danio rerio OX=7955 GN=uba2 PE=1 SV=2)

HSP 1 Score: 456.833 bits (1174), Expect = 2.456e-152
Identity = 276/617 (44.73%), Postives = 368/617 (59.64%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE------LTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLL----------KILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSDSD----RNGNLNSPPNSVDETADL---------------NDSGTNVSGDRKRKHEDS 1752
            D+++   VLVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLF+K++VGKSKA  AKESVL+F P+ NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL ++IPLIE GT GY GQV VI KG+T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE               DQ   +K      W  S  YD   L             LF D+I  LL+M  LW K  R  P  L+   IN     L      +  G+KDQ+   ++ + Q F++S   L  ++ +  D A LVWDKDD  AMDFV AA+N+RM+VF  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL A KILN   ++C  + ++   + R K++       P   CYVC+ K E+T+   + +   ++ L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +    EL+ D  +E++GD      +  +  +     NGN +S   S    A +               + +    S +RKRKH D+
Sbjct:   14 DSLSSCRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGQTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVSTKEWARSTGYDPIKLFNKVSALSQTSPYLFKDDIMYLLTMDKLWKK--RKAPLPLEWEEIN----QLGSQEQVIGSGLKDQQVLGVQGYAQLFQHSVETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKILNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKL-NVHKTMVQALQDKILKEKFGMVAPDVQIEDGKGTILISSEEGETEANNNKFLSDFGIRNGSRLQADDFLQDYTLLVNVIHSEELEKDVEFEVVGDAPDKAPAPSAPEEGKNIANGNKDSAQPSTSSKAAVEDDDVLLVDSDEEPSSSTMDTESSNRKRKHHDA 622          
BLAST of SUMO-activating enzyme subunit vs. UniProt/SwissProt
Match: sp|Q9UBT2|SAE2_HUMAN (SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2)

HSP 1 Score: 456.062 bits (1172), Expect = 4.329e-152
Identity = 255/541 (47.13%), Postives = 352/541 (65.06%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTE-------NGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDL--SQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV 1608
            +A   VLVVGAGGIGCELLKNLV+  F  I +IDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P  NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV  I KG T CYEC+PKP Q+ +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD+ DPE   E TE       + +  D  +++ +  W  S  YD   L   LF D+IR LL+M  LW K  R  P  LD + +    ++   S   +    G+KDQ+   ++++ + F  S   L   +++  D A L+WDKDD  AMDFV +AAN+RM +F  + M +RF+IKSMAGNIIPAIATTNA+IAG+ VL   KIL+G+ D+C  + ++   + R K++       P  +CYVC+ K E+T+   + + +++  L+  I++    M+AP+V I++    I+   ++   E    K L +F + NG+  +  DFLQ+Y  ++ I    +L  D  +E++GD 
Sbjct:   15 VAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTK-EWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRK--RKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFS-MNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRL-NVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDA 550          
BLAST of SUMO-activating enzyme subunit vs. UniProt/SwissProt
Match: sp|Q642Q1|SAE2A_XENLA (SUMO-activating enzyme subunit 2-A OS=Xenopus laevis OX=8355 GN=uba2-a PE=2 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 2.591e-150
Identity = 265/588 (45.07%), Postives = 366/588 (62.24%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRKHEDSM 1755
            ++ S +LVVGAGGIGCELLKNLV+  F  + VIDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P+ NI A HD +M+  YN +FFK F + +NALDN AARN+VNRMCL + IPLIE GT GY GQV VI KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE   + T+  ++ +       +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N +     Q  S++  G+KDQ+  ++ ++ Q F  S   L E++ +  D A LVWDKDDV AMDFV AAAN+RM +F  + M ++F++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T+   + + +++++L+  IL+    M+AP+V I++    I+   +    +    + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV              G    P  SV    + +D G   S  + +  +D +
Sbjct:   15 VSASRLLVVGAGGIGCELLKNLVLTGFTNLDVIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPDANITAYHDSIMNPDYNVEFFKQFTMAMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVSVIKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAAWDPTKAAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPIPLEWASLHNKENCSEIQNESSLL-GLKDQKVLNVASYAQLFSKSVETLREQLREKGDGAELVWDKDDVPAMDFVTAAANLRMHIFS-MNMKSKFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVTVKL-NVHKVTVQMLQDKILKEKFAMVAPDVQIEDGKGTILISSEAGETDANNHRKISEFGIRNSSQLQADDFLQDYTLMMNILHSDEMEKDVDFEVVGDVPE-----------KGPQKPPEESVKNITNGSDDGAQPSTSKAQDQDDVL 586          
BLAST of SUMO-activating enzyme subunit vs. UniProt/SwissProt
Match: sp|Q7ZY60|SAE2B_XENLA (SUMO-activating enzyme subunit 2-B OS=Xenopus laevis OX=8355 GN=uba2-b PE=2 SV=2)

HSP 1 Score: 449.899 bits (1156), Expect = 1.149e-149
Identity = 264/588 (44.90%), Postives = 366/588 (62.24%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ-SDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKN--DYEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRKHEDSM 1755
            ++ S +LVVGAGGIGCELLKNLV+  F  + VIDLDTIDVSNLNRQFLF+K++VG+SKA  AKESVL+F P+ +I A HD +M+  YN +FFK F + +NALDN AARN+VNRMCL + IPLIE GT GY GQV VI KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE   + T+  ++ +       +K      W  S  YD   L   LF D+I+ LL+M  LW K  R  P  L+  SL N +     Q  S++  G+KDQ+  ++ ++ Q F  S   L E++ +  D A LVWDKDDV AMDFV AAAN+RM +F  + M ++F++KSMAGNIIPAIATTNA+I+G+ VL   KIL+G  ++C  V ++   + R K++       P   CYVC+ K E+T+   + + +++++L+  IL+    M+AP+V I++    I+   +    +    + + +F + N +  +  DFLQ+Y  ++ I    E++   D+E++GDV              G    P  SV    + +D G   S  + +  +D +
Sbjct:   15 VSASRLLVVGAGGIGCELLKNLVLTGFTNLDVIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPDASITAYHDSIMNPDYNVEFFKQFTMAMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVSVIKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAAWDPTKAAERANASNVDGDIKRVSTKQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRK--RKPPIPLEWASLHNKENCSEIQNESSLL-GLKDQKVLNVASYAQLFSKSVETLREQLREKGDGAELVWDKDDVPAMDFVTAAANLRMHIFS-MNMKSKFDVKSMAGNIIPAIATTNAVISGLIVLEGLKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVTVKL-NVHKVTVQMLQDKILKEKFAMVAPDVQIEDGKGTILISSEAGETDANNHRKISEFGIRNSSQLQADDFLQDYTLMMNILHSDEMEKDVDFEVVGDVPE-----------KGPQKPPEESVKNITNGSDDGAQPSTSKAQDQDDVL 586          
BLAST of SUMO-activating enzyme subunit vs. TrEMBL
Match: A0A2T7NHS4 (SUMO-activating enzyme subunit OS=Pomacea canaliculata OX=400727 GN=C0Q70_18890 PE=3 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 2.264e-159
Identity = 283/611 (46.32%), Postives = 375/611 (61.37%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENG-------DQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERM-SQSDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEF-VLEIKVDS-ELKNDYEILGDVEHVISSAVSDSDRNGNLNSPPNS------------VDETADLNDSGTNVSGD--RKRKHEDSMEHELKHK 1776
            + +  SN+LVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLFRKE+VG+SKA  AKESVL FNPNV+I A HD VMS  Y+ +FFK F +V+NALDNKAARN+VNRMCL +++PL+E G+ GY GQV VI KG+T CYEC PKP QK +P CTIRNTPSEPIHCVVWAK LFNQLFGE D DQDV PD  DPELT E  +         D+   +      AW     Y+   L    F D+I+ LLSMK LW K  RV P  LD S +  + D     M++ +G ++DQ+ + ++     F      L + + +Q D   LVWDKDD V+MDFV + ANIR  +F I PM TRF+IKSMAGNIIPAIATTNA+IAG+ ++ A+KIL  +   C ++ ++   + R +++      SP   CYVC+ K E+T++  +T    +  L+  +L++HL M+AP+V I +    I+   ++   E   +K L  F V +GT  +C DFLQ Y   ++   V+  E + D+E++GD+   +         NG       +            +D   DL +    + G   RKRK +D +E   K +
Sbjct:   15 EQVKNSNILVVGAGGIGCELLKNLVLTGFKTIEVIDLDTIDVSNLNRQFLFRKEHVGRSKAQVAKESVLNFNPNVSITAYHDSVMSPDYDVNFFKKFTLVMNALDNKAARNHVNRMCLAADVPLVESGSAGYLGQVTVIKKGQTECYECRPKPVQKTFPGCTIRNTPSEPIHCVVWAKHLFNQLFGELDPDQDVSPDTEDPELTAEAGQTALLSEAKIDEIGGLHRKSTRAWAQEVGYNPEKLFNKFFRDDIKYLLSMKTLWKK--RVPPTPLDMSGLPENPD-----MTSNSGVLRDQKLWGIKECADVFAECLESLKKDLATQGDGGVLVWDKDDTVSMDFVTSVANIRAYIFGI-PMKTRFQIKSMAGNIIPAIATTNAVIAGLIIMEAFKILGNRLHSCKEIYLNRVPNDRNRLLIPCCLNSPNPKCYVCAPKPEVTVVLNTTTF-KVGALQDKVLKSHLGMVAPDVEIDDMKGTILISSEEGETEENNDKFLSDFGVRSGTRLKCDDFLQVYSLNIIVAHVEKLEGEKDFEVVGDLSE-LQPQQEKQKTNGQQELADKALAAANDEDDLMIIDSIDDLQEQSLEMKGHLLRKRKVDDEVEESPKRR 615          
BLAST of SUMO-activating enzyme subunit vs. TrEMBL
Match: V4ATI1 (SUMO-activating enzyme subunit OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_178117 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.381e-159
Identity = 273/541 (50.46%), Postives = 359/541 (66.36%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDPVKLNIR----LAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQL-SERMSQSDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKNDYE--ILGDVEHV 1617
            +N++   VLVVGAGGIGCELLKNLV+  F +I VIDLDTIDVSNLNRQFLFRKE+VGKSK+  AKES LKFNPNVNI A HD VM+  Y ADFFK F +V+NALDN+AARN+VNRMCL +++PL+E GT GY GQV VI KG T CYEC PK AQK +P CTIRNTPSEPIHCVVWAK LFNQLFGE D DQDV PD  DPELT    E+  + +     I       W +   YD+  +   LF D+I+ LL+M+ LW K  R  PE L       D ++LS    + T  ++DQ  +S++     F     +L ++  +Q D   LVWDKDD  A+DFV +AAN+R ++F I    +RF+IKSMAGNIIPAIATTNA+IAG+ V+ A KIL+ + DKC  V ++   + R K++ + +   P   CYVCS K E+T++  +T  I++K L+  IL++ L M+AP+V I N    II   ++   E   +K L +F++ NG+  +C DFLQNY   + I    +L+++ E  ++GD+  +
Sbjct:   11 NNVSNCKVLVVGAGGIGCELLKNLVLTGFSDIQVIDLDTIDVSNLNRQFLFRKEHVGKSKSQVAKESALKFNPNVNIVAYHDSVMNPDYGADFFKQFKLVMNALDNRAARNHVNRMCLAADVPLVESGTAGYLGQVTVIKKGLTECYECRPKAAQKTFPGCTIRNTPSEPIHCVVWAKHLFNQLFGEEDPDQDVSPDTEDPELTAAAGESALEKETEGKEIERKSTRVWAMDTGYDAEKIFSKLFRDDIKYLLTMETLWKK--RRPPEPL-------DYNNLSDESPSSTNDMRDQRIWSMKECADVFSKCLAKLKTDLAAQGDGGMLVWDKDDDKALDFVVSAANVRANIFGI-SQKSRFDIKSMAGNIIPAIATTNAIIAGLIVMEALKILDNKFDKCTAVYLNRKPNFRKKLLDAGRLDPPNPKCYVCSAKPEVTVVL-NTQKITIKFLEDKILKSELGMVAPDVEIDNGLGTIIISSEEGETEQNNDKFLSKFNIINGSRLKCDDFLQNYNLNITIAHVEKLEDEKEFMVVGDMAEL 540          
BLAST of SUMO-activating enzyme subunit vs. TrEMBL
Match: A0A1Z5LEN3 (GE20372 (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 471.855 bits (1213), Expect = 2.043e-156
Identity = 269/539 (49.91%), Postives = 344/539 (63.82%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPEL------TNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSER---MSQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV 1608
            +  S VLVVGAGGIGCELLKNLV+  F++I VIDLDTIDVSNLNRQFLFRK +VGKSKAL AKES  K NP+  IKA HD V+  +Y  +FFK F IVLNALDN+ AR++VNRMCL +N+ LIE GT GY GQV  I+K  T CYEC PKPAQK YP CTIRNTPSEPIHC+VWAK LFNQLFGE DAD+DV PD +DPEL       N   E+GD     +++ RL W VS  YD   L   LFN++I  LL M  LW K  R  P  L  +L+    D +    ++   G  DQ  +S+      F+ S   L  R   +S  D+ L WDKD    +DFV A AN+R   F I P  +RF++KSMAGNIIPAIATTNA+IAG+ VL A+KIL G+ + C  V ++   + R K++   Q + P   CY CS K E+ +   +T  ++L++L+  IL+ HL M AP+V + +    I+   ++   E   EK L   +V +GT  RC DFLQN++ V+ I     L +D  +E++G+V
Sbjct:   10 VKSSKVLVVGAGGIGCELLKNLVLAGFQDIEVIDLDTIDVSNLNRQFLFRKAHVGKSKALVAKESAEKINPDAKIKAHHDSVIKPEYGLEFFKRFSIVLNALDNRGARSHVNRMCLAANVTLIESGTAGYLGQVTPIIKNVTECYECQPKPAQKTYPGCTIRNTPSEPIHCIVWAKHLFNQLFGEADADEDVSPDSSDPELIGQVNSQNMVQESGDGGSLHRVSTRL-WAVSCGYDPVKLFNKLFNEDISYLLRMDKLWKK--RTPPTSLKWNLLP---DAVPSSSNDSVAGTNDQRLWSIAECGIIFRESLRSLKTRIQSLSPGDS-LTWDKDSKDCLDFVTACANLRAHCFGI-PQKSRFDVKSMAGNIIPAIATTNAIIAGVIVLQAFKILQGKKESCSAVYLNKQPNLRKKMIVPTQLVKPSPKCYACSSKAEVFVYL-NTKQVTLQVLEDKILKEHLHMCAPDVEVDDGKGTILISSEEGETEGNREKCLAHLNVTHGTRLRCDDFLQNFQLVMNILHKDSLTDDKEFEVVGNV 539          
BLAST of SUMO-activating enzyme subunit vs. TrEMBL
Match: K1Q5G9 (SUMO-activating enzyme subunit OS=Crassostrea gigas OX=29159 GN=CGI_10018487 PE=3 SV=1)

HSP 1 Score: 471.085 bits (1211), Expect = 7.588e-156
Identity = 271/593 (45.70%), Postives = 372/593 (62.73%), Query Frame = 1
Query:   22 NIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNET-------TENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQ--SDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSD--SDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRKHEDSME 1758
            N+    +LVVGAGGIGCELLKNLV+  F +I VIDLDTIDVSNLNRQFLFRKE+VGKSKA  AKES L FNPN  I A HD +MS  Y  DFFK F +V+NALDN+AARN+VNRMCL ++IPLIE GT GY GQV VI KG T CYEC PKP QK +P CTIRNTPSEPIHCVVWAK LFNQLFGE D DQDV PD  DPELT E         E  +    ++      W +   YD+  +   LF D+I+ LLSM+ LW K  R  P  LD  +L + +  + S  M       +DQ  +S++   Q F +    L +  +    +  LVWDKDD +AMDFVA+ +NIR  +F I    T+F+IKSMAGNIIPAIATTNA+IA + V+   K+L+G+ ++C  + ++   + R K++       P   CYVCS K E+T++  +T  +++K L+  IL++ L M+AP+V I +    I+   ++   E   +K L +F V NG++ +C DFLQ+YE  + I    +L+ D  ++++GD+  + +  + +  +++NG+  S     D+   +++     SG +++  ++  E
Sbjct:   15 NVLSCKLLVVGAGGIGCELLKNLVLTGFHDIVVIDLDTIDVSNLNRQFLFRKEHVGKSKAQVAKESALNFNPNAKITAYHDSIMSPDYGVDFFKKFTMVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGLTECYECQPKPPQKSFPGCTIRNTPSEPIHCVVWAKHLFNQLFGEEDPDQDVSPDTEDPELTAEAGQTALEQKEQSNVAGGIERKSTRTWAMETGYDAKKIFNKLFRDDIKYLLSMETLWKK--RRPPNPLDFDNLPHTECSEPSTVM-------RDQRVWSMKECAQVFSDCLAGLKKEFTNQGENGMLVWDKDDELAMDFVASTSNIRSHIFGI-NQKTKFDIKSMAGNIIPAIATTNAIIAAVIVMEGLKVLDGRIEECKQIYLNRQPNPRKKLLVPCALDKPSPKCYVCSSKPEVTVVL-NTEKMTIKTLEDKILKSALGMVAPDVEIDDGKGTILISSEEGEMEENNDKFLSEFHVGNGSILKCDDFLQSYELKIIIAHKDKLEEDKEFDVVGDLSELHAKPLVEQPTNQNGSTTSHQEEEDDLMIVDEVEVIKSGTKRKADQEPDE 596          
BLAST of SUMO-activating enzyme subunit vs. TrEMBL
Match: A0A1S3J4Q2 (SUMO-activating enzyme subunit OS=Lingula unguis OX=7574 GN=LOC106169757 PE=3 SV=1)

HSP 1 Score: 471.085 bits (1211), Expect = 1.726e-155
Identity = 273/552 (49.46%), Postives = 351/552 (63.59%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDP-------VKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLD-KSLINVDIDDLSQFMSNVTGG-------VKDQEKFSLRNWCQAFKNSANQL-SERMSQSDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEF-VLEIKVDS-ELKNDYEILGDVEHV 1617
            + +  S +LVVGAGGIGCELLKNLV+  FK+I VIDLDTIDVSNLNRQFLFRKE+VGKSKA  A+ES LKFNP+  IKA HD VMS +Y+ +FFK FD+VLNALDN+AARN+VNRMCL ++ PL+E GT GY GQV VI KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK LFNQLFGE D D+DV PD  DPEL  +  +   Q++        ++      W     YD   +   LF D+I  LLSM++LW K  R  PE LD  SL N             TGG       + DQ  +S++     FK S + L SE   Q D   LVWDKD+  AMDFV AAANIR  +F I P+ +RF+IKSMAGNIIPAIATTNA+IAG+ V+ A KIL+G  + C  V ++   + R K++       P   CYVCS K E+T+   +T++ ++K L+  +++    ++AP+V + +    II   ++   E    K L  F + NG+  +C DFLQ Y   +  + VD  E + ++E++GDV  V
Sbjct:   14 EKVKSSRILVVGAGGIGCELLKNLVLTGFKDIEVIDLDTIDVSNLNRQFLFRKEHVGKSKAQVARESALKFNPDGKIKAYHDSVMSTEYDTEFFKQFDVVLNALDNRAARNHVNRMCLAADKPLVESGTAGYLGQVTVIKKGLTECYECQPKPHQKTFPGCTIRNTPSEPIHCIVWAKHLFNQLFGEADPDEDVSPDTEDPELAGDAGKQALQSEAKEDTVGGIERKSTRIWAQETGYDPMKIFNKLFRDDIHYLLSMESLWKK--RRPPEPLDFDSLPN-------------TGGSSDNMNLIHDQRIWSVQECADIFKQSVDLLKSELQKQGDAGILVWDKDEPAAMDFVTAAANIRAYIFGI-PIKSRFDIKSMAGNIIPAIATTNAIIAGLLVMEALKILSGNINDCRTVYLNRHPNSRKKLLVPCMLDPPNPKCYVCSSKPEVTVKVNTTSM-TVKSLEDKVIKGQFGLVAPDVELDDGKGTIIISSEEGETEENAAKPLSFFGIKNGSRIKCDDFLQEYNLNITLLHVDKLEEEKEFEVVGDVSEV 548          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Cavefish
Match: uba2 (ubiquitin like modifier activating enzyme 2 [Source:NCBI gene;Acc:103037342])

HSP 1 Score: 458.759 bits (1179), Expect = 4.500e-154
Identity = 281/618 (45.47%), Postives = 377/618 (61.00%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPEL------TNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTG-GVKDQEKFSLRNWCQAFKNSANQLSERMS-QSDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDV-EHVISSAVSDSDR---NGNLNS--PPNS------------VDETADLNDSGTNVSGDR---KRKHEDSMEHELKHK 1776
            D+++   +LVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLF+K++VGKSKA  AKESVL+F P+ NI A HD +M+  YN +FF++F +V+NALDN+AARN+VNRMCL ++IPLIE GT GY GQV VI KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE       T       DQ   +K      W  S  YD   L   LF D+I  LL+M  LW K  R  P  LD +    ++  L+       G G+KDQ+  ++  + + F++S   L  +++ + D A LVWDKDD  AMDFV AAAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL A K+LN    +C  + ++   + R K++       P  +CYVC+ K E+T+       I ++ L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +    EL  D  +E++GD  +    S   + ++   NGN +S  P  S            VD   + + S  +VS +    KRKH+D+   E   K
Sbjct:   14 DSVSSCKILVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRSFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGVTECYECQPKPTQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPEDTAARATASDQDGDIKRVSTKDWARSTGYDPVKLFNKLFKDDIMYLLTMDKLWKK--RKAPVPLDWA----EMLQLANPQDEGCGTGLKDQQVLNVGGYSRLFQHSVETLRSQLADKGDGAELVWDKDDPPAMDFVTAAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKVLNSDIQQCRTIFLNKQPNPRKKLLVPCALDRPNPNCYVCASKPEVTVKLNVHKTI-VQALQDKILKEKFGMVAPDVQIEDGKGTILISSEEGETEANNGKMLSDFGIRNGSRLQADDFLQDYTLLVNVLHSEELPKDVEFEVVGDAPDKAPPSKAPEEEKSITNGNKDSAQPSTSSKAVVEEDDLLIVDSDEEPSSSTADVSTETSSLKRKHQDAETGEAASK 623          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Cavefish
Match: uba1 (ubiquitin like modifier activating enzyme 1 [Source:NCBI gene;Acc:103045813])

HSP 1 Score: 160.614 bits (405), Expect = 7.498e-41
Identity = 87/202 (43.07%), Postives = 119/202 (58.91%), Query Frame = 1
Query:    1 IF*SRMDNI-AKSNVLVVGAGGIGCELLKNLVMWNFK----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNK---YNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
            +F S+M  + AK    +VGAG IGCELLKN  M        E+ V D+DTI+ SNLNRQFLFR  +V K K+ TA  +V + NP+V I    + V  +    Y+ DFF++ D V NALDN  AR Y++R C+    PL+E GT+G +G VQV++   T  Y     P +K  P CT++N P+   H + WA+  F  LF +P
Sbjct:  458 VFGSKMQELLAKQRYFLVGAGAIGCELLKNFAMMGLASGEGEVIVTDMDTIEKSNLNRQFLFRPWDVTKMKSETAAAAVKQMNPSVRITGHQNRVGPDTEKVYDDDFFESLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVMPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQP 659          

HSP 2 Score: 63.1586 bits (152), Expect = 6.144e-10
Identity = 36/137 (26.28%), Postives = 67/137 (48.91%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQV 426
            M  +  SNVL+ G  G+G E+ KN+++   K +T+ D    + ++L+ QF  R+E++GK++A  ++  + + N  V + A      + +   D+   F +V+        +  +   C    I LI   T G  GQ+
Sbjct:   67 MKRMQSSNVLISGLRGLGVEIAKNVILGGVKTVTLHDQGVAEWNDLSSQFYLREEDLGKNRAEVSQTRLAELNSYVPVTA-----YTGELTDDYLTDFQVVVLTSSTIDEQTRIGEFCHSKGIKLIIADTRGLFGQL 198          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Cavefish
Match: uba1 (ubiquitin like modifier activating enzyme 1 [Source:NCBI gene;Acc:103045813])

HSP 1 Score: 160.614 bits (405), Expect = 7.616e-41
Identity = 87/202 (43.07%), Postives = 119/202 (58.91%), Query Frame = 1
Query:    1 IF*SRMDNI-AKSNVLVVGAGGIGCELLKNLVMWNFK----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNK---YNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
            +F S+M  + AK    +VGAG IGCELLKN  M        E+ V D+DTI+ SNLNRQFLFR  +V K K+ TA  +V + NP+V I    + V  +    Y+ DFF++ D V NALDN  AR Y++R C+    PL+E GT+G +G VQV++   T  Y     P +K  P CT++N P+   H + WA+  F  LF +P
Sbjct:  455 VFGSKMQELLAKQRYFLVGAGAIGCELLKNFAMMGLASGEGEVIVTDMDTIEKSNLNRQFLFRPWDVTKMKSETAAAAVKQMNPSVRITGHQNRVGPDTEKVYDDDFFESLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVMPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQP 656          

HSP 2 Score: 63.1586 bits (152), Expect = 5.881e-10
Identity = 36/137 (26.28%), Postives = 67/137 (48.91%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQV 426
            M  +  SNVL+ G  G+G E+ KN+++   K +T+ D    + ++L+ QF  R+E++GK++A  ++  + + N  V + A      + +   D+   F +V+        +  +   C    I LI   T G  GQ+
Sbjct:   64 MKRMQSSNVLISGLRGLGVEIAKNVILGGVKTVTLHDQGVAEWNDLSSQFYLREEDLGKNRAEVSQTRLAELNSYVPVTA-----YTGELTDDYLTDFQVVVLTSSTIDEQTRIGEFCHSKGIKLIIADTRGLFGQL 195          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Cavefish
Match: UBA3 (ubiquitin like modifier activating enzyme 3 [Source:NCBI gene;Acc:103047072])

HSP 1 Score: 154.451 bits (389), Expect = 1.308e-40
Identity = 88/213 (41.31%), Postives = 123/213 (57.75%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNI----KAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLKNL +  F+ I V+D+DTIDVSNLNRQFLFR ++VG+ KA  A + V    P  ++    K I D      ++  F++ F I++  LD+  AR ++N M L             S IPLI+GGT G++G  +VIL G TAC +C  +  P Q  +P CTI + P  P HC+ + + L  Q   E      V  D ++PE
Sbjct:   56 ILVIGAGGLGCELLKNLALSGFRHIHVVDMDTIDVSNLNRQFLFRSKDVGRPKADVAADFVNSRVPGCHVVPHFKKIQD------FDESFYRQFHIIVCGLDSIIARRWMNGMLLSLLVYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCIEYVRIL--QWPKEKPFGDGVALDGDNPE 260          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Cavefish
Match: UBA3 (ubiquitin like modifier activating enzyme 3 [Source:NCBI gene;Acc:103047072])

HSP 1 Score: 154.451 bits (389), Expect = 1.558e-40
Identity = 88/213 (41.31%), Postives = 123/213 (57.75%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNI----KAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLKNL +  F+ I V+D+DTIDVSNLNRQFLFR ++VG+ KA  A + V    P  ++    K I D      ++  F++ F I++  LD+  AR ++N M L             S IPLI+GGT G++G  +VIL G TAC +C  +  P Q  +P CTI + P  P HC+ + + L  Q   E      V  D ++PE
Sbjct:   67 ILVIGAGGLGCELLKNLALSGFRHIHVVDMDTIDVSNLNRQFLFRSKDVGRPKADVAADFVNSRVPGCHVVPHFKKIQD------FDESFYRQFHIIVCGLDSIIARRWMNGMLLSLLVYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCIEYVRIL--QWPKEKPFGDGVALDGDNPE 271          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Sea Lamprey
Match: uba3 (ubiquitin-like modifier activating enzyme 3 [Source:NCBI gene;Acc:406776])

HSP 1 Score: 158.688 bits (400), Expect = 9.651e-43
Identity = 85/212 (40.09%), Postives = 123/212 (58.02%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF---NQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLK+L +  F++I VID+DTIDVSNLNRQFLFR ++VG+ KA  A E +    P  N+          +Y+  F++ F I++  LD+  AR ++N M +             + IP+I+GGT G++G  +V+L G TAC EC     P Q  +P CT+ + P  P HC+ + + L     Q FG+      V  D +DPE
Sbjct:   58 ILVLGAGGLGCELLKDLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKANVAAEFINTRVPGCNVMPYPSFSNIQEYDESFYRQFHIIVCGLDSIVARRWINGMLMSMLNFEDGVLDPSTIIPMIDGGTEGFKGNARVVLPGMTACIECTLDLYPPQINFPICTLASMPRLPEHCIEYVRLLQWPKEQPFGD-----AVALDGDDPE 264          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Sea Lamprey
Match: sae1 (SUMO1 activating enzyme subunit 1 [Source:NCBI gene;Acc:415148])

HSP 1 Score: 65.0846 bits (157), Expect = 1.105e-11
Identity = 37/129 (28.68%), Postives = 62/129 (48.06%), Query Frame = 1
Query:   34 SNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRG 420
            S +L+VG  G+G E+ KNL++   K +T +D +     +   QFL  +  +G++ A  + E     NP V+++    D+ S     +FF  FD +      +     +NR+C + NI    G   GY G
Sbjct:   38 SKLLIVGMKGLGAEVAKNLILAGVKSVTFLDNNKATEESTRAQFLVPQSRLGENLAEASLERAQNLNPMVDVRTDKSDIASK--TEEFFTQFDSICLTGCPQDVMIKINRICHERNIKFFAGDVFGYHG 164          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Sea Lamprey
Match: mocs3 (molybdenum cofactor synthesis 3 [Source:NCBI gene;Acc:393095])

HSP 1 Score: 60.4622 bits (145), Expect = 4.423e-10
Identity = 33/119 (27.73%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  112 ITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNA-DFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYEC 465
            + ++D D++++SNL+RQ L  ++ VG+ KA +A  +V +   N  ++ +   ++ ++ NA    + +D+V +  DN A R  V+ +C+ +  PL+    +   GQ+ V       CY C
Sbjct:    3 LGLVDHDSVELSNLHRQVLHTEQRVGEEKAASAACAVAQIRLNSTVEVVPYHLLLSQKNALQLVRQYDVVADCSDNVATRYLVSDVCVLAGKPLVSASALRMEGQLTVYNHEGGPCYRC 121          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Sea Lamprey
Match: uba5 (ubiquitin-like modifier activating enzyme 5 [Source:NCBI gene;Acc:386712])

HSP 1 Score: 51.6026 bits (122), Expect = 1.083e-7
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 1
Query:   58 GGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFF------------KTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTM--GYRGQVQVILKGKTACYECYP 471
            GG+G    + L      ++ + D D ++++N+NR F F+ +  G SK   A+ ++   NP+V  +  H+  ++   N   F            +  ++VL  +DN  AR  +N  C + +   IE G       G +Q+I+ G+TAC+ C P
Sbjct:   33 GGVGSVTAEMLTRCGVGKLLLFDYDKVELANMNRLF-FQPQQAGMSKVEAAEHTLRNINPDVQFET-HNYNVTTMGNFQHFMERVSHGGLQEGRPVELVLCCVDNFEARMAINTACNELSQVWIESGVSENAVSGHIQLIIPGETACFACAP 182          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Sea Lamprey
Match: atg7 (ATG7 autophagy related 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-1633])

HSP 1 Score: 51.2174 bits (121), Expect = 5.089e-7
Identity = 25/79 (31.65%), Postives = 43/79 (54.43%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENV---GKSKALTAKESVLKFNPNV 243
            ++ ++ +  L++GAG +GC + + L+ W  + IT +D   +  SN  RQ L+  E+    GK KA  A E + +  P V
Sbjct:  331 LEAVSTARCLLLGAGTLGCNVARTLLGWGVRHITFVDNARVSYSNPVRQTLYEFEDCLGGGKPKAQAAAERLRRIFPGV 409          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Yeast
Match: UBA2 (Subunit of heterodimeric nuclear SUMO activating enzyme E1 with Aos1p; activates Smt3p (SUMO) before its conjugation to proteins (sumoylation), which may play a role in protein targeting; essential for viability [Source:SGD;Acc:S000002798])

HSP 1 Score: 270.011 bits (689), Expect = 2.088e-82
Identity = 202/552 (36.59%), Postives = 304/552 (55.07%), Query Frame = 1
Query:   34 SNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMS-NKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAK-FLFNQLFG------EPDADQDVVPDQNDPELTNETTENGDQTDPVKLNI-RLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILN----GQADKCLDVMVSDFVS-----GRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFE----KTLDQFDVANGTVFRCS----DFLQNYEFVLEIKVDSELKNDYEILGDVE 1611
            S  L+VGAGGIG ELLK++++  F EI ++DLDTID+SNLNRQFLFR++++ + K+ TA ++V  FN N  +     +VM  + +   +F+ FDI+ NALDN AAR YVN++    ++PLIE GT G+ G +Q I+ GKT C+EC  K   K +P CTIR+TPS+PIHC+VWAK FLFNQLF       E D +QD   D  + E+     E  +  +  K+ I R A ++ +      +L  LF  +I  LL+++ LW    R KP  L  S IN      +Q  SN  G +++Q           F N   +L +R  +    + +DKDD   ++FVA AANIR  +F+I PM + F+IK +AGNIIPAIATTNA++AG S L + ++LN        K  D+ ++ F +      + + + + +   P K+C VCSK      +C+    +S   L    L + + ++    +     S++   +   + +  FE    +TL + ++ NG++   S    D +      L + VD EL  +   L DVE
Sbjct:   22 SRCLLVGAGGIGSELLKDIILMEFGEIHIVDLDTIDLSNLNRQFLFRQKDIKQPKSTTAVKAVQHFN-NSKLVPYQGNVMDISTFPLHWFEQFDIIFNALDNLAARRYVNKISQFLSLPLIESGTAGFDGYMQPIIPGKTECFECTKKETPKTFPVCTIRSTPSQPIHCIVWAKNFLFNQLFASETSGNEDDNNQDWGTDDAE-EIKRIKQETNELYELQKIIISRDASRIPE------ILNKLFIQDINKLLAIENLW--KTRTKPVPLSDSQINTPT-KTAQSASNSVGTIQEQ--------ISNFINITQKLMDRYPKEQNHIEFDKDDADTLEFVATAANIRSHIFNI-PMKSVFDIKQIAGNIIPAIATTNAIVAGASSLISLRVLNLLKYAPTTKYTDLNMA-FTAKASNLSQNRYLSNPKLAPPNKNCPVCSK------VCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDASNQRLLFDYDFEDLNDRTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTCSLPDVE 546          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Yeast
Match: UBA1 (Ubiquitin activating enzyme (E1); involved in ubiquitin-mediated protein degradation and essential for viability; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001693])

HSP 1 Score: 150.599 bits (379), Expect = 1.547e-38
Identity = 83/193 (43.01%), Postives = 112/193 (58.03%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKE-----ITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVN--IKAIHDDVMSNK---YNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLF 573
            IA S V +VG+G IGCE+LKN  +          I V D D+I+ SNLNRQFLFR ++VGK+K+  A E+V   NP++   I A  D V       +N  F+++ D V NALDN  AR YV+R C+    PL+E GT+G +G  QVI+   T  Y     P +K  P CT+R+ P++  H + WAK LF   F
Sbjct:  432 IANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYF 624          

HSP 2 Score: 55.4546 bits (132), Expect = 1.864e-8
Identity = 40/145 (27.59%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIH--DDVMSNKYNADFFKTFDIVLNALDNKAARNYV--NRMCLKSNIPLIEGGTMGYRGQVQVIL 438
            M  +  SNVL++G  G+G E+ KN+V+   K +TV D + + +++L+ QF   ++++G+ +    +  + + N  V +  +   DDV            F +V+ A D  +  + V  N  C  S I  I   T G  G   V L
Sbjct:   31 MLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQ-------LSQFQVVV-ATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDL 167          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Yeast
Match: UBA3 (Protein that activates Rub1p (NEDD8) before neddylation; acts together with Ula1p; may play a role in protein degradation; GFP-fusion protein localizes to the cytoplasm in a punctate pattern [Source:SGD;Acc:S000006270])

HSP 1 Score: 129.798 bits (325), Expect = 5.374e-34
Identity = 73/183 (39.89%), Postives = 111/183 (60.66%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNF-KEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVN----RMCLKSN----IPLIEGGTMGYRGQVQVILKGKTACYECY--PKPAQK-QYPACTIRNTPSEPIHCVVWAK 552
            +LV+GAGG+GCE+LKNL M +F K++ ++D+DTI+++NLNRQFLF  +++GK KA  A + V    P + + A   D+ +      F+K F  +++ LD    R ++N    ++ L+SN    IP I+GGT G +G V+ I+ G TAC+EC     P+Q+   P CTI N P    H V +  
Sbjct:    5 ILVLGAGGLGCEILKNLTMLSFVKQVHIVDIDTIELTNLNRQFLFCDKDIGKPKAQVAAQYVNTRFPQLEVVAHVQDLTT--LPPSFYKDFQFIISGLDAIEPRRFINETLVKLTLESNYEICIPFIDGGTEGLKGHVKTIIPGITACWECSIDTLPSQQDTVPMCTIANNPRCIEHVVEYVS 185          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Yeast
Match: UBA4 (E1-like protein that activates Urm1p before urmylation; also acts in thiolation of the wobble base of cytoplasmic tRNAs by adenylating and then thiolating Urm1p; receives sulfur from Tum1p [Source:SGD;Acc:S000001153])

HSP 1 Score: 87.8113 bits (216), Expect = 6.084e-19
Identity = 50/151 (33.11%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   34 SNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNA-DFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVI-LKGKTACYEC-YPKP 477
            + VLVVGAGG+GC  L  L      +I ++D D ++ SNL+RQ L     VG  K  +A++ + K NP++N+  +   V  N  NA D FK ++ +L+  D+   R  V+ + +   I ++    +G  GQ+ ++       CY C YP P
Sbjct:   68 TKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINV--VTYPVRLNSSNAFDIFKGYNYILDCTDSPLTRYLVSDVAVNLGITVVSASGLGTEGQLTILNFNNIGPCYRCFYPTP 216          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Yeast
Match: ATG7 (Autophagy-related protein and dual specificity member of the E1 family; mediates the attachment of Atg12p to Atg5p and Atg8p to phosphatidylethanolamine which are required steps in autophagosome formation; E1 enzymes are also known as ubiquitin-activating enzymes; involved in methionine restriction extension of chronological lifespan in an autophagy-dependent manner [Source:SGD;Acc:S000001214])

HSP 1 Score: 59.3066 bits (142), Expect = 1.161e-9
Identity = 37/125 (29.60%), Postives = 62/125 (49.60%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAI--------HDDVMSNKYNADF------FKTFDIVLNALDNKAAR 348
            +D I  + VL++GAG +GC + + L+ W  ++IT +D  T+  SN  RQ L+  E+ GK KA  A  S+ +  P ++   +        H  V     + DF       K  DI+   +D++ +R
Sbjct:  319 LDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESR 443          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Nematostella
Match: EDO46454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPW5])

HSP 1 Score: 464.151 bits (1193), Expect = 5.769e-157
Identity = 266/589 (45.16%), Postives = 356/589 (60.44%), Query Frame = 1
Query:   10 SRMDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNE----------TTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRK 1740
            S  D +  S +LVVGAGGIGCELLKNLV+  FK I +IDLDTIDVSNLNRQFLF K++VGKSKA  A+ES L+FNP+  I AIHD++ S +Y  D+FK FD+V+NALDN+AARN+VNRMCL +++PL+E GT GY GQ  VI KG T CYEC PKP QK +P CTIRNTPSEPIHC+VWAK LFNQLFGE DAD++V PD  DPE   E             NG +    + + RL W     Y+   L   LFN++I+ LLSM  LW K     P + D     V  +  S    +    ++DQ  +S++   + F  S   L   +S     L WDKDD  +MDFV  AANIR  +F I PM +RF+IK+MAGNIIPAIATTNA+I+GI V+    IL G+ DKC  + ++   + R +I+     + P   CYVC+ K E+  +  +T  ++++ L+  +L+    M+AP+V I +    II   +    E    K L +F++ NG+  +  DFLQNYE V+ IK  ++L+ D  +E+ GD+    S   +  + +     P N    + D      N +  RKRK
Sbjct:   16 SLADKVNNSKILVVGAGGIGCELLKNLVLTGFKNIDLIDLDTIDVSNLNRQFLFHKQHVGKSKAKVARESALRFNPDAKIVAIHDNITSPEYGIDYFKQFDVVMNALDNRAARNHVNRMCLAADVPLVESGTAGYLGQTTVIKKGVTECYECQPKPTQKSFPGCTIRNTPSEPIHCIVWAKHLFNQLFGEADADEEVSPDTEDPEAVGEAGANAAQDGAAANNGGEIQ--RQSTRL-WAEQIGYNPLKLFNKLFNEDIKYLLSMDKLWKKRTPPTPLLWD----TVTTESHSSENGSDDSQLQDQRVWSVQECAKKFSTSIESLKIELSTKGEDLSWDKDDPASMDFVCCAANIRAQIFGI-PMKSRFDIKAMAGNIIPAIATTNAVISGIIVMQGLNILAGKLDKCKTIYLNRQPNPRKRILVPCALVEPNPKCYVCASKPEVVTVFVNTETMTIQALEEKVLKERFGMIAPDVEIDDGKGTIIISSEQGETEDNLPKALAEFNIINGSRLKADDFLQNYELVINIKHRTDLETDQEFEVEGDIPEPGSPGPAPVEPSNEPGLPSNGDTASQDELMVVENATPSRKRK 596          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Nematostella
Match: EDO33332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSG6])

HSP 1 Score: 165.236 bits (417), Expect = 7.206e-43
Identity = 143/451 (31.71%), Postives = 207/451 (45.90%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFK-----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDAD-------------QDVVPDQNDPELTNETTENGDQTDPVKLNIRLAW--KVSDQYDSNLLLKILFNDNIRDLLSM-KALWMKSERV-KPEVLD-KSLINVDI----DDLSQFMSNVTG-----------------------GVK----DQEKFSLRNWCQ--------AFKNSANQLSERMSQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILN 1182
            + +    VVGAG IGCE LKN  M          I   D+DTI+ SNLNRQFLFR  +V K K+  A  +V   NP+VNI A  + V       YN DFF++   V NALDN  AR Y++R C+    PL+E GT+G +G VQV+L   T  Y     P +K  P CT++N P+   H + WA+  F  LF  P  +              D +P     E+ +   +      P      ++W   +  +Y  N + ++LFN     + S  +  W   +R   P V D +   ++D      +L  +M  +TG                       GVK    DQE  + RN  +        A     +    +M+ +D     D D    MDF+ AA+N+R + + I P   R + K +AG IIPAIATT A+++G+  L  YK++ 
Sbjct:  416 LGQQKYFVVGAGAIGCEHLKNFAMMGLGSGEGGHIYTTDMDTIEKSNLNRQFLFRPADVQKMKSEVAARAVKVMNPDVNITAHGNRVGPETEKVYNDDFFESLSGVTNALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVLPFMTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDAFEGLFTIPAENVNQYVCDPKFIERTDKLPGMQAMEVYDSVKKCLVDERPKDFAGCVSWARHLFQEYYHNTIKQLLFNFPADQMTSSGQPFWSGPKRCPHPLVFDPREGTHLDFISAAANLRAYMYGITGSKDQQYILDILKGITVPEFVPKSGVKIAVTDQEAEAERNTDEDDVDSVKSAMPTPESLQGFKMNPAD--FEKDDDTNFHMDFIVAASNLRAANYDIPPA-DRHKSKLIAGKIIPAIATTTAIVSGLVCLELYKLVQ 863          

HSP 2 Score: 69.3218 bits (168), Expect = 2.719e-12
Identity = 40/137 (29.20%), Postives = 71/137 (51.82%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQV 426
            M  +A SNVL+ G  G+G E+ KN+V+   K +T+ D   +++S+L  QF   K++VGK++A  +   + + N  V++      V + K   +F   F +V+    +   + +++  C    I LI   T G  GQ+
Sbjct:   20 MKKMAVSNVLISGLRGLGVEIAKNVVLGGVKSVTLHDTGAVELSDLTSQFFLNKKDVGKNRAEVSHPRIAELNTYVSMS-----VNTQKLTEEFINKFQVVVLTESSLEEQLWISDFCHSKGIKLIISDTKGLFGQI 151          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Nematostella
Match: EDO41621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Z1])

HSP 1 Score: 155.992 bits (393), Expect = 1.380e-41
Identity = 81/198 (40.91%), Postives = 118/198 (59.60%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKE----SVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCL-------------KSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLF 561
            +  + VLV+GAGG+GCELLK+L +  F++I VID+DTID+SNLNRQFLFR +++G+ KA  A E     +   N   + + I D      Y+  F+K F IV+  LD+  AR ++N M +              S IP+++GGT G++G  ++++ G TAC EC     P Q  +P CTI +TP  P HC+ +AK L 
Sbjct:   39 LESAKVLVIGAGGLGCELLKDLALCGFRDIHVIDMDTIDISNLNRQFLFRPKDIGRPKADVAAEFINSRIAGCNVTPHFRKIQD------YDTGFYKNFHIVVCGLDSIFARRWINGMLMSLLEYDEDGNLDQSSLIPMVDGGTEGFKGNARIVVPGITACIECTLDLYPPQVNFPLCTIAHTPRLPEHCIEYAKVLL 230          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Nematostella
Match: EDO38775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV9])

HSP 1 Score: 142.124 bits (357), Expect = 2.695e-35
Identity = 73/194 (37.63%), Postives = 112/194 (57.73%), Query Frame = 1
Query:   25 IAKSNVLVVGAGGIGCELLKNLVMWNFKE-----ITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKA----IHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGE 579
            IA   + +VG G IGCE LKN  +          I++ D D I+ SNLNRQFLFR  ++ K+K+ T+  S  + NP+++I+A    +  D   + +N  FF++ ++V+NALDN  AR YV+  C+ +   L+E GTMG +G VQVI+   T  Y     P  ++ P CT+++ P+   HC+ WA+  F   F +
Sbjct:  413 IADLKLFMVGCGAIGCEFLKNFALLGIASGNNGLISITDNDLIEKSNLNRQFLFRPHHIQKAKSTTSATSTKEINPSLHIEAHQQKVCPDTEQDTFNDAFFESQEVVVNALDNVEARRYVDSRCVSNQRALLETGTMGAKGHVQVIVPHLTESYTSQRDPVDQEVPYCTLKSFPAIIEHCIQWARDKFESSFTQ 606          

HSP 2 Score: 57.3806 bits (137), Expect = 1.321e-8
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKS--KALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVL 321
            M  +A ++V + G GG+G E+ KNL +   K IT+ D     +++L  QF  R+++V  S  +A+ +   V + NP V++    D +  N  N D  K +  V+
Sbjct:    7 MQKMAHASVFLSGVGGLGVEIAKNLTLAGIKSITLHDTRAASMADLGSQFFLREDDVTSSRNRAVASAGRVAELNPYVSVHTQTDALDEN--NLDVLKNYQCVI 108          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Nematostella
Match: EDO48528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ71])

HSP 1 Score: 89.3521 bits (220), Expect = 4.583e-19
Identity = 50/154 (32.47%), Postives = 80/154 (51.95%), Query Frame = 1
Query:   22 NIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNA-DFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYEC-YPKP 477
            ++  S+VLVVGAGG+GC     L       + ++D D +D SNL+RQ L  ++ V   K  +AK+++L+ N +         +  N  NA D    +D++++A DN A R  +N  C+ +  PL+ G  +   GQ+ V       CY C +P P
Sbjct:   43 SLKSSSVLVVGAGGLGCPAALYLAAAGIGCLGLVDYDVVDTSNLHRQVLHTEDRVEVPKVESAKQTLLRLNSDAQYNT--HCLQLNSVNALDIINKYDVIVDATDNVATRYLLNDACVLAKKPLVSGSALRLEGQLVVYNHDNGPCYRCLFPTP 194          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Medaka
Match: uba2 (ubiquitin like modifier activating enzyme 2 [Source:NCBI gene;Acc:101172730])

HSP 1 Score: 465.307 bits (1196), Expect = 1.039e-156
Identity = 285/614 (46.42%), Postives = 373/614 (60.75%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELT----------NETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQL-SERMSQSDTA-LVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELT--LLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKND--YEILGDVEHVISSAVSDSDR-----NGNLNS--PPNSVDETADLND--------------SGTNVSGDRKRKHED 1749
            D++    VLVVGAGGIGCELLKNLV+  FK I VIDLDTIDVSNLNRQFLF+K++VGKSKA  AKESVL+F P+ NI A HD +M+  YN +FF+ F +V+NALDN+AARN+VNRMCL +++PLIE GT GY GQV VI KG T CYEC PKPAQK +P CTIRNTPSEPIHC+VWAK+LFNQLFGE DADQ+V PD  DPE            + + ++GD    VK      W  S  YD   L   LF D+I  LL+M  LW K  R  P  LD + +    +  S    +   G+KDQ+   +   CQ FK+S   L SE   + D A LVWDKDD  AMDFV +AAN+RM +F  + M +RF++KSMAGNIIPAIATTNA+IAG+ VL   KIL+G+ + C  + ++   + R K++       P K+CYVC+ K E+T  L  + T ++S   L+  IL+    M+AP+V I++    I+   ++   E    K L  F + NG+  +  DFLQ+Y  ++ +    EL+ D  +E++G+         S+ +      NGN +S  P  S    AD +D              S   V+   KRKH D
Sbjct:   14 DSLYTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLQFCPSANITAYHDSIMNPDYNVEFFRKFMLVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTVIKKGLTECYECQPKPAQKTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPEEAAARASASEKDGD----VKRVSTKEWARSTGYDPIKLFNKLFKDDIMYLLTMDKLWKK--RKAPTPLDWTQLE---NKASPEEESPASGLKDQQVLGVWGCCQLFKHSVETLRSELREKGDNAELVWDKDDPAAMDFVTSAANLRMHIFS-MNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGELESCRTIFLNKCPNVRKKLLVPCVLDPPSKNCYVCASKPEVTVKLNVQKTTVLS---LQDRILKERFGMVAPDVQIEDGKGTILISSEEGETEANNSKYLSDFGIRNGSRLQSDDFLQDYTLLINVLHTEELERDVEFEVVGEAPDKAPPPQSNPEEVNSITNGNKDSAQPSTSSKAPADEDDLMIVDSDEEEGAPSSSATVTSGTKRKHSD 614          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Medaka
Match: uba1 (ubiquitin like modifier activating enzyme 1 [Source:NCBI gene;Acc:101158523])

HSP 1 Score: 157.532 bits (397), Expect = 6.285e-40
Identity = 83/195 (42.56%), Postives = 114/195 (58.46%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFK----EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEP 582
            D +A+    +VGAG IGCELLKN  M        E+ V D+DTI+ SNLNRQFLFR  +V K K+ TA  +V + NP++ I    + V       Y+ DFF++ D V NALDN  AR Y++R C+    PL+E GT+G +G VQV++   T  Y     P +K  P CT++N P+   H + WA+  F  LF +P
Sbjct:  465 DLLARQRYFLVGAGAIGCELLKNFAMIGLASGEGEVIVTDMDTIEKSNLNRQFLFRPSDVTKMKSDTAAAAVKQMNPSIRITGHQNRVGPETERVYDDDFFESLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQP 659          

HSP 2 Score: 59.3066 bits (142), Expect = 1.051e-8
Identity = 35/137 (25.55%), Postives = 65/137 (47.45%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQV 426
            M  +  SNVL+ G  G+G E+ KN+++   + +TV D    +  +L+ QF  R+E++GK++A  ++  + + N  V + A      +     D+   F +V+        + +    C    I +I   T G  GQ+
Sbjct:   67 MKRMQNSNVLISGMRGLGVEVAKNVILGGVRSVTVHDQGVAEWRDLSSQFYLREEDLGKNRAEMSQLRLAELNNYVPVTA-----YTGALTEDYLTKFQVVVLTNSTLDEQKHFGDFCHSKGIKIIIADTRGLFGQL 198          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Medaka
Match: uba3 (NEDD8-activating enzyme E1 catalytic subunit [Source:NCBI gene;Acc:101162521])

HSP 1 Score: 150.984 bits (380), Expect = 1.959e-39
Identity = 87/213 (40.85%), Postives = 121/213 (56.81%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNV----NIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLK------------SNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLK+L +  F+ I V+D+DTIDVSNLNRQFLFR ++VG+ KA  A + +    P      + K I D       +  F++ F I++  LD+  AR ++N M L             S IPLI+GGT G++G  +VIL G TAC +C  +  P Q  +P CTI + P  P HC+ + + L  Q   E      V  D +DPE
Sbjct:   51 ILVIGAGGLGCELLKDLALTGFRNINVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAADFINSRVPGCCVVPHFKKIQD------LDETFYRQFHIIVCGLDSIVARRWMNGMLLSLLVYEDGVLDPGSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCIEYVRIL--QWPKELPFGDGVALDGDDPE 255          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Medaka
Match: uba3 (NEDD8-activating enzyme E1 catalytic subunit [Source:NCBI gene;Acc:101162521])

HSP 1 Score: 150.984 bits (380), Expect = 2.079e-39
Identity = 87/213 (40.85%), Postives = 121/213 (56.81%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNV----NIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLK------------SNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLK+L +  F+ I V+D+DTIDVSNLNRQFLFR ++VG+ KA  A + +    P      + K I D       +  F++ F I++  LD+  AR ++N M L             S IPLI+GGT G++G  +VIL G TAC +C  +  P Q  +P CTI + P  P HC+ + + L  Q   E      V  D +DPE
Sbjct:   60 ILVIGAGGLGCELLKDLALTGFRNINVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAADFINSRVPGCCVVPHFKKIQD------LDETFYRQFHIIVCGLDSIVARRWMNGMLLSLLVYEDGVLDPGSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCIEYVRIL--QWPKELPFGDGVALDGDDPE 264          
BLAST of SUMO-activating enzyme subunit vs. Ensembl Medaka
Match: uba3 (NEDD8-activating enzyme E1 catalytic subunit [Source:NCBI gene;Acc:101162521])

HSP 1 Score: 150.984 bits (380), Expect = 2.990e-39
Identity = 87/213 (40.85%), Postives = 121/213 (56.81%), Query Frame = 1
Query:   40 VLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNV----NIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLK------------SNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPE 624
            +LV+GAGG+GCELLK+L +  F+ I V+D+DTIDVSNLNRQFLFR ++VG+ KA  A + +    P      + K I D       +  F++ F I++  LD+  AR ++N M L             S IPLI+GGT G++G  +VIL G TAC +C  +  P Q  +P CTI + P  P HC+ + + L  Q   E      V  D +DPE
Sbjct:   71 ILVIGAGGLGCELLKDLALTGFRNINVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAADFINSRVPGCCVVPHFKKIQD------LDETFYRQFHIIVCGLDSIVARRWMNGMLLSLLVYEDGVLDPGSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCIEYVRIL--QWPKELPFGDGVALDGDDPE 275          
BLAST of SUMO-activating enzyme subunit vs. Planmine SMEST
Match: SMESG000047759.1 (SMESG000047759.1)

HSP 1 Score: 1162.9 bits (3007), Expect = 0.000e+0
Identity = 609/610 (99.84%), Postives = 610/610 (100.00%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTALVWDKXXXXXXXXXXXXXNIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVNIQNKSSVXXXXXXXXXXXVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKNDYEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRKHEDSMEHELKHKIAKMXXXXXXXXXXXXXXLIMVE 1845
            MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTALVWDKDDVVAMDFVAAAANIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNV+IQNKSSVIIDGDDDEIDEVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKNDYEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRKHEDSMEHELKHKIAKMDSQVDIDNEDDQDDLIMVE
Sbjct:    1 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQNDPELTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLLSMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRNWCQAFKNSANQLSERMSQSDTALVWDKDDVVAMDFVAAAANIRMSVFHILPMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMVSDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVAILENHLKMLAPNVSIQNKSSVIIDGDDDEIDEVYFEKTLDQFDVANGTVFRCSDFLQNYEFVLEIKVDSELKNDYEILGDVEHVISSAVSDSDRNGNLNSPPNSVDETADLNDSGTNVSGDRKRKHEDSMEHELKHKIAKMDSQVDIDNEDDQDDLIMVE 610          
BLAST of SUMO-activating enzyme subunit vs. Planmine SMEST
Match: SMESG000073442.1 (SMESG000073442.1)

HSP 1 Score: 270.781 bits (691), Expect = 3.496e-88
Identity = 133/149 (89.26%), Postives = 140/149 (93.96%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYE 462
            MDN+AKSNVLVV A GIGCELLKNLVM N KEI VIDLDTIDV NLNRQFLFRK+NVGKSKALTAKESVLKFNPNVN+KAI+DDVMSNKYNADFFKTFDIVL ALDNKAARNYV+RMCL+SN  LI+GGTMGYRGQVQVILKGKTACYE
Sbjct:    1 MDNVAKSNVLVVSAVGIGCELLKNLVMRNLKEIAVIDLDTIDVGNLNRQFLFRKKNVGKSKALTAKESVLKFNPNVNLKAINDDVMSNKYNADFFKTFDIVLKALDNKAARNYVSRMCLRSNNQLIKGGTMGYRGQVQVILKGKTACYE 149          
BLAST of SUMO-activating enzyme subunit vs. Planmine SMEST
Match: SMESG000004769.1 (SMESG000004769.1)

HSP 1 Score: 187.193 bits (474), Expect = 9.983e-57
Identity = 94/128 (73.44%), Postives = 98/128 (76.56%), Query Frame = 1
Query:  175 KENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFL 558
            +   GKSK LTAKE+VLKFN NVNIKAIHDD                   A++NKAARNYVNRMCLKSNI LIEGGTMGYRGQVQVILK KTACYECYPKP QKQ PACTIRNTPSEPIHC VWAKF 
Sbjct:    3 QRKCGKSKLLTAKETVLKFNTNVNIKAIHDD-------------------AMNNKAARNYVNRMCLKSNITLIEGGTMGYRGQVQVILKDKTACYECYPKPVQKQSPACTIRNTPSEPIHC-VWAKFF 110          
BLAST of SUMO-activating enzyme subunit vs. Planmine SMEST
Match: SMESG000000487.1 (SMESG000000487.1)

HSP 1 Score: 157.532 bits (397), Expect = 6.017e-42
Identity = 81/189 (42.86%), Postives = 113/189 (59.79%), Query Frame = 1
Query:   37 NVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVNRM-------------CLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPK--PAQKQYPACTIRNTPSEPIHCVVWAKFL 558
            ++LV+GAGG+GCELLK++ M  F  I VID DTID+SNLNRQFLFR  ++GK K++ A   ++   P+   K I        +++ F+K F +V+  LD+  AR ++N M              L S IPLI+GGT G++G  +VIL GKT C EC     P Q  YP CT+ NTP  P HC+ + + +
Sbjct:   42 SILVIGAGGLGCELLKDIAMMGFSNIEVIDADTIDLSNLNRQFLFRTHDIGKPKSIVAANYIMSRIPDC--KVIPHFAKIQDFDSSFYKKFHVVVCGLDSIVARRWINGMLASLVEYNDIGEPILSSIIPLIDGGTEGFKGNARVILFGKTPCIECTLDFYPPQINYPLCTLANTPRLPEHCIEYVRVI 228          
BLAST of SUMO-activating enzyme subunit vs. Planmine SMEST
Match: SMESG000081278.1 (SMESG000081278.1)

HSP 1 Score: 159.073 bits (401), Expect = 1.706e-40
Identity = 86/204 (42.16%), Postives = 117/204 (57.35%), Query Frame = 1
Query:   19 DNIAKSNVLVVGAGGIGCELLKNLVMWNFK-----------EITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDV---MSNKYNADFFKTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYECYPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDA 588
            + ++K  + +VGAG IGCELLKN VM               +I V D+D+I+ SNLNRQFLFR +++GK K+LTA E+    NP V I+A+   V     + +N  FF    +V NALDN  AR Y++R C+    PL+E GT+G +  VQV+L   T  Y     P +K  P CTI+N P    H + WA+ LF  LF +P A
Sbjct:  468 EKLSKLKIFLVGAGAIGCELLKNFVMMGVGASINDSDDDSGKIVVTDMDSIERSNLNRQFLFRSKDIGKMKSLTAAEAAKCMNPYVRIEALELKVGKETESYFNDAFFNDISVVANALDNVEARQYMDRRCVFYLKPLLESGTLGTKCNVQVVLPHLTESYSSSQDPPEKSIPVCTIKNFPYLIEHTIQWARDLFEGLFSQPAA 671          

HSP 2 Score: 62.3882 bits (150), Expect = 8.435e-10
Identity = 41/139 (29.50%), Postives = 74/139 (53.24%), Query Frame = 1
Query:   16 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDIVLNALDNKAARNYVN--RMCLKSNIPLIEGGTMGYRGQV 426
            M N++KSN+L+ G GG+G E+ KN+++   K +T+ D  +    +L+ Q+   + N+G+++A +  + + + N  VN+     +V +N    +    F+IV+  L N      +N    C  +NI LI   T G  GQ+
Sbjct:   60 MKNMSKSNILISGMGGLGVEIAKNVILAGVKSVTLHDELSATECSLSSQYYLNENNIGQNRATSCFKHLAELNSYVNV-----NVDTNPLTKEMLLNFNIVV--LTNIKQDEIINITGFCHLNNIKLIITRTFGLFGQI 191          
The following BLAST results are available for this feature:
BLAST of SUMO-activating enzyme subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBA29.015e-15347.13ubiquitin like modifier activating enzyme 2 [Sourc... [more]
UBA25.737e-11043.14ubiquitin like modifier activating enzyme 2 [Sourc... [more]
UBA24.982e-8651.09ubiquitin like modifier activating enzyme 2 [Sourc... [more]
UBA31.589e-4342.92ubiquitin like modifier activating enzyme 3 [Sourc... [more]
UBA31.872e-4342.92ubiquitin like modifier activating enzyme 3 [Sourc... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba-25.067e-12542.49SUMO-activating enzyme subunit uba-2 [Source:UniP... [more]
uba-11.828e-4042.55UBA (Human ubiquitin) related [Source:UniProtKB/T... [more]
uba-11.828e-4042.55UBA (Human ubiquitin) related [Source:UniProtKB/T... [more]
uba-11.965e-4042.55UBA (Human ubiquitin) related [Source:UniProtKB/T... [more]
uba-11.969e-4042.55UBA (Human ubiquitin) related [Source:UniProtKB/T... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uba26.779e-13542.41gene:FBgn0029113 transcript:FBtr0076734[more]
Uba33.618e-4041.33gene:FBgn0263697 transcript:FBtr0087585[more]
Uba16.756e-3942.71gene:FBgn0023143 transcript:FBtr0088499[more]
Uba18.007e-3942.71gene:FBgn0023143 transcript:FBtr0339517[more]
Uba48.689e-1930.20gene:FBgn0032054 transcript:FBtr0079683[more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba26.988e-15645.47ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
uba23.254e-15344.73ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
uba23.813e-15344.73ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
uba26.395e-6540.16ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
uba33.879e-4041.67ubiquitin-like modifier activating enzyme 3 [Sourc... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf41.714e-12846.81ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
arf43.572e-12746.15ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
arf44.610e-12645.93ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
arf41.082e-12545.76ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
arf43.619e-12545.54ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uba21.626e-15344.50ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
Uba27.474e-6367.72ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
Uba27.238e-4769.39ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
Uba31.114e-4343.66ubiquitin-like modifier activating enzyme 3 [Sourc... [more]
Uba31.300e-4343.66ubiquitin-like modifier activating enzyme 3 [Sourc... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1F9|SAE2_MOUSE1.137e-15244.50SUMO-activating enzyme subunit 2 OS=Mus musculus O... [more]
sp|Q7SXG4|SAE2_DANRE2.456e-15244.73SUMO-activating enzyme subunit 2 OS=Danio rerio OX... [more]
sp|Q9UBT2|SAE2_HUMAN4.329e-15247.13SUMO-activating enzyme subunit 2 OS=Homo sapiens O... [more]
sp|Q642Q1|SAE2A_XENLA2.591e-15045.07SUMO-activating enzyme subunit 2-A OS=Xenopus laev... [more]
sp|Q7ZY60|SAE2B_XENLA1.149e-14944.90SUMO-activating enzyme subunit 2-B OS=Xenopus laev... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NHS42.264e-15946.32SUMO-activating enzyme subunit OS=Pomacea canalicu... [more]
V4ATI18.381e-15950.46SUMO-activating enzyme subunit OS=Lottia gigantea ... [more]
A0A1Z5LEN32.043e-15649.91GE20372 (Fragment) OS=Ornithodoros moubata OX=6938... [more]
K1Q5G97.588e-15645.70SUMO-activating enzyme subunit OS=Crassostrea giga... [more]
A0A1S3J4Q21.726e-15549.46SUMO-activating enzyme subunit OS=Lingula unguis O... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba24.500e-15445.47ubiquitin like modifier activating enzyme 2 [Sourc... [more]
uba17.498e-4143.07ubiquitin like modifier activating enzyme 1 [Sourc... [more]
uba17.616e-4143.07ubiquitin like modifier activating enzyme 1 [Sourc... [more]
UBA31.308e-4041.31ubiquitin like modifier activating enzyme 3 [Sourc... [more]
UBA31.558e-4041.31ubiquitin like modifier activating enzyme 3 [Sourc... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba39.651e-4340.09ubiquitin-like modifier activating enzyme 3 [Sourc... [more]
sae11.105e-1128.68SUMO1 activating enzyme subunit 1 [Source:NCBI gen... [more]
mocs34.423e-1027.73molybdenum cofactor synthesis 3 [Source:NCBI gene;... [more]
uba51.083e-726.97ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
atg75.089e-731.65ATG7 autophagy related 7 homolog (S. cerevisiae) [... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBA22.088e-8236.59Subunit of heterodimeric nuclear SUMO activating e... [more]
UBA11.547e-3843.01Ubiquitin activating enzyme (E1); involved in ubiq... [more]
UBA35.374e-3439.89Protein that activates Rub1p (NEDD8) before neddyl... [more]
UBA46.084e-1933.11E1-like protein that activates Urm1p before urmyla... [more]
ATG71.161e-929.60Autophagy-related protein and dual specificity mem... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464545.769e-15745.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333327.206e-4331.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416211.380e-4140.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387752.695e-3537.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485284.583e-1932.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba21.039e-15646.42ubiquitin like modifier activating enzyme 2 [Sourc... [more]
uba16.285e-4042.56ubiquitin like modifier activating enzyme 1 [Sourc... [more]
uba31.959e-3940.85NEDD8-activating enzyme E1 catalytic subunit [Sour... [more]
uba32.079e-3940.85NEDD8-activating enzyme E1 catalytic subunit [Sour... [more]
uba32.990e-3940.85NEDD8-activating enzyme E1 catalytic subunit [Sour... [more]
back to top
BLAST of SUMO-activating enzyme subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047759.10.000e+099.84SMESG000047759.1[more]
SMESG000073442.13.496e-8889.26SMESG000073442.1[more]
SMESG000004769.19.983e-5773.44SMESG000004769.1[more]
SMESG000000487.16.017e-4242.86SMESG000000487.1[more]
SMESG000081278.11.706e-4042.16SMESG000081278.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002120 ID=SMED30002120|Name=SUMO-activating enzyme subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1855bp
ATTTTTTGAAGTAGAATGGATAATATTGCAAAAAGTAATGTGCTAGTTGT
GGGCGCTGGGGGTATTGGTTGTGAACTTTTAAAAAATCTAGTGATGTGGA
ATTTTAAAGAAATCACTGTGATTGATTTAGATACTATTGATGTTAGCAAT
CTTAATAGACAATTTCTATTCCGCAAGGAAAATGTAGGAAAATCGAAAGC
ATTGACTGCCAAAGAAAGTGTTTTGAAATTTAATCCTAATGTGAACATAA
AAGCAATCCACGATGATGTTATGAGTAATAAATATAATGCAGATTTTTTC
AAAACGTTTGACATTGTATTGAATGCATTAGACAACAAAGCTGCAAGAAA
TTATGTTAATAGAATGTGTTTAAAATCCAATATTCCATTAATAGAAGGTG
GTACAATGGGTTATAGAGGACAGGTTCAAGTCATTTTGAAAGGTAAAACG
GCTTGTTATGAATGCTATCCAAAACCTGCACAAAAGCAGTACCCAGCTTG
CACAATTAGAAATACGCCGTCTGAGCCAATTCATTGCGTGGTTTGGGCAA
AATTTTTGTTCAATCAATTATTCGGTGAACCCGATGCCGACCAAGATGTC
GTACCTGATCAAAACGACCCTGAATTAACTAATGAAACCACAGAAAACGG
AGACCAAACAGATCCTGTTAAACTAAACATCCGATTAGCATGGAAAGTTT
CTGATCAATATGATTCGAACTTATTACTGAAGATCTTATTTAACGATAAT
ATTCGCGATTTATTATCAATGAAGGCATTGTGGATGAAAAGTGAACGAGT
GAAACCGGAAGTTCTGGACAAATCTTTAATCAATGTGGATATTGACGATC
TCAGTCAGTTCATGTCAAATGTTACTGGAGGCGTGAAGGATCAAGAGAAA
TTCTCTCTGAGAAATTGGTGCCAAGCTTTCAAAAATTCAGCCAATCAATT
GTCAGAGAGGATGAGCCAATCCGATACTGCGTTGGTTTGGGATAAAGATG
ACGTCGTAGCCATGGATTTTGTTGCAGCAGCAGCCAATATTCGAATGAGT
GTATTCCATATATTGCCGATGTTAACACGGTTCGAAATAAAATCCATGGC
CGGGAATATTATCCCAGCCATAGCGACCACTAATGCTATGATTGCTGGAA
TATCTGTATTGCATGCCTATAAAATTTTAAATGGCCAAGCCGACAAATGT
TTAGATGTTATGGTTTCTGATTTTGTATCAGGACGTGGTAAAATCGTGCA
ATCCGTTCAACCACTTTCACCCGTTAAAGATTGTTACGTTTGTTCGAAAA
AATTAGAATTAACTCTCCTATGTAAAAGTACAAATCTTATTAGTCTAAAA
TTGCTGAAAGTAGCAATTTTGGAAAATCATCTCAAAATGTTGGCCCCTAA
CGTTAACATCCAAAACAAGTCCAGTGTTATTATTGATGGTGACGATGATG
AAATAGACGAGGTTTATTTCGAGAAAACCCTTGATCAATTCGATGTTGCG
AACGGAACTGTATTTAGATGTAGCGATTTCTTACAGAATTACGAATTCGT
TCTTGAGATTAAAGTCGATTCTGAATTGAAAAATGATTACGAAATTCTCG
GAGATGTGGAACATGTAATATCGTCTGCAGTTTCAGATTCAGATCGCAAC
GGAAATTTGAATAGTCCGCCCAATAGTGTAGATGAGACAGCAGATCTCAA
CGATTCAGGAACCAATGTTTCTGGCGATCGGAAAAGAAAGCACGAAGACT
CGATGGAGCATGAATTGAAGCATAAAATAGCTAAAATGGATTCCCAGGTC
GATATTGATAATGAAGACGATCAAGATGACCTTATAATGGTGGAATGATA
AAAGT
back to top

protein sequence of SMED30002120-orf-1

>SMED30002120-orf-1 ID=SMED30002120-orf-1|Name=SMED30002120-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQF
LFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFFKTFDI
VLNALDNKAARNYVNRMCLKSNIPLIEGGTMGYRGQVQVILKGKTACYEC
YPKPAQKQYPACTIRNTPSEPIHCVVWAKFLFNQLFGEPDADQDVVPDQN
DPELTNETTENGDQTDPVKLNIRLAWKVSDQYDSNLLLKILFNDNIRDLL
SMKALWMKSERVKPEVLDKSLINVDIDDLSQFMSNVTGGVKDQEKFSLRN
WCQAFKNSANQLSERMSQSDTALVWDKDDVVAMDFVAAAANIRMSVFHIL
PMLTRFEIKSMAGNIIPAIATTNAMIAGISVLHAYKILNGQADKCLDVMV
SDFVSGRGKIVQSVQPLSPVKDCYVCSKKLELTLLCKSTNLISLKLLKVA
ILENHLKMLAPNVNIQNKSSVIIDGDDDEIDEVYFEKTLDQFDVANGTVF
RCSDFLQNYEFVLEIKVDSELKNDYEILGDVEHVISSAVSDSDRNGNLNS
PPNSVDETADLNDSGTNVSGDRKRKHEDSMEHELKHKIAKMDSQVDIDNE
DDQDDLIMVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031510SUMO activating enzyme complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR023318Ub_act_enz_dom_a_sf
IPR035985Ubiquitin-activating_enz
IPR019572UBA_E1_Cys
IPR028077UAE_UbL_dom
IPR000594ThiF_NAD_FAD-bd
IPR016040NAD(P)-bd_dom
IPR030661Uba2
Vocabulary: molecular function
TermDefinition
GO:0008641small protein activating enzyme activity
GO:0019948SUMO activating enzyme activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016925protein sumoylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028077Ubiquitin/SUMO-activating enzyme ubiquitin-like domainPFAMPF14732UAE_UbLcoord: 439..520
e-value: 1.8E-11
score: 44.4
IPR000594THIF-type NAD/FAD binding foldPFAMPF00899ThiFcoord: 2..398
e-value: 1.4E-74
score: 250.5
IPR030661SUMO-activating enzyme subunit Uba2PIRSFPIRSF039133SUMO_E1Bcoord: 1..605
e-value: 2.7E-177
score: 588.8
IPR030661SUMO-activating enzyme subunit Uba2PANTHERPTHR10953:SF5SUMO-ACTIVATING ENZYME SUBUNIT 2coord: 2..523
IPR023318Ubiquitin activating enzyme, alpha domain superfamilyGENE3DG3DSA:1.10.10.520coord: 157..364
e-value: 1.5E-160
score: 536.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 7..426
e-value: 1.5E-160
score: 536.6
NoneNo IPR availableGENE3DG3DSA:3.10.290.20coord: 428..565
e-value: 7.6E-24
score: 86.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..610
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..566
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 567..596
NoneNo IPR availablePANTHERPTHR10953UBIQUITIN-ACTIVATING ENZYME E1coord: 2..523
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..19
score: 5.0
IPR035985Ubiquitin-activating enzymeSUPERFAMILYSSF69572Activating enzymes of the ubiquitin-like proteinscoord: 2..444