Immunoglobulin domain-containing-like protein isoform 1

Overview
NameImmunoglobulin domain-containing-like protein isoform 1
Smed IDSMED30002117
Length (bp)4286
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Immunoglobulin domain-containing-like protein isoform 1 (SMED30002117) t-SNE clustered cells

Violin plots show distribution of expression levels for Immunoglobulin domain-containing-like protein isoform 1 (SMED30002117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Immunoglobulin domain-containing-like protein isoform 1 (SMED30002117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Immunoglobulin domain-containing-like protein isoform 1 (SMED30002117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Human
Match: BOC (BOC cell adhesion associated, oncogene regulated [Source:HGNC Symbol;Acc:HGNC:17173])

HSP 1 Score: 62.003 bits (149), Expect = 8.302e-9
Identity = 77/349 (22.06%), Postives = 141/349 (40.40%), Query Frame = 2
Query:  611 HINKYSNYLSVNIT--LIVWHNLKNHPF-HIRIISNL--GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENK--------IFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
             +N   + L V IT   +V   L NH     + ++ +  G+  S P  + +  L +F+ D+   +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S  +  L V++              S A+ ++II       I + +G  L++ C+    P   V+W    S +      +F    L I   S +D+    CM +           ++ + V++   +    S++ +      KL    C +  N   + +  WL N V + + ++  +   +L +  +  +++G+YQC  E
Sbjct:   74 ELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHP---KAQVRYSVKQEWLEASRGNYLIMP------SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRR--------------STAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKL---TCEVRGNPPPSVL--WLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Human
Match: BOC (BOC cell adhesion associated, oncogene regulated [Source:HGNC Symbol;Acc:HGNC:17173])

HSP 1 Score: 62.003 bits (149), Expect = 8.370e-9
Identity = 77/349 (22.06%), Postives = 141/349 (40.40%), Query Frame = 2
Query:  611 HINKYSNYLSVNIT--LIVWHNLKNHPF-HIRIISNL--GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENK--------IFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
             +N   + L V IT   +V   L NH     + ++ +  G+  S P  + +  L +F+ D+   +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S  +  L V++              S A+ ++II       I + +G  L++ C+    P   V+W    S +      +F    L I   S +D+    CM +           ++ + V++   +    S++ +      KL    C +  N   + +  WL N V + + ++  +   +L +  +  +++G+YQC  E
Sbjct:   74 ELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHP---KAQVRYSVKQEWLEASRGNYLIMP------SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRR--------------STAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKL---TCEVRGNPPPSVL--WLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Human
Match: BOC (BOC cell adhesion associated, oncogene regulated [Source:HGNC Symbol;Acc:HGNC:17173])

HSP 1 Score: 62.003 bits (149), Expect = 8.370e-9
Identity = 77/349 (22.06%), Postives = 141/349 (40.40%), Query Frame = 2
Query:  611 HINKYSNYLSVNIT--LIVWHNLKNHPF-HIRIISNL--GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENK--------IFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
             +N   + L V IT   +V   L NH     + ++ +  G+  S P  + +  L +F+ D+   +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S  +  L V++              S A+ ++II       I + +G  L++ C+    P   V+W    S +      +F    L I   S +D+    CM +           ++ + V++   +    S++ +      KL    C +  N   + +  WL N V + + ++  +   +L +  +  +++G+YQC  E
Sbjct:   74 ELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHP---KAQVRYSVKQEWLEASRGNYLIMP------SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRR--------------STAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKL---TCEVRGNPPPSVL--WLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Human
Match: CDON (cell adhesion associated, oncogene regulated [Source:HGNC Symbol;Acc:HGNC:17104])

HSP 1 Score: 58.5362 bits (140), Expect = 8.946e-8
Identity = 66/306 (21.57%), Postives = 119/306 (38.89%), Query Frame = 2
Query:  707 NLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKI--------VEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNT-KLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELN--QQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPS---RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQC 1582
            ++G+ +S P  + +  L +F       +     +   I CR+P S P   K E              RYKI         E      +  L I N+  ED G YKC    P T +L+ E I    L+V +P ++  +  L  +HS A       + +   + + + C+    P  +V W     D+    N  + +  L   +    D+ + SCM         +V   + ++ + S    ++ +  +    +   C+++ N   N    W HN   I+   ++      L I  +T ++ G+YQC
Sbjct:   78 SIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIGCRVPESNP---KAEV-------------RYKIRGKWLEHSTENYLILPSGNLQILNVSLEDKGSYKCAAYNPVTHQLKVEPIGRK-LLVSRPSSD-DVHILHPTHSQA-------LAVLSRSPVTLECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVKYVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPN--CTWFHNAQPIHPSARHLTAGNGLKISGVTVEDVGMYQC 356          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Human
Match: CDON (cell adhesion associated, oncogene regulated [Source:HGNC Symbol;Acc:HGNC:17104])

HSP 1 Score: 58.5362 bits (140), Expect = 1.039e-7
Identity = 66/306 (21.57%), Postives = 119/306 (38.89%), Query Frame = 2
Query:  707 NLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKI--------VEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNT-KLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELN--QQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPS---RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQC 1582
            ++G+ +S P  + +  L +F       +     +   I CR+P S P   K E              RYKI         E      +  L I N+  ED G YKC    P T +L+ E I    L+V +P ++  +  L  +HS A       + +   + + + C+    P  +V W     D+    N  + +  L   +    D+ + SCM         +V   + ++ + S    ++ +  +    +   C+++ N   N    W HN   I+   ++      L I  +T ++ G+YQC
Sbjct:  102 SIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIGCRVPESNP---KAEV-------------RYKIRGKWLEHSTENYLILPSGNLQILNVSLEDKGSYKCAAYNPVTHQLKVEPIGRK-LLVSRPSSD-DVHILHPTHSQA-------LAVLSRSPVTLECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVKYVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPN--CTWFHNAQPIHPSARHLTAGNGLKISGVTVEDVGMYQC 380          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Zebrafish
Match: boc (BOC cell adhesion associated, oncogene regulated [Source:ZFIN;Acc:ZDB-GENE-030131-6560])

HSP 1 Score: 75.0998 bits (183), Expect = 5.806e-13
Identity = 73/320 (22.81%), Postives = 129/320 (40.31%), Query Frame = 2
Query:  668 NLKNHPFHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCM--NNENKIFRIHVYQKLRLIANPS-RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            NL    +     +++GS  S P  +   +L +FE D  +++E   GN A I C LP S+P   K +  +        ++   Y I+       +  L I N   +D G Y C    P T+  + S  T  L +++              S ++ ++II       I + +G  LV+ C+    P  +V+W     D++   N +F    L I  AS  D+    C+  N         V   +++   P  RVEL++ +     T+  +          + WLHN   +    ++ +    L +  +  ++ G+YQC  E
Sbjct:  103 NLTVGRYQCVATTSVGSCASVPANVTAAKLRDFEPDDQQEIEVDEGNTAVIECHLPESQP---KAQVRYSVKQEWLETSKGNYLIMP------SGNLQIANATRDDEGPYICAAYNPVTQEIKTSTSTDRLRIRR--------------STSEAARIIYPPASRSIMVNKGQRLVLECVASGIPTPQVTWAKDGLDLRNHNNTRFLLSNLLIDAASESDSGTYVCLADNGIGSTSSAQVLYDVQVFEPPQVRVELQQQDVAWGDTVRFSCQVRGKPAPTVVWLHNAQPLSPSPRHRVSAQVLRVLNVGPQDDGMYQCMAE 399          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Zebrafish
Match: cdon (cell adhesion associated, oncogene regulated [Source:ZFIN;Acc:ZDB-GENE-021115-4])

HSP 1 Score: 58.9214 bits (141), Expect = 5.610e-8
Identity = 64/298 (21.48%), Postives = 117/298 (39.26%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFG--TLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPS---RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQC 1582
            S  GS +S   ++ I  + EF +          G+ A I C LP S P  P +  F         ++  Y I+       +  L I ++  E  G YKC    P T+  +     T L+VK   ++ P++ +   +     S  +D    +   L + C+   +   +V W    +++     +      L +++    D    SC    ++   + V   + ++A+ S    +  + +     +   C  + N   N  I WL N   + +  + +I   SL I   T ++QGIYQC
Sbjct:  102 SETGSIISRHARVTIADIEEFAETHRRSFTVNKGDTAVIECPLPRSNP--PALPRFRIRGKWLEQSTDEYLILP------SGNLQIVSVSSEHQGMYKCGAYNPLTRETRVEAHGTKLLVKDSESSSPVRIV---YPITPRSLTVD----QSGSLTLECVVSGSLSSKVKWMKNGAELSLSSKRMLSHSNLVLNDIQPGDGGHYSCSVPTDRGAVVSVNYTVNVLAHVSILRGLSDQAAVAGSSVRFTCAASGNPTPN--ITWLLNAAPLSSSPRLKISGTSLLISSTTLQDQGIYQC 382          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Zebrafish
Match: cntn3a.2 (contactin 3a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-090312-57])

HSP 1 Score: 51.9878 bits (123), Expect = 7.160e-6
Identity = 38/159 (23.90%), Postives = 72/159 (45.28%), Query Frame = 2
Query: 1142 IKIPEGTLLVIYCIFESAPVEEVSWYWPKS---DMKYELNQQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPSRVELKKS---NFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKN 1600
            +   +G+++ + C     PV E++W    +     K ++      L I +   +D     C+  ENK+ +  V  +L   A P  V+  +    +  + L   C  N     +Y  +WL NG ++  + + +I+N +LTI  +   + G+YQC  E K+
Sbjct:  176 VPAAKGSVVTLECFALGNPVPEITWRRANAVPFPSKVKMKNSNVVLEIPSFQQEDAGGYECVA-ENKMGKNTVQGRLSFHAKPQWVQTMRDIALSIEERLFWECKANGKPKPSY--SWLKNGELLAAEDRIQIENGALTISSVNLSDAGMYQCVAENKH 331          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Zebrafish
Match: igsf10 (immunoglobulin superfamily, member 10 [Source:ZFIN;Acc:ZDB-GENE-130530-827])

HSP 1 Score: 51.9878 bits (123), Expect = 7.841e-6
Identity = 55/230 (23.91%), Postives = 91/230 (39.57%), Query Frame = 2
Query:  950 ALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQ--------FGTLTIHNASLQDNSDISCM-----NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINW-LHNGVII----YNDKQYEI-KNYSLTIKKLTTKNQGIYQC 1582
             LLI     +D G+Y C        + +    +  L+V       P + L        ++K+ D+KI  G  + + C  E  PV  VSW  P        N +         GTLTI   S+ D+    C+       +     + V   L +I    + +L K++  + L + C  +   D     +W LHNGVI+    Y+  +  +  N +L ++ L     G Y+C
Sbjct: 1491 TLLIHRTNIKDHGQYIC--------IAENDYGSDKLVVTLSVVAYPARIL--------ETKMRDLKILAGKTVHMACRTEGRPVPIVSWILPNHTEVKGPNGEHGRVKVSPMGTLTIQEVSVSDHGHYKCVASNPGGTDTATVHLQVVATLPVILE-EKQQLVKADAGQNLFLPCTTHG--DPQPTTHWVLHNGVIVLPLTYSHTKISVFANGTLYLRNLDVSESGKYEC 1701          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Zebrafish
Match: igsf10 (immunoglobulin superfamily, member 10 [Source:ZFIN;Acc:ZDB-GENE-130530-827])

HSP 1 Score: 51.9878 bits (123), Expect = 8.344e-6
Identity = 55/230 (23.91%), Postives = 91/230 (39.57%), Query Frame = 2
Query:  950 ALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQ--------FGTLTIHNASLQDNSDISCM-----NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINW-LHNGVII----YNDKQYEI-KNYSLTIKKLTTKNQGIYQC 1582
             LLI     +D G+Y C        + +    +  L+V       P + L        ++K+ D+KI  G  + + C  E  PV  VSW  P        N +         GTLTI   S+ D+    C+       +     + V   L +I    + +L K++  + L + C  +   D     +W LHNGVI+    Y+  +  +  N +L ++ L     G Y+C
Sbjct: 1579 TLLIHRTNIKDHGQYIC--------IAENDYGSDKLVVTLSVVAYPARIL--------ETKMRDLKILAGKTVHMACRTEGRPVPIVSWILPNHTEVKGPNGEHGRVKVSPMGTLTIQEVSVSDHGHYKCVASNPGGTDTATVHLQVVATLPVILE-EKQQLVKADAGQNLFLPCTTHG--DPQPTTHWVLHNGVIVLPLTYSHTKISVFANGTLYLRNLDVSESGKYEC 1789          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Xenopus
Match: pax7 (paired box 7 [Source:Xenbase;Acc:XB-GENE-487140])

HSP 1 Score: 61.2326 bits (147), Expect = 1.443e-8
Identity = 77/311 (24.76%), Postives = 124/311 (39.87%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIY------CIFESAP-VEEVSWY-WPKSDMKYELNQQFGT-LTIHNASLQDNSDISCM-NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIM------CNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWT 1588
            +++G+ LS P  + +  L++FE  I   V    G+   I C++P S P       +         +S +Y I+       +  L I N+  ED G Y+C    P T   + +  T  L V +              S   DS I+   I +  L+ I+      C+    P   +V WY   K    Y   +   T L I      D  + SC+ +N + +F+  V   L ++  PS   + + N ++ L +       C    N   N  I W HN V I+    ++I    L I  L  ++ GIYQC+ 
Sbjct:  102 TSVGAILSRPATVSVAYLNDFETTIGHSVTAEEGSSEFIGCKIPESNPK--AHVRYKVRGKWLKESSDKYLILP------SGNLHILNVSLEDRGTYRCAAYNPVTHELKPNPSTVKLSVNR--------------SPQVDSHILHPVIAQTVLVQIHDPLTLECVVGGVPNHSQVYWYKGGKEAEAYGRRKLLHTHLVIEQVQRSDAGNYSCVFDNGSGVFQ-RVNYTLTVLEPPS---ISQKNEDQSLIMGSNVRFSCESRGNPSPN--ITWFHNAVQIHPSAHHQISGNKLRITNLIAEDSGIYQCFA 384          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Xenopus
Match: pax7 (paired box 7 [Source:Xenbase;Acc:XB-GENE-487140])

HSP 1 Score: 60.4622 bits (145), Expect = 2.556e-8
Identity = 78/312 (25.00%), Postives = 125/312 (40.06%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIY------CIFESAP-VEEVSWY-WPKSDMKYELNQQFGT-LTIHNASLQDNSDISCM-NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIM------CNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWT 1588
            +++G+ LS P  + +  L++FE  I   V    G+   I C++P S P   K    +         +S +Y I+       +  L I N+  ED G Y+C    P T   + +  T  L V +              S   DS I+   I +  L+ I+      C+    P   +V WY   K    Y   +   T L I      D  + SC+ +N + +F+  V   L ++  PS   + + N ++ L +       C    N   N  I W HN V I+    ++I    L I  L  ++ GIYQC+ 
Sbjct:  102 TSVGAILSRPATVSVAYLNDFETTIGHSVTAEEGSSEFIGCKIPESNP---KAHVRYKVRGKWLKESSDKYLILP------SGNLHILNVSLEDRGTYRCAAYNPVTHELKPNPSTVKLSVNR--------------SPQVDSHILHPVIAQTVLVQIHDPLTLECVVGGVPNHSQVYWYKGGKEAEAYGRRKLLHTHLVIEQVQRSDAGNYSCVFDNGSGVFQ-RVNYTLTVLEPPS---ISQKNEDQSLIMGSNVRFSCESRGNPSPN--ITWFHNAVQIHPSAHHQISGNKLRITNLIAEDSGIYQCFA 384          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Xenopus
Match: pax7 (paired box 7 [Source:Xenbase;Acc:XB-GENE-487140])

HSP 1 Score: 60.077 bits (144), Expect = 3.396e-8
Identity = 78/312 (25.00%), Postives = 125/312 (40.06%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIY------CIFESAP-VEEVSWY-WPKSDMKYELNQQFGT-LTIHNASLQDNSDISCM-NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIM------CNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWT 1588
            +++G+ LS P  + +  L++FE  I   V    G+   I C++P S P   K    +         +S +Y I+       +  L I N+  ED G Y+C    P T   + +  T  L V +              S   DS I+   I +  L+ I+      C+    P   +V WY   K    Y   +   T L I      D  + SC+ +N + +F+  V   L ++  PS   + + N ++ L +       C    N   N  I W HN V I+    ++I    L I  L  ++ GIYQC+ 
Sbjct:  102 TSVGAILSRPATVSVAYLNDFETTIGHSVTAEEGSSEFIGCKIPESNP---KAHVRYKVRGKWLKESSDKYLILP------SGNLHILNVSLEDRGTYRCAAYNPVTHELKPNPSTVKLSVNR--------------SPQVDSHILHPVIAQTVLVQIHDPLTLECVVGGVPNHSQVYWYKGGKEAEAYGRRKLLHTHLVIEQVQRSDAGNYSCVFDNGSGVFQ-RVNYTLTVLEPPS---ISQKNEDQSLIMGSNVRFSCESRGNPSPN--ITWFHNAVQIHPSAHHQISGNKLRITNLIAEDSGIYQCFA 384          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Xenopus
Match: pax7 (paired box 7 [Source:Xenbase;Acc:XB-GENE-487140])

HSP 1 Score: 59.6918 bits (143), Expect = 4.535e-8
Identity = 78/312 (25.00%), Postives = 125/312 (40.06%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIY------CIFESAP-VEEVSWY-WPKSDMKYELNQQFGT-LTIHNASLQDNSDISCM-NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIM------CNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWT 1588
            +++G+ LS P  + +  L++FE  I   V    G+   I C++P S P   K    +         +S +Y I+       +  L I N+  ED G Y+C    P T   + +  T  L V +              S   DS I+   I +  L+ I+      C+    P   +V WY   K    Y   +   T L I      D  + SC+ +N + +F+  V   L ++  PS   + + N ++ L +       C    N   N  I W HN V I+    ++I    L I  L  ++ GIYQC+ 
Sbjct:  102 TSVGAILSRPATVSVAYLNDFETTIGHSVTAEEGSSEFIGCKIPESNP---KAHVRYKVRGKWLKESSDKYLILP------SGNLHILNVSLEDRGTYRCAAYNPVTHELKPNPSTVKLSVNR--------------SPQVDSHILHPVIAQTVLVQIHDPLTLECVVGGVPNHSQVYWYKGGKEAEAYGRRKLLHTHLVIEQVQRSDAGNYSCVFDNGSGVFQ-RVNYTLTVLEPPS---ISQKNEDQSLIMGSNVRFSCESRGNPSPN--ITWFHNAVQIHPSAHHQISGNKLRITNLIAEDSGIYQCFA 384          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Xenopus
Match: fkbp15 (FKBP prolyl isomerase 15 [Source:Xenbase;Acc:XB-GENE-6035907])

HSP 1 Score: 58.151 bits (139), Expect = 1.110e-7
Identity = 61/293 (20.82%), Postives = 118/293 (40.27%), Query Frame = 2
Query:  755 LSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCM--NNENKIFRIHVYQKLRLIANPS-RVELKKS--NFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            L++F+ D    +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S+ +  L V++              S A+ ++II       I + +G  L++ C+    P   ++W    +++      +F    L I   S +D+   +C   N   +     ++  +++   P   +EL +    + +     C +  N   + +  WL N   +    ++++    L +  +  ++ G+YQC  E
Sbjct:    3 LTDFKSDAQHVIEVDEGNTAVIACNLPESHP---KAQVRYSVKQEWLETSRDNYLIMP------SGNLQIVNATQEDEGTYKCAAYNPVTQEVKTSVSSDRLRVRR--------------STAEAARIIYPPNAQTIIVTKGQSLILECVASGMPPPRITWAKDGAEVSGHNKTRFLLSNLLIDATSEEDSGTYTCTAGNGIGEGGSTFIFYNVQVFEPPEVSMELSQPIVTWGQSAKFTCEIKGNPQPSVI--WLRNATPLIPSAKHKMSRKVLRVINVGPEDGGVYQCMAE 270          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Mouse
Match: Boc (biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein [Source:MGI Symbol;Acc:MGI:2151153])

HSP 1 Score: 62.3882 bits (150), Expect = 4.725e-9
Identity = 76/349 (21.78%), Postives = 140/349 (40.11%), Query Frame = 2
Query:  611 HINKYSNYLSVNIT--LIVWHNLKNHPF-HIRIISNL--GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENK--------IFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
             +N   + L V IT   +V   L NH     + ++ +  G+  S P  + +  L +F+ D+   +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S     L V++              S A+ ++II       + + +G  L++ C+    P   V+W    S +      +F    L I   S +D+    CM +           ++ + V++   +    S++ +      KL    C +  N   + +  WL N V + + ++  +   +L +  +  +++G+YQC  E
Sbjct:   69 ELNGSDDALGVFITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHP---KAQVRYSVKQEWLEASRDNYLIMP------SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSGDRLRVRR--------------STAEAARIIYPLEAQTVIVTKGQSLILECVASGIPPPRVTWAKDGSSIAAYNKTRFLLSNLLIDTTSEEDSGTYRCMASNGVGDPGAAVILYNVQVFEPPEVTVELSQLVIPWGQSAKL---TCEVRGNPPPSVL--WLRNAVPLTSSQRLRLSRRALRVVSVGPEDEGVYQCMAE 389          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Mouse
Match: Dscam (DS cell adhesion molecule [Source:MGI Symbol;Acc:MGI:1196281])

HSP 1 Score: 60.077 bits (144), Expect = 2.769e-8
Identity = 64/271 (23.62%), Postives = 105/271 (38.75%), Query Frame = 2
Query:  944 TVALLIRNLMEEDS-GKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF----GTLTIHNASLQDNSDISC-----MNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKN---YSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFFPKKNVKEIHSMRILYIDPDRPVDLRCEV 1717
            T AL I+++  ED    Y+C      T   ++S  +  L V  P  + P       H  A   + +++           C     P  E  + W K +M  EL+ +F      L I N+   D+    C           I R++V Q L+   +P +V   KS+    +++ C++  NED+   ++W  NG I+   K   I      +L +  +   + G YQC+         D V +       K I +     + P  PV L C V
Sbjct:  178 TGALYIKDVQNEDGLYNYRCITRHRYTGETRQS-NSARLFVSDPANSAPSILDGFDHRKAMAGQRVELP----------CKALGHP--EPDYRWLKDNMPLELSGRFQKTVTGLLIENSRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKV---KSSVGSQVSLSCSVTGNEDQE--LSWYRNGEILNPGKNVRITGLNHANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSLVCNV 430          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Mouse
Match: Cntn3 (contactin 3 [Source:MGI Symbol;Acc:MGI:99534])

HSP 1 Score: 55.8398 bits (133), Expect = 4.777e-7
Identity = 75/336 (22.32%), Postives = 126/336 (37.50%), Query Frame = 2
Query:  665 HNLKNHPFHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQ----------TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPE------GTLLVIYCIFESAPVEEVSWYWPKSDM-----KYELNQQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPSRVELKKS---NFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKN 1600
             N     +     ++LG+ +S   K+Q   L  F+  +   V    G    +LC      P P   E  +            +   E+P F +          T  L I  +   D G Y C V+         S  T T ++  P    P+  L S     +    I+++ PE      G+ + + C     PV +++W   +SD      K +L +  G L I N   +D     C+  EN   +     +L   A P  ++L +         L   C  +     +Y   WL NG  +  +++ +I+N +LTI  L   + G++QC  E K+
Sbjct:   91 RNWDTGSYQCFATNSLGTIVSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLC-----GPPPHSGELSYA-----------WVFNEYPSFVEEDSRRFVSQETGHLYIAKVEPSDVGNYTCVVT---------STVTNTRVLGSP---TPL-VLRSDGVMGEYEPKIEVQFPETLPAAKGSTVRLECFALGNPVPQINWR--RSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIA-ENSRGKNVARGRLTYYAKPYWLQLLRDVEIAVEDSLYWECRASGKPKPSY--RWLKNGDALVLEERIQIENGALTITNLNVTDSGMFQCIAENKH 392          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Mouse
Match: Cntn3 (contactin 3 [Source:MGI Symbol;Acc:MGI:99534])

HSP 1 Score: 55.8398 bits (133), Expect = 4.777e-7
Identity = 75/336 (22.32%), Postives = 126/336 (37.50%), Query Frame = 2
Query:  665 HNLKNHPFHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQ----------TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPE------GTLLVIYCIFESAPVEEVSWYWPKSDM-----KYELNQQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPSRVELKKS---NFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKN 1600
             N     +     ++LG+ +S   K+Q   L  F+  +   V    G    +LC      P P   E  +            +   E+P F +          T  L I  +   D G Y C V+         S  T T ++  P    P+  L S     +    I+++ PE      G+ + + C     PV +++W   +SD      K +L +  G L I N   +D     C+  EN   +     +L   A P  ++L +         L   C  +     +Y   WL NG  +  +++ +I+N +LTI  L   + G++QC  E K+
Sbjct:   91 RNWDTGSYQCFATNSLGTIVSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLC-----GPPPHSGELSYA-----------WVFNEYPSFVEEDSRRFVSQETGHLYIAKVEPSDVGNYTCVVT---------STVTNTRVLGSP---TPL-VLRSDGVMGEYEPKIEVQFPETLPAAKGSTVRLECFALGNPVPQINWR--RSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIA-ENSRGKNVARGRLTYYAKPYWLQLLRDVEIAVEDSLYWECRASGKPKPSY--RWLKNGDALVLEERIQIENGALTITNLNVTDSGMFQCIAENKH 392          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Mouse
Match: Cdon (cell adhesion molecule-related/down-regulated by oncogenes [Source:MGI Symbol;Acc:MGI:1926387])

HSP 1 Score: 53.9138 bits (128), Expect = 1.390e-6
Identity = 61/299 (20.40%), Postives = 116/299 (38.80%), Query Frame = 2
Query:  707 NLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQ----DNSDISCMNNENKIFRIHVYQKLRLIANPS---RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQC 1582
            ++G+ +S P  +    L +F+      +     N   I CR+P S P   K E  +      + +S+   I+       +  L + N+  +D G YKC    P T   +       L+V +P +N     L  + S A       + +   + + + C+    P  +V  YW K          +  L  H A+      D+ + SC+         HV   + ++ + S    +  +K +    +   C+++ N   N    W HN   I+   ++  +   L I ++  ++ G+YQC
Sbjct:  101 SVGAVVSGPATVSAAALGDFDSSTMHVITAEEKNTGFIGCRVPESNP---KAEVRYKIRGKWLKHSTGNYII-----LPSGNLQVLNVSSKDKGSYKCAAYNPVTSELKVEPTGRKLLVSRPSSNG-FHILHPALSQA-------LAVLPHSPVTLECVVSGVPASQV--YWLKDGQDAVAGSNWRRLYSHLATASIDPADSGNYSCVVGNKSGDVKHVTYMVNVLEHASISKGLHDQKVSLGATVHFTCDVHGNPAPNR--TWFHNAQPIHPSSRHLTEGNVLKITRVVMEDSGLYQC 379          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q90Z04|CDON_XENLA (Cell adhesion molecule-related/down-regulated by oncogenes OS=Xenopus laevis OX=8355 GN=cdon PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 9.446e-9
Identity = 76/313 (24.28%), Postives = 123/313 (39.30%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEE-VSWY-WPKSDMKYELNQQFGT-LTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPS---RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEV 1621
            +++G+ LS  + + +  L++FE      V    G+ A I C++P S P   K    +         +S +Y I+       +  L I N+  ED G Y+C    P T   + S  T  L V +    V  + L   H     + ++ I  P    L + C+    P    V WY   +    Y   +   T L I      D  + SC+          VY  + ++  PS   + E +       +   C    N   N  I W HN V I+   +++I    + I  L  ++ GIYQC+  + NE  S +V
Sbjct:  102 TSVGAILSKSVSVSVAYLNDFETTTGHSVTAEEGSSAFIGCKIPESNP---KAHVRYKVRGKWLKESSDKYLILP------SGNLHILNVSVEDRGTYRCAAYNPVTHDLKLSTSTLKLSVNR-SPRVDSRIL---HPVTSQAVLVQIHDP----LTLECVVGGGPSHPPVYWYKGGQEAAAYGRRKLLHTHLVIEQVQRSDAGNYSCVLGNGSGISQRVYYTVIVLEPPSVSQKTEDQSLTAGSNVRFSCESRGNPTPN--ITWFHNAVQIHASTRHQISGNKIRITSLFAQDSGIYQCF--VNNEAGSAQV 393          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q6AZB0|BOC_MOUSE (Brother of CDO OS=Mus musculus OX=10090 GN=Boc PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 3.277e-8
Identity = 76/349 (21.78%), Postives = 140/349 (40.11%), Query Frame = 2
Query:  611 HINKYSNYLSVNIT--LIVWHNLKNHPF-HIRIISNL--GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENK--------IFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
             +N   + L V IT   +V   L NH     + ++ +  G+  S P  + +  L +F+ D+   +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S     L V++              S A+ ++II       + + +G  L++ C+    P   V+W    S +      +F    L I   S +D+    CM +           ++ + V++   +    S++ +      KL    C +  N   + +  WL N V + + ++  +   +L +  +  +++G+YQC  E
Sbjct:   69 ELNGSDDALGVFITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHP---KAQVRYSVKQEWLEASRDNYLIMP------SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSGDRLRVRR--------------STAEAARIIYPLEAQTVIVTKGQSLILECVASGIPPPRVTWAKDGSSIAAYNKTRFLLSNLLIDTTSEEDSGTYRCMASNGVGDPGAAVILYNVQVFEPPEVTVELSQLVIPWGQSAKL---TCEVRGNPPPSVL--WLRNAVPLTSSQRLRLSRRALRVVSVGPEDEGVYQCMAE 389          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q9BWV1|BOC_HUMAN (Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 4.020e-8
Identity = 77/349 (22.06%), Postives = 141/349 (40.40%), Query Frame = 2
Query:  611 HINKYSNYLSVNIT--LIVWHNLKNHPF-HIRIISNL--GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENK--------IFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
             +N   + L V IT   +V   L NH     + ++ +  G+  S P  + +  L +F+ D+   +E   GN A I C LP S P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S  +  L V++              S A+ ++II       I + +G  L++ C+    P   V+W    S +      +F    L I   S +D+    CM +           ++ + V++   +    S++ +      KL    C +  N   + +  WL N V + + ++  +   +L +  +  +++G+YQC  E
Sbjct:   74 ELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHP---KAQVRYSVKQEWLEASRGNYLIMP------SGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRR--------------STAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKL---TCEVRGNPPPSVL--WLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q9ERC8|DSCAM_MOUSE (Down syndrome cell adhesion molecule homolog OS=Mus musculus OX=10090 GN=Dscam PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.937e-7
Identity = 64/271 (23.62%), Postives = 105/271 (38.75%), Query Frame = 2
Query:  944 TVALLIRNLMEEDS-GKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF----GTLTIHNASLQDNSDISC-----MNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKN---YSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFFPKKNVKEIHSMRILYIDPDRPVDLRCEV 1717
            T AL I+++  ED    Y+C      T   ++S  +  L V  P  + P       H  A   + +++           C     P  E  + W K +M  EL+ +F      L I N+   D+    C           I R++V Q L+   +P +V   KS+    +++ C++  NED+   ++W  NG I+   K   I      +L +  +   + G YQC+         D V +       K I +     + P  PV L C V
Sbjct:  178 TGALYIKDVQNEDGLYNYRCITRHRYTGETRQS-NSARLFVSDPANSAPSILDGFDHRKAMAGQRVELP----------CKALGHP--EPDYRWLKDNMPLELSGRFQKTVTGLLIENSRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKV---KSSVGSQVSLSCSVTGNEDQE--LSWYRNGEILNPGKNVRITGLNHANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSLVCNV 430          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q8VHZ8|DSCAM_RAT (Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus OX=10116 GN=Dscam PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.037e-7
Identity = 64/271 (23.62%), Postives = 105/271 (38.75%), Query Frame = 2
Query:  944 TVALLIRNLMEEDS-GKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF----GTLTIHNASLQDNSDISC-----MNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKN---YSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFFPKKNVKEIHSMRILYIDPDRPVDLRCEV 1717
            T AL I+++  ED    Y+C      T   ++S  +  L V  P  + P       H  A   + +++           C     P  E  + W K +M  EL+ +F      L I N+   D+    C           I R++V Q L+   +P +V   KS+    +++ C++  NED+   ++W  NG I+   K   I      +L +  +   + G YQC+         D V +       K I +     + P  PV L C V
Sbjct:  178 TGALYIKDVQNEDGLYNYRCITRHRYTGETRQS-NSARLFVSDPANSAPSILDGFDHRKAMAGQRVELP----------CKALGHP--EPDYRWLKDNMPLELSGRFQKTVTGLLIENSRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKV---KSSVGSQVSLSCSVTGNEDQE--LSWYRNGEILNPGKNVRITGLNHANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSLVCNV 430          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. TrEMBL
Match: A0A4Z2DKQ6 (Immunoglobulin domain-containing-like protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_000017 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.577e-30
Identity = 218/996 (21.89%), Postives = 395/996 (39.66%), Query Frame = 2
Query:  713 GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIV---------------EFPPFYQT---------VALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVP--IKF--------------------LTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQ---------DNSD-----------------------------------ISCMNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMIN-------WLHNGVIIYNDK---QYEIKNYSLTIKKLTTKNQGIYQCWTEIK----NEWLSDEVYIFFPKKNVKEIHSMRILYIDPDR------------PVDLRCEVPI-----------NYNVYNATSRWFRKFTGKEITN----SSLDFTKKY---DYESNIFILTVKNPLSLKNNQSFVCKIFYXXXXXXXXXX---------------XXXXXXXXXVNRQNQSPDPRET--------VKDSLF----SFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYRQGVLKLKPTEGKLLDPLIEWGNS---------TIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIY-----SSEMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATKLSSFHDERVELIITN----------LKANTQYLVAIYAILRPLTGMSMM-----YTALSDARIIDTSLAGKKSILTDSNNNSKNQT-----------VSNSNYFRNK------------------------ILFLVLGSLAGILFVIALFMFIMCLWYQIR 3025
            G+  S  I ++   L  F    ++ +  L+GN A ++C LP S+PS P + F+HN+  ++++   RY+++               + P F +            LLI +L   D+G+Y C VSL +  L   S + T L+V KP   +   +KF                    ++SS +    S + +IKI E T L ++CIFESAPV   SWY+       E+NQ+FG L I+ A L+         DNS                                    ++C NNE +   +     + L  +PSR E  K N NK++       +N+ +  +IN       W+HNG  I  ++    Y + +  L I K+T  + GIYQ     +    N  ++D       K +++  H   I  +  D+               L C +              YN Y  +  W+R  T  E  N    +      KY   +      IL++ NP  + ++  ++C+++     K L  +                        + +QN++  P+++        +K S+        +S+P + R  +F +A+++ W +  S I          HYQ+  +Q  L        L+ P  ++ +S         +I+   +  +S II +  + +PK+ Y  R + +                     ++ SPW++PVNF+N + +  +I ++ + N+    V WIY     SS  SD     +++F ++YR           G+ +E+ + L +  +   ++      V  +K++   D  +  II +          L  NT Y V+IY  +  ++          +T LS+  +  T      S + ++N+ ++N             + + +Y ++K                        +L ++LGSLAG+LF+I + +   C+WY++R
Sbjct:  189 GTITSHLIDMKPSILPAFPLHSDKYLSLLIGNTAAVVCHLPSSQPSLPTVYFYHNNIRLDLTQIDRYRLIYIGGDDSGLPWEIFTQKPHFKKANIKKHKPSAAILLIHSLQLSDTGQYYCSVSLFDKTL--SSNQRTHLVVTKPNEKIRTHLKFSSDDNDLTYLYTDETTNNSIISSSKNENTLSTMKEIKIYENTNLTLFCIFESAPVVSTSWYFEGFTDNIEINQKFGVLMINYARLENDGIYTCSVDNSHSKLIGKSFRVVVMRSPLTSSSNLKIITTEIGKQVTLNCNNNELQTTNVTNELNIPLPKSPSRDEWNKWNMNKMINNTKYPIENQYDKRIINYSSVTNQWIHNGQFITMNEVKNNYHLDDGILKILKVTKSHTGIYQYMKSNQVSDVNSIVNDNDESISCKFHIQLDHENTIHNVTNDQVNTIFEYTLEGLTGHLNCNLSTLLLTEEYQNTNGYNEYQWSILWYRSVTSNEPLNIESINKASGGIKYIISNVNEYTQILSIVNPKKVTDDGQYICRVYNTTTGKLLGEQRFQLIIESNNDDEMHKNKMKHELLIKKQNRNELPKKSNNNNEKLPLKQSIHHEKPQIKVSQPIIKRLANFTMAIHMKWIVYNSPIEKL-------HYQLGIKQ--LGQNRHIRSLIIPSNQYIHSENQSNLEQFSILPNIYENSSIIIDSRDLFQPKHTYCLRVLVLE-------------------HQLWSPWTEPVNFNNMLDTTLQIISLGVNNASCLYVEWIYIQSRNSSFTSDMTDIKDMKFMIIYRNLS--------GNPSERKSLLELWTELVLHNNEKEFPVDLSKVNKLGDLHIRQIIGDSSMKGHLIDGLPPNTTYAVSIYIEVTKMSQYQQQQQQKYFTRLSNEAVQRTLPNVISSSIDENNHITENPPKEKINKPEDLFIQSKSYLKSKMIKQIDNQDDLSSKLAITYQHESYVLIVILGSLAGVLFIIFIALITFCIWYRLR 1146          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. TrEMBL
Match: A0A068Y2A2 (Cell adhesion molecule:down regulated by OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000363400 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.449e-20
Identity = 99/335 (29.55%), Postives = 153/335 (45.67%), Query Frame = 2
Query:  659 VWHNLKNHPFHIRIISNLGSFLSPPIKIQIYQLSEFEDD---INEKV-EFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFL----TSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKS-DMKYELNQQFGTLTIHNASLQDNSDISCMNNENKI-FRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYN-DKQYEIKNYSLTIKKLTTKNQGIYQCWTEI------KNEWLS 1612
            VW  L     H R  +  GS LS P ++   +L E        N +V EF+ GN A + CR+P     PP ++F+   +   IS S +YK V   P    V LLI N    D G Y+C ++ P T+    S +   L V+ P   V ++ L    +  +S+A  S++I ++  EG  + ++CI E AP  EV  Y   + + +Y ++Q FG L + N    D     C      +   + V  +LRL  +P  V+L+ ++  KL    C+ + N  + +   WL NG  IY  D Q       L I  +   + G+YQC           +EW+S
Sbjct:  151 VWR-LGAMDVHCRATTQFGSVLSAPFRVVQTRLPEVSTPSGFTNTRVQEFISGNTAFVSCRIPPDSQPPPTVQFY--LNETVISYSQKYKQVRR-PNEDRVLLLINNFKTSDEGDYRCTLTNPMTRRTVWSPEIVRLQVRAPDKPVNVRVLLPLASQDNSSAAASRLIVVR--EGDNVTLFCIMEGAPPPEVQTYPHNTQNGRYIMDQDFGLLHLVNVQPSDEGVFLCSTAHLSLTATLKVKPRLRLTTSP--VDLRIASLGKLAEFRCSTSDNSVKPF---WLFNGNPIYTPDPQV------LVIGSVQESDLGLYQCIARTLTPDGRTDEWVS 468          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. TrEMBL
Match: A0A158RAF4 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9195 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.222e-18
Identity = 93/324 (28.70%), Postives = 152/324 (46.91%), Query Frame = 2
Query:  689 HIRIISNLGSFLSPPIKIQIYQLSEFEDDI---NEKV-EFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFL----TSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKS-DMKYELNQQFGTLTIHNASLQDNSDISCMNNENKI-FRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEI------KNEWLS 1612
            H R  +  GS LS P ++   +L E    +   N +V EF+ GN A + CR+P     PP ++F+   +   I +S +YK V  P   Q V LLI +    D G Y+C ++ P T     S +   L V+ P   V ++ L    T  +S+A  S++I ++  EG  + + CI E AP  EV  Y   + +++Y +++ FG L + N    D     C      +   + V  +LRL  +P  V+L+ ++ +K     C+ + N  + +   WL NG  IY     E+    L I+ +   + G+YQC           +EW+S
Sbjct:  175 HCRATTQFGSVLSAPFRVVQTRLPEVSTPLGFTNTRVQEFISGNTAFVSCRIPPGSQPPPTVQFY--LNDTLIRHSQKYKQVHRPNEDQ-VLLLINSFKTSDEGDYRCELTNPITGRTVRSPEIVRLQVRTPDKPVSVRVLLPLATQDNSSAAASRLIVVR--EGDNVTLLCIMEGAPPPEVRTYPHNTQNIRYIMDKDFGLLHLVNVQPSDEGVFLCSTAHMSLTATLKVKPRLRLTTSP--VDLRIASLDKQAEFRCSTSDNNVKPF---WLFNGNPIYTPNP-EV----LVIESVRKSDLGLYQCIARTLTPDGRTDEWVS 483          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. TrEMBL
Match: G7Y6X5 (Hemicentin-2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_101942 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.529e-18
Identity = 80/297 (26.94%), Postives = 132/297 (44.44%), Query Frame = 2
Query:  686 FHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFH-XXXXXXXXXXXRYKIV--------------------EFPPFYQ----TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADD----------------SKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE------NKIFRIHVYQKLRLIANP-SRVELKKSNFNKLLTIM 1432
             ++ + + LG+  + PI++   +L  F    +E++  L+GN  +++C LP S+PS P + F+H    +  ++ +SRY++V                      P F+Q     V L I  L   DSG+YKC   L    +  E  + T L V KP A V  +   S    ADD                S +  + +P G  L ++C+FE AP+    WY+  +   +  +  FG LTI +  L D    +C+         +K F+I V     L+  P S V+++K + N LL  +
Sbjct:    3 LYLLLSTELGTIRTRPIRLLPIELPRFPRYADERLSVLIGNTGRVICHLPRSQPSLPAVNFYHNGKQIDMLTEASRYRLVYVGGDGSGTPWSSGRSRGPRRDPLFWQQMPSAVILFIHPLELSDSGEYKCEAQLMEHLIMAE--QKTILNVTKPMAKVKARLQFS----ADDPGLSYLYDMYMSSQMVSGVRTLNVPVGLNLTLFCLFEGAPIVPTRWYYDGAHKNFREDSNFGILTIDSVELNDAGTYTCLAQSPESDAISKSFKIKVTTPTHLVPQPRSTVKVRKGS-NILLACL 292          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. TrEMBL
Match: A0A074ZMZ4 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13513 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.800e-18
Identity = 79/305 (25.90%), Postives = 132/305 (43.28%), Query Frame = 2
Query:  659 VWHNLKNHPFHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFH-XXXXXXXXXXXRYKIV--------------------EFPPFYQ----TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADD----------------SKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE------NKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIM 1432
            V++   N   ++ + + LG+  + PI++   +L  F    +E++  L+GN  +++C LP S+PS P + F+H    +  ++ +SRY++V                      P F+Q     V L I  L   DSG+Y+C   L    +  E  + T L V KP A V  +   S    ADD                S I  + +P G  L ++C+FE AP+    WY+  +   +  +  FG LTI +  L D    +C+         +K F+I V     L+  P+ +   +   N LL  +
Sbjct:  199 VYNLFPNMILYLLLSTELGTIRTRPIRLIPIELPRFPRYADERLSVLIGNTGRVICHLPRSQPSLPAVNFYHNGKQIDMLTEASRYRLVYVGGDGSGTPWSSGRSRGPRRDPLFWQQMPSAVILFIHPLELSDSGEYRCEAQLMEQVIMAE--QKTVLNVTKPLAKVKARLQFS----ADDPGLSYLYDIYMSSQMVSGIRTLNVPVGLNLTLFCLFEGAPIVPTRWYYDGAHKHFREDSNFGILTIDSVELNDAGTYTCLAQSPESDAISKSFKIKVTAPAHLVPQPNSIVKARKGSNILLACL 497          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Cavefish
Match: boc (BOC cell adhesion associated, oncogene regulated [Source:NCBI gene;Acc:103040321])

HSP 1 Score: 79.337 bits (194), Expect = 2.203e-14
Identity = 71/310 (22.90%), Postives = 130/310 (41.94%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCM--NNENKIFRIHVYQKLRLIANPS-RVELKKSN--FNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            ++ G+  S P  +   +L +FE D  +++E   GN A I C LP S+P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + S  T  L +++              S ++ ++II       + + +G  LV+ C+    P  +V+W     +++ + N +F    L I      D+   +C   N         V   +++I  P  RVEL++ +  +   +   C +  N     M  WLHN   +     + + + +L +  +  ++ G+YQC  E
Sbjct:  121 TSAGARASVPANVTAAKLRDFEPDDQQEIEVDEGNTAVIECHLPESQP---KAQVRYSVKQEWLETSKGNYLIMP------SGNLQIANATQEDEGPYKCAAYNPVTQEVKTSSSTDRLRIRR--------------STSEAARIIYPPASRSMTVRKGHRLVLECVASGTPTPQVTWAKNGHNLQPQNNTRFLLSNLLIDAVGESDSGTYACHAHNGMGSPGTATVLYDVQVIEAPKVRVELQQQDPVWGDTVKFTCQVQGNPTPTVM--WLHNAQPLSPSSHHRVSSQTLRVLNVGPQDDGVYQCMAE 405          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Cavefish
Match: cdon (cell adhesion associated, oncogene regulated [Source:ZFIN;Acc:ZDB-GENE-021115-4])

HSP 1 Score: 69.707 bits (169), Expect = 2.370e-11
Identity = 62/296 (20.95%), Postives = 111/296 (37.50%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPSRVELKKS-NFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQC 1582
            S  G+  S   ++ I  + EFE+     +    G  A I C LP S P  P +  +         ++  Y I+       +  L I ++  E  G YKC    P ++  +     T LIVK    + P+  +   +        + + + + T LV+ C+   +P     W     D++     Q     L +      D  + SC         + V   L ++ + S+    +S      +   C    N      I WL N   +      +I + +L+I  ++ ++QG+YQC
Sbjct:  105 SETGAVTSRQARVTIADIEEFEETHRRTLAVKAGGTAVIQCPLPQSNP--PALPRYRIRGKWIEESTGEYLILP------SGNLQIVSVSSEHQGMYKCGAYNPISRESRVEAHGTKLIVKDSDGSSPVGIIYPVNP-------VSLTVEQNTSLVLECVVSGSPAPVARWTKEGQDLQLSPRMQLLHSNLRLSEVRAGDGGNYSCTVQREDGEMVSVSYTLSVLGDVSKGPSDQSVPSGSSVRFTCASRGNPPPK--ITWLFNSSPVLPSSHVQISDSALSISSVSAQDQGVYQC 383          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Cavefish
Match: mxra5b (matrix-remodelling associated 5b [Source:ZFIN;Acc:ZDB-GENE-081104-119])

HSP 1 Score: 52.7582 bits (125), Expect = 3.918e-6
Identity = 58/250 (23.20%), Postives = 106/250 (42.40%), Query Frame = 2
Query:  953 LLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKS---DMKYELNQQF-----GTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLL---TIMCNLNQNEDENYMINW------LHNGVIIYNDKQYEIKNY------SLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFF 1633
            L +RN  E+DSG Y+C    P    ++       L+VKK F+    K  ++S    D        +  G  L + C    +P   + W  P     D  Y  + +      GTLTI + + +D  D  C+   NK+   +V  ++ ++   +R+E K+S+ +K+L    +  +   +   N  I W      + N V+  +D     + Y      +L   ++  + +G Y C+ E  N+   DE+ ++ 
Sbjct: 1742 LYLRNPTEKDSGTYECVAVNPVGADKRR----VNLLVKKNFSTS--KITSTSPQKTD--------VSYGDFLRLDCSALGSPEPRIIWRTPAKKLIDEHYSFDHRMKVFSNGTLTIKSVTDKDQGDYLCV-ARNKMGDDYVLLRVNVMMKAARIEQKQSSDHKVLYGGDLKVDCVASGLPNPEIRWSLPDGTMVNSVMQSDDSGVRRRRYVVFDNGTLYFNEVGMREEGDYTCYAE--NQIGKDEMKVYI 1974          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Sea Lamprey
Match: neo1b (neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320])

HSP 1 Score: 53.5286 bits (127), Expect = 3.480e-7
Identity = 58/283 (20.49%), Postives = 108/283 (38.16%), Query Frame = 2
Query:  953 LLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF-----GTLTIHNASLQDNSDISCM-NNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLT--IMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFF-------------PKKNVKEIHSMRILYIDPDRPVDLRCEVPINYNVY 1738
            LL++N    D GKY C++         +    + L    P        +   H        +D+ +  G    + C+    P   V W       +  L+++F     G + I N    D  D +C+   +N+  R+  Y KL ++  P R+     N N  ++  I+           +I+W  NG +I  D   +I + SL +  +   ++G+YQC  E + + +     +               P+     + S R + +    P + R  V ++Y+VY
Sbjct:   58 LLLQNASMADGGKYFCQLVFGGRTFTNQGTNLSVL----PEMESNRLCVVLRHP-------VDVSVRLGHTATLECVVAGFPAPSVHW---TRGTESVLSERFSVVAGGIMRIDNVQEDDAGDYTCIIKAQNETQRL--YAKLTVL-EPPRILHGPENRNASVSDDIILECQAEGRPRPVISWFQNGDLIIPDDFIQIVDGSLHVLGVMRSDEGVYQCMAESEVDGMQAAAQLVVINHAVPGILASSAPRGVTAVLVSTRFIRLSWRAPAESRGSV-LHYSVY 322          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Sea Lamprey
Match: nfasca (neurofascin homolog (chicken) a [Source:ZFIN;Acc:ZDB-GENE-080229-6])

HSP 1 Score: 50.0618 bits (118), Expect = 4.733e-6
Identity = 58/264 (21.97%), Postives = 101/264 (38.26%), Query Frame = 2
Query:  953 LLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANV---PIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELN----QQFGTLTIHNASLQDNSDISC-----MNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFFPKKNVKEIHSMRILYID-PDRPVDL 1705
            +++ NL E  S  Y+C           E+      I+   F NV   P + L  S  N   S +++  +       I C   ++P     WY P +     +N        TL +      D    +C     +N    + R+ +    R++  PS  EL+   F  + T  C+   +   +  I+W H+G  +    ++E++   LTI  +T ++ G Y+C    + +    E                R+  ID PD P+DL
Sbjct:  364 IILSNLPEGTSAVYQC-----------EATNKHGSILGNAFVNVLAVPPRIL--SPMNKVYSAVVNQTV------HIECKVFASPQPTFMWYVPNTQTCISINGFDSAASDTLVVPRVQKGDAGVYTCHVQNYLNKNQSLARLLIKDPTRIVQPPS--ELRAQRFG-VATFECHATHDPSLSLNISWFHDGYPLPESPRHELEGSGLTIVNVTEEDVGHYKCRASTELDHAEAEA---------------RLTVIDRPDSPMDL 590          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Nematostella
Match: EDO41500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4D5])

HSP 1 Score: 53.5286 bits (127), Expect = 6.377e-7
Identity = 101/437 (23.11%), Postives = 162/437 (37.07%), Query Frame = 2
Query:  713 GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKC------RVSLPNTK-------LQQESIKTTTLI--VKKPFANVPIKFLTSSHSNADDSKII--DIKIPEGTLLVIYCIFESAPVEEVSW---YWPKSDMKYELNQQFGT-LTIHNASLQDNSDISCMNNENKIFRIH-----------------------------VYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGV-IIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE--IKNEWLSDEVYI-------FFPKKNVKEI----HSMRILYIDPDRPVDLRCEVPINYNVYNATSRWFRKFTGKEITNS---SLDFTKKYDY 1822
            G+  S  + + I  LS   ++  + +    G  A+  C++  + P+P  I + HN  VI  S     + V  P      AL I N+ + D G Y+C      R+   NT        L Q  I  T  +  VK  +      F+ +  S   +   I  +  +  G   V+ CI    PV  V W           Y L +  G  L I +AS +D  +  C+ + +     H                             VY K     N  ++     +    LT+ C+          I WL NG  ++ N +Q  I N  L I+ L+TK+ G+YQC+ E  I +   S  V +        +P  NV  +      + I ++ P  P  +     INY   + +S+  +    K+ T+    SL    KY +
Sbjct:  107 GTVASRKVTLHIAVLSRKFEEQPQSINAWEGTTARFSCKVKKAYPAP-SISWEHNGQVIVPSK----RHVVLP----NGALQIHNVQQVDQGTYQCVASNIARIRRSNTATLTVQQVLWQGRIAPTAFLPKVKVIYLGTYCSFIKTKSSKQPNFTTIPSNTSVISGEEAVLECIATGVPVPTVQWKKVGGADRAYDYSLAKPGGCNLRIRSASPKDGGEYMCIVSASGRSMTHSTFLSVQGRLVDLDFFVVCNFRRVFFLPSVYSKPPHFINTPKLPKGLLDIGATLTLQCSATGVPPPR--ITWLKNGKELVGNQRQSGINN-DLVIQSLSTKDSGVYQCFAENDIGSVQTSTRVLVRRSGKLNTYPPLNVTGVGISSEEVNISWLPPRGPEQV-LAYSINYQPADKSSKELQVVLAKDFTSEVIRSLSGFTKYTF 530          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Medaka
Match: boc (BOC cell adhesion associated, oncogene regulated [Source:NCBI gene;Acc:101174631])

HSP 1 Score: 79.7221 bits (195), Expect = 1.950e-14
Identity = 74/316 (23.42%), Postives = 133/316 (42.09%), Query Frame = 2
Query:  704 SNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEF-FHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKII------DIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQF--GTLTIHNASLQDNSDISCMNNENKI---------FRIHVYQKLRLIANPSRVELKKSN--FNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            +  G+  S P  +   +L +FE D  +++E   GN A I C LP S+P   K +  +        ++   Y I+       +  L I N  +ED G YKC    P T+  + SI T  L +++              S ++ ++II       I + +G  LV+ C+    P  +V+W     D++   N  F    L I +A  + +S +      N I         + +HVY+  R+      VEL++    +   +   C+       + M  WLHN   +    ++ + +  L +  + ++++G+YQC  E
Sbjct:  113 TGAGALASVPANVTAAKLRDFEPDDQQEIEVDEGNTAVIECHLPESQP---KAQVRYSVKQEWLETSKGNYLIMP------SGNLQIANATQEDEGPYKCAAYNPITQEVKTSISTDRLRIRR--------------STSEAARIIYPPAQRSIMVTKGQRLVLECVASGIPTPQVTWTKDDHDLRSHNNTHFLLSNLLI-DAVDEGDSGVYICKAGNIINFDSPATVRYDVHVYEPPRVT-----VELQQQEVVYGSTVRFTCDARGKPTPSVM--WLHNARPLSPSLRHRLTSNKLRVSNVGSQDEGLYQCMVE 397          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Medaka
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:101171162])

HSP 1 Score: 53.5286 bits (127), Expect = 1.750e-6
Identity = 76/316 (24.05%), Postives = 119/316 (37.66%), Query Frame = 2
Query:  713 GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQ----------TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFAN-VPIKFLTSSHSNADDSKIIDIKIPEGTLLV-----IYCIFESAPVEEVSWYWPKSDM--KYELNQQFGTLTIHNASLQDNSDISC--MNNENKIFRIHVYQKLRLIANPSRVE---LKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            G+ +S    +Q   L  F  D    V    G  A +LC  P   P+  K+ F             R+   EFP F Q          T  L I  +   D G Y C             I ++  I K  F+N +P++ LT    N      + +K P+ T LV     + C     PV E+ W   +  +   ++L      L ++N  ++D+    C  +N++ K +       + + A P  VE    KK   +   T+ C  +   +    I WL NG        ++I    +  + LT  N G+YQC  E
Sbjct:  121 GTVISKEASVQFGYLDLFSTDERTTVYVKEGQGAVVLCAPPPHFPA--KLSF-------------RWIFNEFPTFIQLDNRRYVCQTTGNLYISKVESSDRGNYSC-------------IASSHSISKSVFSNYIPLQPLTE-RPNRKYPADLRVKFPDTTALVGQNVTLECFALGNPVPEIHWRKMEGHLPQNHDLRMSGSQLHLYNIQVKDSGIYKCEAINSKGKDYH---SANVFVEAYPEWVEHITSKKKELHSNYTMSCKASGKPEPK--IRWLKNG--------HQIDEKDVHFRNLTLDNSGMYQCIAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Medaka
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:101171162])

HSP 1 Score: 53.5286 bits (127), Expect = 2.037e-6
Identity = 76/316 (24.05%), Postives = 119/316 (37.66%), Query Frame = 2
Query:  713 GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQ----------TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFAN-VPIKFLTSSHSNADDSKIIDIKIPEGTLLV-----IYCIFESAPVEEVSWYWPKSDM--KYELNQQFGTLTIHNASLQDNSDISC--MNNENKIFRIHVYQKLRLIANPSRVE---LKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            G+ +S    +Q   L  F  D    V    G  A +LC  P   P+  K+ F             R+   EFP F Q          T  L I  +   D G Y C             I ++  I K  F+N +P++ LT    N      + +K P+ T LV     + C     PV E+ W   +  +   ++L      L ++N  ++D+    C  +N++ K +       + + A P  VE    KK   +   T+ C  +   +    I WL NG        ++I    +  + LT  N G+YQC  E
Sbjct:  108 GTVISKEASVQFGYLDLFSTDERTTVYVKEGQGAVVLCAPPPHFPA--KLSF-------------RWIFNEFPTFIQLDNRRYVCQTTGNLYISKVESSDRGNYSC-------------IASSHSISKSVFSNYIPLQPLTE-RPNRKYPADLRVKFPDTTALVGQNVTLECFALGNPVPEIHWRKMEGHLPQNHDLRMSGSQLHLYNIQVKDSGIYKCEAINSKGKDYH---SANVFVEAYPEWVEHITSKKKELHSNYTMSCKASGKPEPK--IRWLKNG--------HQIDEKDVHFRNLTLDNSGMYQCIAE 381          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Medaka
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:101171162])

HSP 1 Score: 53.5286 bits (127), Expect = 2.079e-6
Identity = 76/316 (24.05%), Postives = 119/316 (37.66%), Query Frame = 2
Query:  713 GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQ----------TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFAN-VPIKFLTSSHSNADDSKIIDIKIPEGTLLV-----IYCIFESAPVEEVSWYWPKSDM--KYELNQQFGTLTIHNASLQDNSDISC--MNNENKIFRIHVYQKLRLIANPSRVE---LKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            G+ +S    +Q   L  F  D    V    G  A +LC  P   P+  K+ F             R+   EFP F Q          T  L I  +   D G Y C             I ++  I K  F+N +P++ LT    N      + +K P+ T LV     + C     PV E+ W   +  +   ++L      L ++N  ++D+    C  +N++ K +       + + A P  VE    KK   +   T+ C  +   +    I WL NG        ++I    +  + LT  N G+YQC  E
Sbjct:  121 GTVISKEASVQFGYLDLFSTDERTTVYVKEGQGAVVLCAPPPHFPA--KLSF-------------RWIFNEFPTFIQLDNRRYVCQTTGNLYISKVESSDRGNYSC-------------IASSHSISKSVFSNYIPLQPLTE-RPNRKYPADLRVKFPDTTALVGQNVTLECFALGNPVPEIHWRKMEGHLPQNHDLRMSGSQLHLYNIQVKDSGIYKCEAINSKGKDYH---SANVFVEAYPEWVEHITSKKKELHSNYTMSCKASGKPEPK--IRWLKNG--------HQIDEKDVHFRNLTLDNSGMYQCIAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Medaka
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:101171162])

HSP 1 Score: 53.5286 bits (127), Expect = 2.079e-6
Identity = 76/316 (24.05%), Postives = 119/316 (37.66%), Query Frame = 2
Query:  713 GSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQ----------TVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFAN-VPIKFLTSSHSNADDSKIIDIKIPEGTLLV-----IYCIFESAPVEEVSWYWPKSDM--KYELNQQFGTLTIHNASLQDNSDISC--MNNENKIFRIHVYQKLRLIANPSRVE---LKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTE 1591
            G+ +S    +Q   L  F  D    V    G  A +LC  P   P+  K+ F             R+   EFP F Q          T  L I  +   D G Y C             I ++  I K  F+N +P++ LT    N      + +K P+ T LV     + C     PV E+ W   +  +   ++L      L ++N  ++D+    C  +N++ K +       + + A P  VE    KK   +   T+ C  +   +    I WL NG        ++I    +  + LT  N G+YQC  E
Sbjct:  121 GTVISKEASVQFGYLDLFSTDERTTVYVKEGQGAVVLCAPPPHFPA--KLSF-------------RWIFNEFPTFIQLDNRRYVCQTTGNLYISKVESSDRGNYSC-------------IASSHSISKSVFSNYIPLQPLTE-RPNRKYPADLRVKFPDTTALVGQNVTLECFALGNPVPEIHWRKMEGHLPQNHDLRMSGSQLHLYNIQVKDSGIYKCEAINSKGKDYH---SANVFVEAYPEWVEHITSKKKELHSNYTMSCKASGKPEPK--IRWLKNG--------HQIDEKDVHFRNLTLDNSGMYQCIAE 394          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Planmine SMEST
Match: SMESG000022938.1 (SMESG000022938.1)

HSP 1 Score: 2139.77 bits (5543), Expect = 0.000e+0
Identity = 1113/1120 (99.38%), Postives = 1118/1120 (99.82%), Query Frame = 2
Query:  800 MGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFFPKKNVKEIHSMRILYIDPDRPVDLRCEVPINYNVYNATSRWFRKFTGKEITNSSLDFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYXXXXXXXXXXXXXXXXXXXVNRQNQSPDPRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYRQGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSSEMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATKLSSFHDERVELIITNLKANTQYLVAIYAILRPLTGMSMMYTALSDARIIDTSLAGKKSILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWYQIRYHNKKRQNIXXXXXXXXXXXXXFAPIGTVNQISSNSVFVTSSNIVSPHGLSPWNKSNRFPSTSEFPHLYLAQHLSLWSPNHLAQFNLPNNIQDQIVDEMKIXXXXXXXXXXXXXXXXXXIDLEINNLDGSIEDSQEESVRLLDYQSHSSGFKRDDQCTLNNAFSVKSEGRDRQNDQDANSYNTRSISHYPFSPSALELYSHKKKTKVCSSNRKDLSNIKLHLKQPKLQNSNYFLPIRSRLSCFFPSAPSGESPPPCTPVISSLCKDNSLIQYNQMKKDETFAEHPFLMADNIKNGFITNYGNGSFKYHYSPSNNFANQKLPSKFIFDPIHDLQPHDDSRSNSTAASARQFLFSLYPDGVRPSINLDLDKQASNSQTNL 4159
            MGNVAQILCRLPISKPSPPKIEFFHNSSVINISNSSRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANP+RVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYI+FPKKNVKEIHSMRILYIDPDRPVDLRCEVPINYNVYNATSRWFRKFTGKEITN S DFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYKENKKFLLRKLEFRLLFNKVNRQNQSPDPRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYRQGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSSEMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATKLSSFHDERVELIITNLKANTQYLVAIYAILRPLTGMSMMYTALSDARIIDTSLAGKK+ILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWYQIRYHNKKRQNISS+SSVKTSSATTFAPIGTVNQIS+NSVFVTSSNIVSPHGLSPWNKSNRFPSTSEFPHLYLAQHLSLWSPNHLAQFNLPNNIQDQIVDEMKIKKPNTSPTTLSTPSPKSNIDLEINNLDGSIEDSQEESVRLLDYQSHSSGFKRDDQCTLNNAFSVKSEGRDRQNDQDANSYNTRSISHYPFSPSALELYSHKKKTKVCSSNRKDLSNIKLHLKQPKLQNSNYFLPIRSRLSCFFPSAPSGESPPPCTPVISSLCKDNSLIQYNQMKKDETFAEHPFLMADNIKNGFITNYGNGSFKYHYSPSNNFANQKLPSKFIFDPIHDLQPHDDSRSNSTAASARQFLFSLYPDGVRPSINLDLDKQASNSQTNL
Sbjct:    1 MGNVAQILCRLPISKPSPPKIEFFHNSSVINISNSSRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNENKIFRIHVYQKLRLIANPARVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIYFPKKNVKEIHSMRILYIDPDRPVDLRCEVPINYNVYNATSRWFRKFTGKEITNFSSDFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYKENKKFLLRKLEFRLLFNKVNRQNQSPDPRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYRQGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSSEMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATKLSSFHDERVELIITNLKANTQYLVAIYAILRPLTGMSMMYTALSDARIIDTSLAGKKAILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWYQIRYHNKKRQNISSTSSVKTSSATTFAPIGTVNQISNNSVFVTSSNIVSPHGLSPWNKSNRFPSTSEFPHLYLAQHLSLWSPNHLAQFNLPNNIQDQIVDEMKIKKPNTSPTTLSTPSPKSNIDLEINNLDGSIEDSQEESVRLLDYQSHSSGFKRDDQCTLNNAFSVKSEGRDRQNDQDANSYNTRSISHYPFSPSALELYSHKKKTKVCSSNRKDLSNIKLHLKQPKLQNSNYFLPIRSRLSCFFPSAPSGESPPPCTPVISSLCKDNSLIQYNQMKKDETFAEHPFLMADNIKNGFITNYGNGSFKYHYSPSNNFANQKLPSKFIFDPIHDLQPHDDSRSNSTAASARQFLFSLYPDGVRPSINLDLDKQASNSQTNL 1120          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Planmine SMEST
Match: SMESG000063656.1 (SMESG000063656.1)

HSP 1 Score: 281.182 bits (718), Expect = 2.134e-77
Identity = 250/815 (30.67%), Postives = 392/815 (48.10%), Query Frame = 2
Query:  686 FHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE--NKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNG-VIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEW--LSDEVYIFFPKKNVKEIHSMR--ILYID----PDRPVDLRCEVPINY--NVYNATSRWFRKFTGKEI----TNSSLDFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYXXXXXXXXXXXXXXXXXXXVNRQNQ----SPD-PRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYR-QGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSS-EMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATK-LSSFHDERVELI-----ITNLKANTQYLVAIYAILRPLTGM-SMMYTALSDARIIDTSLAGKKSILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWYQIRYHNK 3037
             HI   ++LG+  S P +I    L+ F    +E  EF+MGNV QI+C +P SKPSPP IEF H++  IN +  S+YK +  PP    + LLI+NL   DSG Y C  S   TK  Q S   T L V  P  ++  +F  SS+ N    + I I+  EG+ + +YC++ES P  EV+WY+P S  +YE + QFGTL+I+N  L D SD SC+ NE   + F++ V    R  ++P  +   KS   + + I C +  N   N  I W H+G ++   +   + +   L I+ L  K+ GIYQCW E  NEW   +  V +      ++E  S R  I  ID    P   + L C +  +   +  N T +W R     E+     N  + F KK +      IL++ NP    +   ++C+++ +  +     K +  +   K N  NQ    S D P +  +   F   +S+P  VR   +   V + WN    ++ D     +I+H+++E++ + V K++ T         EW    +ID   T     I +  ILRP     FR +     +++        L++  F  +RS WS+ + F+N +  +  ISN  +    S  V W ++    SD H    I F +LY             S+ + +   +  PD +  +     I    K L     ER ++      IT+L++  +Y++A+Y   + +T M  + Y  LS+  II  S +  K    D N  S   + S+S+  RN+++FL+LGSLAG+LFV+A  MF MC WY ++ H K
Sbjct:  124 LHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPP--GAMILLIKNLEPRDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKI-IEATEGSNITLYCLYESTPAAEVTWYYPNSK-RYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISF-KSYARQTVEIKCEV-LNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLE--NEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSE---GTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEH--FEPSVSRPEAVRINEYAFGVTIKWN----VLPDNKIVNVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILF--LKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAV-TPASVEVMWTHNCVRESDWHP---ITFDILYV------------SMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYG--KVITTMQDIFYIPLSN--IIKVSTSEDK----DENRISLEMS-SDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMK 894          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Planmine SMEST
Match: SMESG000063656.1 (SMESG000063656.1)

HSP 1 Score: 280.796 bits (717), Expect = 2.754e-77
Identity = 250/815 (30.67%), Postives = 392/815 (48.10%), Query Frame = 2
Query:  686 FHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE--NKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNG-VIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEW--LSDEVYIFFPKKNVKEIHSMR--ILYID----PDRPVDLRCEVPINY--NVYNATSRWFRKFTGKEI----TNSSLDFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYXXXXXXXXXXXXXXXXXXXVNRQNQ----SPD-PRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYR-QGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSS-EMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATK-LSSFHDERVELI-----ITNLKANTQYLVAIYAILRPLTGM-SMMYTALSDARIIDTSLAGKKSILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWYQIRYHNK 3037
             HI   ++LG+  S P +I    L+ F    +E  EF+MGNV QI+C +P SKPSPP IEF H++  IN +  S+YK +  PP    + LLI+NL   DSG Y C  S   TK  Q S   T L V  P  ++  +F  SS+ N    + I I+  EG+ + +YC++ES P  EV+WY+P S  +YE + QFGTL+I+N  L D SD SC+ NE   + F++ V    R  ++P  +   KS   + + I C +  N   N  I W H+G ++   +   + +   L I+ L  K+ GIYQCW E  NEW   +  V +      ++E  S R  I  ID    P   + L C +  +   +  N T +W R     E+     N  + F KK +      IL++ NP    +   ++C+++ +  +     K +  +   K N  NQ    S D P +  +   F   +S+P  VR   +   V + WN    ++ D     +I+H+++E++ + V K++ T         EW    +ID   T     I +  ILRP     FR +     +++        L++  F  +RS WS+ + F+N +  +  ISN  +    S  V W ++    SD H    I F +LY             S+ + +   +  PD +  +     I    K L     ER ++      IT+L++  +Y++A+Y   + +T M  + Y  LS+  II  S +  K    D N  S   + S+S+  RN+++FL+LGSLAG+LFV+A  MF MC WY ++ H K
Sbjct:  124 LHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPP--GAMILLIKNLEPRDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKI-IEATEGSNITLYCLYESTPAAEVTWYYPNSK-RYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISF-KSYARQTVEIKCEV-LNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLE--NEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSE---GTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEH--FEPSVSRPEAVRINEYAFGVTIKWN----VLPDNKIVNVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILF--LKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAV-TPASVEVMWTHNCVRESDWHP---ITFDILY------------VSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYG--KVITTMQDIFYIPLSN--IIKVSTSEDK----DENRISLEMS-SDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMK 894          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Planmine SMEST
Match: SMESG000063656.1 (SMESG000063656.1)

HSP 1 Score: 280.411 bits (716), Expect = 3.165e-77
Identity = 250/815 (30.67%), Postives = 392/815 (48.10%), Query Frame = 2
Query:  686 FHIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE--NKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNG-VIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEW--LSDEVYIFFPKKNVKEIHSMR--ILYID----PDRPVDLRCEVPINY--NVYNATSRWFRKFTGKEI----TNSSLDFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYXXXXXXXXXXXXXXXXXXXVNRQNQ----SPD-PRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYR-QGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSS-EMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATK-LSSFHDERVELI-----ITNLKANTQYLVAIYAILRPLTGMS-MMYTALSDARIIDTSLAGKKSILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWYQIRYHNK 3037
             HI   ++LG+  S P +I    L+ F    +E  EF+MGNV QI+C +P SKPSPP IEF H++  IN +  S+YK +  PP    + LLI+NL   DSG Y C  S   TK  Q S   T L V  P  ++  +F  SS+ N    + I I+  EG+ + +YC++ES P  EV+WY+P S  +YE + QFGTL+I+N  L D SD SC+ NE   + F++ V    R  ++P  +   KS   + + I C +  N   N  I W H+G ++   +   + +   L I+ L  K+ GIYQCW E  NEW   +  V +      ++E  S R  I  ID    P   + L C +  +   +  N T +W R     E+     N  + F KK +      IL++ NP    +   ++C+++ +  +     K +  +   K N  NQ    S D P +  +   F   +S+P  VR   +   V + WN    ++ D     +I+H+++E++ + V K++ T         EW    +ID   T     I +  ILRP     FR +     +++        L++  F  +RS WS+ + F+N +  +  ISN  +    S  V W ++    SD H    I F +LY             S+ + +   +  PD +  +     I    K L     ER ++      IT+L++  +Y++A+Y   + +T M  + Y  LS+  II  S +  K    D N  S   + S+S+  RN+++FL+LGSLAG+LFV+A  MF MC WY ++ H K
Sbjct:  113 LHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPP--GAMILLIKNLEPRDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKI-IEATEGSNITLYCLYESTPAAEVTWYYPNSK-RYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISF-KSYARQTVEIKCEV-LNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLE--NEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSE---GTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEH--FEPSVSRPEAVRINEYAFGVTIKWN----VLPDNKIVNVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILF--LKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAV-TPASVEVMWTHNCVRESDWHP---ITFDILYV------------SMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYG--KVITTMQDIFYIPLSN--IIKVSTSEDK----DENRISLEMS-SDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMK 883          
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.807e-14
Identity = 99/380 (26.05%), Postives = 156/380 (41.05%), Query Frame = 2
Query:  689 HIRIISNLGSFLSPPIKIQIYQLSEFEDDINEKV---EFLMGNVAQILCRLPISKPSPPKIEFFHXXXXXXXXXXXRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFA--NVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYW---PKS-DMKYELNQQFGTLTIHNASLQDNSDISCMNN---ENKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNGVII---YNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYIFFPKKNVKEIHSMRILYIDPDRPVDLRCEVPINYNVYNATSRWFRKFTGKEI 1783
            H    ++ G  LS P ++    +S F     EKV   EFL+GN+A + C  P S P   K +     +   I    +Y+IV++    + + LLI+N+   DSGKY+C      T    +S +   LI++ P    N  I    S  S    S  + I    G+ + ++CI   +P   +  Y    P S + +++ +  FG L I N    D     C +N      +F+  V + L +   P  +++   +F    T  C  N+    N    WL NG  I   YN    +I   SL       +  G+YQC  +  +EW+S    +           S R++   P  P     + PI  N+ N   + FR    K I
Sbjct:  119 HCLAGTDFGKILSRPFRVAHASMSNFGG--GEKVTKKEFLIGNIAYVDCIPPESHP---KADVKFIFNDQEIKEGGKYRIVQWSE-QRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRS----SGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFK--VIEPLSITETP--LDIVMDSFTGHATFSCKSNK---PNSSPTWLFNGRPITANYNSSTIQITEVSL-------RTLGLYQCIIQDLDEWVSAAATL--------STKSYRLISRPPLEPSS-NIKPPIQQNIDNE-GKIFRSVESKRI 464          
The following BLAST results are available for this feature:
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOC8.302e-922.06BOC cell adhesion associated, oncogene regulated [... [more]
BOC8.370e-922.06BOC cell adhesion associated, oncogene regulated [... [more]
BOC8.370e-922.06BOC cell adhesion associated, oncogene regulated [... [more]
CDON8.946e-821.57cell adhesion associated, oncogene regulated [Sour... [more]
CDON1.039e-721.57cell adhesion associated, oncogene regulated [Sour... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boc5.806e-1322.81BOC cell adhesion associated, oncogene regulated [... [more]
cdon5.610e-821.48cell adhesion associated, oncogene regulated [Sour... [more]
cntn3a.27.160e-623.90contactin 3a, tandem duplicate 2 [Source:ZFIN;Acc:... [more]
igsf107.841e-623.91immunoglobulin superfamily, member 10 [Source:ZFIN... [more]
igsf108.344e-623.91immunoglobulin superfamily, member 10 [Source:ZFIN... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax71.443e-824.76paired box 7 [Source:Xenbase;Acc:XB-GENE-487140][more]
pax72.556e-825.00paired box 7 [Source:Xenbase;Acc:XB-GENE-487140][more]
pax73.396e-825.00paired box 7 [Source:Xenbase;Acc:XB-GENE-487140][more]
pax74.535e-825.00paired box 7 [Source:Xenbase;Acc:XB-GENE-487140][more]
fkbp151.110e-720.82FKBP prolyl isomerase 15 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Boc4.725e-921.78biregional cell adhesion molecule-related/down-reg... [more]
Dscam2.769e-823.62DS cell adhesion molecule [Source:MGI Symbol;Acc:M... [more]
Cntn34.777e-722.32contactin 3 [Source:MGI Symbol;Acc:MGI:99534][more]
Cntn34.777e-722.32contactin 3 [Source:MGI Symbol;Acc:MGI:99534][more]
Cdon1.390e-620.40cell adhesion molecule-related/down-regulated by o... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90Z04|CDON_XENLA9.446e-924.28Cell adhesion molecule-related/down-regulated by o... [more]
sp|Q6AZB0|BOC_MOUSE3.277e-821.78Brother of CDO OS=Mus musculus OX=10090 GN=Boc PE=... [more]
sp|Q9BWV1|BOC_HUMAN4.020e-822.06Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1... [more]
sp|Q9ERC8|DSCAM_MOUSE1.937e-723.62Down syndrome cell adhesion molecule homolog OS=Mu... [more]
sp|Q8VHZ8|DSCAM_RAT2.037e-723.62Down syndrome cell adhesion molecule homolog OS=Ra... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DKQ63.577e-3021.89Immunoglobulin domain-containing-like protein isof... [more]
A0A068Y2A27.449e-2029.55Cell adhesion molecule:down regulated by OS=Echino... [more]
A0A158RAF41.222e-1828.70Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
G7Y6X52.529e-1826.94Hemicentin-2 (Fragment) OS=Clonorchis sinensis OX=... [more]
A0A074ZMZ42.800e-1825.90Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
boc2.203e-1422.90BOC cell adhesion associated, oncogene regulated [... [more]
cdon2.370e-1120.95cell adhesion associated, oncogene regulated [Sour... [more]
mxra5b3.918e-623.20matrix-remodelling associated 5b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
neo1b3.480e-720.49neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320][more]
nfasca4.733e-621.97neurofascin homolog (chicken) a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO415006.377e-723.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boc1.950e-1423.42BOC cell adhesion associated, oncogene regulated [... [more]
CNTN11.750e-624.05contactin 1 [Source:NCBI gene;Acc:101171162][more]
CNTN12.037e-624.05contactin 1 [Source:NCBI gene;Acc:101171162][more]
CNTN12.079e-624.05contactin 1 [Source:NCBI gene;Acc:101171162][more]
CNTN12.079e-624.05contactin 1 [Source:NCBI gene;Acc:101171162][more]
back to top
BLAST of Immunoglobulin domain-containing-like protein isoform 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022938.10.000e+099.38SMESG000022938.1[more]
SMESG000063656.12.134e-7730.67SMESG000063656.1[more]
SMESG000063656.12.754e-7730.67SMESG000063656.1[more]
SMESG000063656.13.165e-7730.67SMESG000063656.1[more]
SMESG000048961.12.807e-1426.05SMESG000048961.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002117 ID=SMED30002117|Name=Immunoglobulin domain-containing-like protein isoform 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4286bp
CTCAAATACATTATTGCGTACAATTTCACAGCATCGCCATTAGCTTCTGA
TATTTTAATTAATATGGAAGCAAAAAAATCAATATCTCAGAATTAATAAT
CAAAGATTTCACATTGCTCCTCTCTAAGCATCAGTGGCAAGTCACTGAAA
CTTCTTCAAAAAAAATTTCCTATGTTTAATAGAAACTCACATTTAGAAAT
TCATTGGAAAGGATTTTTTTTTAAATCAAAAATATGTCAAAATATTTTAA
TTGGAGAATTCAATAATTGAGTGACGAATGTTGTTTTGGAATCCTCTGAA
TTCCATTTTCAAAACAAAATTTTACGATCTATTCCTCATTCTGTTATTTG
TAGTATTCGGTGCTTGTTCAAATGATTTTCCTAAACTATTAAAATTTCCT
CACGATATTCTTTTCGCTTCCTCCGTTTATGAGACAATATCCTTTAATGT
TATAATGTCCCCATTCGATGTGAAGTTTTTACTGCTGGTCAGATTTCATA
AACCTTCACAGTCTTCAAAATACGAATTCCAAACACTGTACAATTCTTCC
AAAGACAATTCTGTTTTGCATTCACCGTCATTTTATGAATTGGCAATCAA
AGACACAACTCACATTAACAAATATAGCAATTATTTGTCAGTCAATATAA
CACTTATTGTATGGCATAATTTAAAGAATCATCCATTCCATATCAGAATC
ATTTCAAATTTAGGATCTTTTCTAAGTCCACCAATAAAAATTCAGATCTA
CCAACTCTCGGAATTCGAAGATGATATCAACGAAAAGGTTGAGTTCTTAA
TGGGAAATGTTGCACAAATTCTTTGTCGTCTTCCGATTTCCAAGCCCAGT
CCACCGAAAATTGAGTTTTTTCACAATTCCAGTGTAATTAATATCAGCAA
TTCTTCGCGATATAAAATAGTAGAATTTCCCCCTTTTTATCAGACTGTGG
CTTTATTAATTCGCAATTTAATGGAAGAAGATTCAGGAAAATACAAATGT
CGTGTATCTTTACCAAACACTAAACTTCAGCAGGAATCCATTAAAACTAC
CACTTTAATTGTTAAGAAGCCATTTGCCAACGTTCCAATAAAATTTCTTA
CTTCTTCTCATTCTAATGCAGATGATAGTAAAATTATAGACATTAAGATT
CCGGAAGGCACTCTTCTAGTGATTTACTGTATATTTGAGAGTGCTCCAGT
TGAAGAAGTCAGCTGGTATTGGCCTAAATCTGACATGAAATATGAACTAA
ATCAACAATTTGGTACGTTAACAATTCATAATGCCAGTTTACAGGACAAC
TCGGACATATCATGTATGAACAATGAAAATAAAATATTCAGAATTCATGT
TTATCAGAAATTAAGACTTATTGCCAATCCGTCAAGGGTGGAGCTTAAAA
AATCCAATTTCAATAAACTCCTAACTATTATGTGTAACCTTAATCAAAAT
GAAGATGAAAATTATATGATCAACTGGTTGCATAATGGTGTAATTATATA
TAATGATAAACAATATGAAATTAAAAATTATTCGTTAACAATCAAAAAAC
TGACAACCAAAAACCAAGGAATCTACCAATGTTGGACAGAAATAAAGAAC
GAATGGTTGTCTGATGAAGTTTACATATTTTTTCCCAAAAAGAATGTCAA
AGAGATCCACTCAATGAGGATATTATACATTGACCCCGACCGACCTGTGG
ACTTACGTTGTGAAGTTCCCATTAATTATAATGTTTACAATGCCACTAGT
AGATGGTTTAGGAAGTTTACCGGAAAGGAAATCACAAATTCCAGTTTGGA
TTTCACCAAGAAATATGATTACGAAAGCAATATATTTATTTTAACAGTGA
AAAATCCGTTATCATTGAAGAATAATCAAAGCTTTGTTTGCAAGATATTC
TACAAAGAAAATAAAAAATTTCTGTTAAGAAAGTTAGAATTCAGATTATT
ATTTAATAAAGTAAATCGACAAAATCAATCTCCAGATCCAAGGGAGACAG
TAAAAGATTCTTTATTTTCTTTTATATTATCCAAGCCGACTGTTGTGCGA
CCAATATCATTTCTATTGGCAGTTAATGTTTCTTGGAATATGCAGACAAG
CATCATCACAGACAAAAATCAGTCGAAAATCATCAATCACTACCAAATAG
AATATCGCCAAGGAGTTCTAAAATTGAAGCCAACAGAAGGGAAATTATTG
GACCCGTTGATTGAATGGGGTAACTCGACAATTATTGACAAATCATTCAC
TAAAACCAGCTGTATTATCTACAACTCTCAAATTCTGAGGCCAAAATATT
TGTACAGTTTCAGAGCTGTAGGCATTCCCAATTTTGAGATCGTGAAATTT
CATGAAAAGAAAAAATTCCTATCTAAAAATTTCTTTCAAGAAATTCGTAG
CCCTTGGTCAGATCCTGTCAATTTCGATAACTTCATGCAATCTCGACCGA
AGATATCTAATATAACTATTTTGAATTCTGAAAGTGCTGTAGTTTCTTGG
ATTTACAGTTCTGAAATGTCAGACAATCATGCAAAGAGCAACATTGAATT
TAAAGTTCTTTATCGAGAATTTATGTTGAAATATTCGATCAAAGGTTTCG
GGTCAATTAATGAACAAGTTACTGATTTACGAATTGATCCCGATTTTTAT
TATAATGATTTGACCGACAACAAAATAGTAACCGCAACGAAATTAAGTTC
GTTTCACGATGAAAGGGTTGAGCTGATTATTACCAACCTTAAAGCGAATA
CTCAATATTTAGTTGCCATTTATGCGATCCTTCGGCCCTTAACTGGCATG
TCAATGATGTATACTGCTTTGAGTGATGCTCGTATTATAGATACTTCTCT
CGCTGGAAAAAAATCCATTCTAACTGACAGCAATAATAATTCCAAGAATC
AAACGGTTTCCAATTCGAATTATTTCCGAAACAAAATCCTTTTTCTTGTT
CTCGGTTCATTAGCGGGAATTCTTTTTGTCATTGCTCTTTTCATGTTTAT
TATGTGTTTGTGGTATCAAATTCGCTATCACAATAAAAAGCGTCAAAATA
TAAGCTCGTCATCTTCAGTGAAAACATCCAGTGCAACCACTTTTGCTCCA
ATCGGAACAGTGAATCAGATTTCTAGTAATTCAGTTTTTGTTACGTCTTC
CAATATCGTCTCTCCACATGGATTATCCCCGTGGAACAAGTCTAATCGGT
TTCCCAGCACAAGCGAATTTCCACATCTGTATCTTGCGCAGCATTTAAGT
TTGTGGTCTCCAAATCACTTAGCTCAGTTCAACTTACCGAACAATATTCA
AGATCAAATTGTGGATGAGATGAAAATCAAAAAGCCAAATACTTCTCCGA
CAACTCTGTCGACACCATCGCCGAAATCTAATATAGATTTAGAAATAAAT
AATTTGGATGGTTCTATCGAAGATTCACAAGAGGAATCAGTCAGATTGCT
TGACTATCAATCTCACTCATCTGGCTTCAAAAGAGACGATCAGTGTACAT
TAAACAATGCATTTTCAGTAAAATCTGAAGGTAGAGATCGGCAGAATGAC
CAAGACGCTAATTCGTACAATACAAGATCTATTTCTCATTATCCATTTTC
TCCTAGTGCTTTGGAGCTCTATTCTCACAAAAAGAAAACAAAAGTTTGTT
CAAGCAACAGAAAAGATTTATCAAATATTAAATTGCATTTAAAGCAACCT
AAATTACAAAATTCCAATTACTTTCTTCCGATTCGTTCAAGATTATCATG
TTTTTTCCCATCAGCTCCTTCTGGAGAATCTCCTCCTCCGTGTACTCCAG
TCATTTCATCGCTATGCAAAGATAACTCCTTAATCCAATACAATCAAATG
AAAAAGGATGAAACGTTTGCTGAACATCCGTTCCTGATGGCAGACAATAT
TAAAAACGGTTTCATAACCAATTACGGCAACGGCTCGTTCAAATATCATT
ATTCTCCATCCAATAACTTTGCAAATCAAAAATTGCCATCGAAATTCATT
TTTGATCCGATCCACGATCTCCAGCCACACGATGATTCTCGTAGCAACAG
TACAGCTGCGTCCGCTCGCCAATTTTTGTTTTCATTATATCCTGATGGGG
TGCGACCATCTATAAACCTCGACTTAGACAAGCAAGCATCAAATAGTCAA
ACTAATTTATAATTTATCAAATCATTTCCTTAAATCTTTCAAATTGCTTT
TTTCTTTGGAATCAAAGGAAAAAGAAATTGTTAAAAATAAGTGATAAATA
TTTTTGCTTTCAAAACTCTATTATTAAATCTTTTCC
back to top

protein sequence of SMED30002117-orf-1

>SMED30002117-orf-1 ID=SMED30002117-orf-1|Name=SMED30002117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1295bp
MLFWNPLNSIFKTKFYDLFLILLFVVFGACSNDFPKLLKFPHDILFASSV
YETISFNVIMSPFDVKFLLLVRFHKPSQSSKYEFQTLYNSSKDNSVLHSP
SFYELAIKDTTHINKYSNYLSVNITLIVWHNLKNHPFHIRIISNLGSFLS
PPIKIQIYQLSEFEDDINEKVEFLMGNVAQILCRLPISKPSPPKIEFFHN
SSVINISNSSRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKL
QQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIY
CIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE
NKIFRIHVYQKLRLIANPSRVELKKSNFNKLLTIMCNLNQNEDENYMINW
LHNGVIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEWLSDEVYI
FFPKKNVKEIHSMRILYIDPDRPVDLRCEVPINYNVYNATSRWFRKFTGK
EITNSSLDFTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYKENKKFLL
RKLEFRLLFNKVNRQNQSPDPRETVKDSLFSFILSKPTVVRPISFLLAVN
VSWNMQTSIITDKNQSKIINHYQIEYRQGVLKLKPTEGKLLDPLIEWGNS
TIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSK
NFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSSEMSDN
HAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKI
VTATKLSSFHDERVELIITNLKANTQYLVAIYAILRPLTGMSMMYTALSD
ARIIDTSLAGKKSILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILF
VIALFMFIMCLWYQIRYHNKKRQNISSSSSVKTSSATTFAPIGTVNQISS
NSVFVTSSNIVSPHGLSPWNKSNRFPSTSEFPHLYLAQHLSLWSPNHLAQ
FNLPNNIQDQIVDEMKIKKPNTSPTTLSTPSPKSNIDLEINNLDGSIEDS
QEESVRLLDYQSHSSGFKRDDQCTLNNAFSVKSEGRDRQNDQDANSYNTR
SISHYPFSPSALELYSHKKKTKVCSSNRKDLSNIKLHLKQPKLQNSNYFL
PIRSRLSCFFPSAPSGESPPPCTPVISSLCKDNSLIQYNQMKKDETFAEH
PFLMADNIKNGFITNYGNGSFKYHYSPSNNFANQKLPSKFIFDPIHDLQP
HDDSRSNSTAASARQFLFSLYPDGVRPSINLDLDKQASNSQTNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032983CDO
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0045663positive regulation of myoblast differentiation
GO:0045664regulation of neuron differentiation
GO:0048598embryonic morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 368..453
e-value: 12.0
score: 10.7
coord: 286..359
e-value: 13.0
score: 10.4
coord: 168..263
e-value: 1.4E-5
score: 34.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 368..448
e-value: 2.5E-8
score: 35.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 157..263
e-value: 3.2E-10
score: 41.8
NoneNo IPR availablePANTHERPTHR44170FAMILY NOT NAMEDcoord: 144..437
NoneNo IPR availableCDDcd00096Igcoord: 398..451
e-value: 2.79994E-4
score: 38.3773
NoneNo IPR availableCDDcd00096Igcoord: 297..347
e-value: 0.00514864
score: 34.9105
NoneNo IPR availableTMHMMTMhelixcoord: 44..63
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 891..913
IPR032983Cell adhesion molecule-related/down-regulated by oncogenesPANTHERPTHR44170:SF1CELL ADHESION MOLECULE-RELATED/DOWN-REGULATED BY ONCOGENEScoord: 144..437
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 270..346
score: 7.522
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 151..258
score: 8.502
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 368..435
score: 8.502
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 286..347
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 380..438
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 170..246