Dipeptidyl peptidase 1

Overview
NameDipeptidyl peptidase 1
Smed IDSMED30002110
Length (bp)1584
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dipeptidyl peptidase 1 (SMED30002110) t-SNE clustered cells

Violin plots show distribution of expression levels for Dipeptidyl peptidase 1 (SMED30002110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dipeptidyl peptidase 1 (SMED30002110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dipeptidyl peptidase 1 (SMED30002110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002110SMESG000077202.1 Contig1968GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30002110SMESG000077202.1 dd_Smed_v4_219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002110SMESG000077202.1 dd_Smed_v4_219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30002110SMESG000077202.1 dd_Smed_v6_219_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002110SMESG000077202.1 dd_Smed_v4_219_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Human
Match: CTSC (cathepsin C [Source:HGNC Symbol;Acc:HGNC:2528])

HSP 1 Score: 460.685 bits (1184), Expect = 2.157e-158
Identity = 228/444 (51.35%), Postives = 301/444 (67.79%), Query Frame = 2
Query:   92 DTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYP---NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK-HVHIP--QSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            DTPANC+Y D +G W  QV +S      + S   P +   ++Y    + A DD GN G +T+IYNQGFE+ + + K+F +F +K+  S  T +YCN     W HDVL R W CF  +K+    E  +V+I   +++    ++ LY    + V  IN     W A  Y E+   TL  ++R +GG S K+ RPKPAP+T      + ++P S+DWRNV+G+N+VSPVRNQ  CGSCYSFAS GMLEAR RI +NN+ +PILSPQ+VV CS Y+QGCEGGFPYLIAGK+A+DFG+ +E+C PY G D  C   ++C RYY+++Y Y+GGFYG  NE LM++ELV +GP+AV FEVYDDF+ Y+ G+YHH       T  +  FNPFELTNHAVL+VGYG ++A+G  +W VKNSWG+GWGENGYFRIRR  DEC IES+ VA+ PI
Sbjct:   25 DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVT-TYCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHH-------TGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPI 460          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Human
Match: CTSC (cathepsin C [Source:HGNC Symbol;Acc:HGNC:2528])

HSP 1 Score: 197.978 bits (502), Expect = 2.823e-59
Identity = 100/217 (46.08%), Postives = 138/217 (63.59%), Query Frame = 2
Query:  218 NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK-HVHIP--QSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQD 859
            + A DD GN G +T+IYNQGFE+ + + K+F +F +K+  S  T +YCN     W HDVL R W CF  +K+    E  +V+I   +++    ++ LY    + V  IN     W A  Y E+   TL  ++R +GG S K+ RPKPAP+T      + ++P S+DWRNV+G+N+VSPVRNQ  CGSCYSFAS GMLEAR RI +NN+ +PILSPQ+
Sbjct:   29 DTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVT-TYCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQE 244          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Human
Match: CTSH (cathepsin H [Source:HGNC Symbol;Acc:HGNC:2535])

HSP 1 Score: 137.117 bits (344), Expect = 1.380e-35
Identity = 89/242 (36.78%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  692 PKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSP--YSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATN-----EPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            P S DWR     N+VSPV+NQG CGSC++F++ G LE+   I +   +S  L+ Q +V+C+    + GC+GG P         + G+  E   PY+G+DG C              K IG      N     E  M   +    P++  FEV  DFM Y++G+Y          +S       +  NHAVL VGYGE   G  +W VKNSWG  WG NGYF I R  + CG+ +   AS PI
Sbjct:  105 PPSVDWRKKG--NFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLS--LAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPG---------KAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIY----------SSTSCHKTPDKVNHAVLAVGYGEK-NGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAA--CASYPI 320          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Human
Match: CTSH (cathepsin H [Source:HGNC Symbol;Acc:HGNC:2535])

HSP 1 Score: 136.732 bits (343), Expect = 2.300e-35
Identity = 86/237 (36.29%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  692 PKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSP--YSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            P S DWR     N+VSPV+NQG CGSC++F++ G LE+   I +   +S  L+ Q +V+C+    + GC+GG P         + G+  E   PY+G+DG C         +      I  +    +E  M   +    P++  FEV  DFM Y++G+Y          +S       +  NHAVL VGYGE   G  +W VKNSWG  WG NGYF I R  + CG+ +   AS PI
Sbjct:  117 PPSVDWRKKG--NFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLS--LAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIY----DEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIY----------SSTSCHKTPDKVNHAVLAVGYGEK-NGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAA--CASYPI 332          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Human
Match: CTSB (cathepsin B [Source:HGNC Symbol;Acc:HGNC:2527])

HSP 1 Score: 131.724 bits (330), Expect = 1.429e-33
Identity = 104/328 (31.71%), Postives = 151/328 (46.04%), Query Frame = 2
Query:  518 IVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNV-NGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVEC--SPYSQGCEGGFPY----------LIAGKFAEDFGMAQESCNPY------------------KGEDGKCSTTKNCQRYYATKYK----YIGGFYGATN-EPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEP 1393
            +VN +N +N  W A     F+   +  + R+ G F   L  PKP P        +K +P SFD R        +  +R+QG CGSC++F +   +  R  I +N  +S  +S +D++ C  S    GC GG+P           L++G   E    +   C PY                  +G+  KCS  K C+  Y+  YK    Y    Y  +N E  +  E+ +NGP+   F VY DF+ Y+SGVY H      +T    G        HA+ ++G+G    G  +W V NSW + WG+NG+F+I R  D CGIES  VA  P
Sbjct:   30 LVNYVNKRNTTWQAGH--NFYNVDMSYLKRLCGTF---LGGPKP-PQRVMFTEDLK-LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYE----SHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCS--KICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQH------VTGEMMG-------GHAIRILGWG-VENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIP 330          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Celegans
Match: cpr-1 (Gut-specific cysteine proteinase [Source:UniProtKB/Swiss-Prot;Acc:P25807])

HSP 1 Score: 143.28 bits (360), Expect = 3.152e-38
Identity = 90/255 (35.29%), Postives = 134/255 (52.55%), Query Frame = 2
Query:  689 IPKSFDWRNV-NGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVEC--SPYSQGCEGGFPYLIAGKFAEDFGMAQ------ESCNPYK---GEDGKCSTTK------NCQRYYATKY---KYIG--GFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVA 1384
            +P +FD R   +    +  +R+Q  CGSC++F +A M+  R  I++     PI+SP D++ C  S    GCEGG+P + A ++ +  G+          C PY       G C  +K      +CQ  Y+T Y   K+ G   +    N   ++ E+  NGP+   F VY+DF  Y+SGVY H       TA K+      L  HA+ ++G+G T +G  +W V NSWG  WGE+G+F+I R +D+CGIES  VA
Sbjct:   85 VPATFDSRTQWSECKSIKLIRDQATCGSCWAFGAAEMISDRTCIETKGAQQPIISPDDLLSCCGSSCGNGCEGGYP-IQALRWWDSKGVVTGGDYHGAGCKPYPIAPCTSGNCPESKTPSCSMSCQSGYSTAYAKDKHFGVSAYAVPKNAASIQAEIYANGPVEAAFSVYEDFYKYKSGVYKH-------TAGKY------LGGHAIKIIGWG-TESGSPYWLVANSWGVNWGESGFFKIYRGDDQCGIESAVVA 324          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Celegans
Match: W07B8.4 (pep chromosome:WBcel235:V:1130088:1131942:-1 gene:WBGene00021072.1 transcript:W07B8.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07B8.4)

HSP 1 Score: 134.806 bits (338), Expect = 3.900e-35
Identity = 109/353 (30.88%), Postives = 156/353 (44.19%), Query Frame = 2
Query:  476 IFALNSLLYGSQKHIVNTINNQNIGWIAKDYPE-FHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFD----WRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSP----YSQGCEGGFP-----------YLIAGKFAEDFGMAQESCNPYK----GE--DG--------KCSTTKNCQRYYATKYKYIGGF-----YGATNEPLMR------MELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            I A ++++    K  +N IN+    W A+ Y   F  K L ++  +A       H  K   + E    +   IP S+D    W     VN +   R+Q  CGSC++ A+A  +  R  I SN  ++ +LS +D++ C         GCEGG+P            +  G F   +G     C PY     GE  DG        K S T  C+ +      Y   +     +GA+   + R       E++ +GP+ VGF VY+DF  Y++G+Y H                 EL  HAV ++G+G    G  +W   NSW + WGE GYFRI R  DECGIES  VA  P L
Sbjct:   11 ILAASAVVLPRNKLFINHINSAQKLWTAEHYTTPFEVKNLMKVEHVAA------HLDKDIKLAE----TADSIPDSYDVRDHWPQCISVNNI---RDQSHCGSCWAVAAAEAISDRTCIASNGDVNTLLSAEDILTCCTGKFNCGDGCEGGYPIQAWRYWVKNGLVTGGSFESQYG-----CKPYSIAPCGETIDGVTWPECPMKISDTPKCEHHCTGNNSYPIPYDQDKHFGASAYAIGRSAKQIQTEILAHGPVEVGFIVYEDFYLYKTGIYTH-------------VAGGELGGHAVKMLGWG-VDNGTPYWLAANSWNTVWGEKGYFRILRGVDECGIESAAVAGMPDL 331          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Celegans
Match: tag-196 (pep chromosome:WBcel235:V:8594914:8597500:1 gene:WBGene00007055.1 transcript:F41E6.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-196)

HSP 1 Score: 134.806 bits (338), Expect = 3.846e-34
Identity = 80/233 (34.33%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVAS 1387
            +P+SFDWR    V   + V+NQG CGSC++F++ G +E  + I  N  +S  LS Q++V+C    QGC GG P     +     G+  E   PY G    C   +     Y       G      +E  M+  LV  GPI++G    +    Y+ GV H           K    PF L NH VL+VGYG+    + +W VKNSWG  WGE GYF++ R  + CG++ +  ++
Sbjct:  264 LPESFDWREKGAV---TQVKNQGNCGSCWAFSTTGNVEGAWFIAKNKLVS--LSEQELVDCDSMDQGCNGGLPSNAYKEIIRMGGLEPEDAYPYDGRGETCHLVRKDIAVYIN-----GSVELPHDEVEMQKWLVTKGPISIGLNA-NTLQFYRHGVVH---------PFKIFCEPFML-NHGVLIVGYGKDGR-KPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQEMATSA 474          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Celegans
Match: tag-196 (pep chromosome:WBcel235:V:8594914:8597469:1 gene:WBGene00007055.1 transcript:F41E6.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-196)

HSP 1 Score: 134.806 bits (338), Expect = 3.846e-34
Identity = 80/233 (34.33%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVAS 1387
            +P+SFDWR    V   + V+NQG CGSC++F++ G +E  + I  N  +S  LS Q++V+C    QGC GG P     +     G+  E   PY G    C   +     Y       G      +E  M+  LV  GPI++G    +    Y+ GV H           K    PF L NH VL+VGYG+    + +W VKNSWG  WGE GYF++ R  + CG++ +  ++
Sbjct:  264 LPESFDWREKGAV---TQVKNQGNCGSCWAFSTTGNVEGAWFIAKNKLVS--LSEQELVDCDSMDQGCNGGLPSNAYKEIIRMGGLEPEDAYPYDGRGETCHLVRKDIAVYIN-----GSVELPHDEVEMQKWLVTKGPISIGLNA-NTLQFYRHGVVH---------PFKIFCEPFML-NHGVLIVGYGKDGR-KPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQEMATSA 474          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Celegans
Match: cpr-2 (Cysteine PRotease related [Source:UniProtKB/TrEMBL;Acc:O45466])

HSP 1 Score: 129.413 bits (324), Expect = 3.242e-33
Identity = 103/318 (32.39%), Postives = 145/318 (45.60%), Query Frame = 2
Query:  512 KHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNV-NGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYS--QGCEGGFPYLIAGKFAEDFGMAQ------ESCNPYKGEDGKCSTTKN---------CQRYYATKYKYIGGFYGATNEPLMRM------ELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEP 1393
            + +V+ IN+    +  ++Y   HEK       M   F++       A   E+ L++    P +FD R        +  +R Q  CGSC++F++A ++  R  I SN T  PI+SP D++ C   S  +GC+GGFPY  A ++    G+          C PY           N         CQ  Y T Y      YG +  P+ R       ++  NGP+   F VY+DF  Y+SG+Y H     K               HAV ++G+G T  G  +W   NSWGS WGE+G FRI R  DECGIES  VA  P
Sbjct:   29 QDLVDHINSAASTFQTENYAVTHEK--MHTRSMHEKFNAPFPDEFRATEREFVLDAT---PLNFDARTRWPQCKSMKLIREQSNCGSCWAFSTAEVISDRTCIASNGTQQPIISPTDLLTCCGMSCGEGCDGGFPYR-AFQWWARRGVVTGGDYLGTGCKPYPIRPCNSDNCVNLQTPPCRLSCQPGYRTTYTNDKN-YGNSAYPVPRTVAAIQADIYYNGPVVAAFIVYEDFEKYKSGIYRHIAGRSK-------------GGHAVKLIGWG-TERGTPYWLAVNSWGSQWGESGTFRILRGVDECGIESRIVAGLP 325          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Fly
Match: Swim (gene:FBgn0034709 transcript:FBtr0071785)

HSP 1 Score: 140.584 bits (353), Expect = 2.763e-36
Identity = 93/306 (30.39%), Postives = 145/306 (47.39%), Query Frame = 2
Query:  515 HIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYK-----------YIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            H VN+I    +GW A+ Y ++  +   + +++  G     +R K     +   N    +P SF+  +    +Y+S V +QG CG+ +  ++  +   R+ I+S    +  LS Q+++ C+   QGCEGG     A ++    G+  E+C PY      C    N +   A   +            +G  Y    E  +  E+  +GP+     V  DF +Y  GVY      RK   +  GF       H+V +VG+GE   GEK+W   NSWGS WGE+GYFRI R ++ECGIE   +AS P +
Sbjct:  134 HSVNSI--HRLGWSARKYDQWWGRKYSEGLKLRLGTKEPTYRVKAMTRLK---NPTDGLPSSFNALD-KWSSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCTRRQQGCEGGH-LDAAWRYLHKKGVVDENCYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATMRVNRDFFAYSGGVYRETAANRK---APTGF-------HSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRILRGSNECGIEEYVLASWPYV 422          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Fly
Match: Swim (gene:FBgn0034709 transcript:FBtr0071784)

HSP 1 Score: 140.584 bits (353), Expect = 2.763e-36
Identity = 93/306 (30.39%), Postives = 145/306 (47.39%), Query Frame = 2
Query:  515 HIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYK-----------YIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            H VN+I    +GW A+ Y ++  +   + +++  G     +R K     +   N    +P SF+  +    +Y+S V +QG CG+ +  ++  +   R+ I+S    +  LS Q+++ C+   QGCEGG     A ++    G+  E+C PY      C    N +   A   +            +G  Y    E  +  E+  +GP+     V  DF +Y  GVY      RK   +  GF       H+V +VG+GE   GEK+W   NSWGS WGE+GYFRI R ++ECGIE   +AS P +
Sbjct:  134 HSVNSI--HRLGWSARKYDQWWGRKYSEGLKLRLGTKEPTYRVKAMTRLK---NPTDGLPSSFNALD-KWSSYISEVPDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCTRRQQGCEGGH-LDAAWRYLHKKGVVDENCYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATMRVNRDFFAYSGGVYRETAANRK---APTGF-------HSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRILRGSNECGIEEYVLASWPYV 422          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0087592)

HSP 1 Score: 117.087 bits (292), Expect = 1.261e-28
Identity = 101/364 (27.75%), Postives = 160/364 (43.96%), Query Frame = 2
Query:  383 YHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTL--------------YQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYI-------PKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFR-IRRANDECGIESLGVASEPIL 1399
            + DV++ +W  FK +   N  ++     +  IF                  N+N   IAK    F E  +              ++  ++  GF+  LH+   A   +     V +I       PKS DWR    V   + V++QG CGSC++F+S G LE ++  KS   +S  LS Q++V+CS    + GC GG          ++ G+  E   PY+  D  C   K      AT   +     G  +E  M   +   GP++V  +  ++ F  Y  GVY+      +  A           +H VLVVG+G   +GE +W VKNSWG+ WG+ G+ + +R   ++CGI S   +S P++
Sbjct:   21 FADVVMEEWHTFKLEHRKNYQDETEERFRLKIF------------------NENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAA--DESFKGVTFISPAHVTLPKSVDWRTKGAV---TAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVS--LSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGT--VGATDRGFTDIPQG--DEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEP----QCDAQNL--------DHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIAS--ASSYPLV 341          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0087593)

HSP 1 Score: 117.087 bits (292), Expect = 1.859e-28
Identity = 101/364 (27.75%), Postives = 160/364 (43.96%), Query Frame = 2
Query:  383 YHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTL--------------YQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYI-------PKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFR-IRRANDECGIESLGVASEPIL 1399
            + DV++ +W  FK +   N  ++     +  IF                  N+N   IAK    F E  +              ++  ++  GF+  LH+   A   +     V +I       PKS DWR    V   + V++QG CGSC++F+S G LE ++  KS   +S  LS Q++V+CS    + GC GG          ++ G+  E   PY+  D  C   K      AT   +     G  +E  M   +   GP++V  +  ++ F  Y  GVY+      +  A           +H VLVVG+G   +GE +W VKNSWG+ WG+ G+ + +R   ++CGI S   +S P++
Sbjct:   51 FADVVMEEWHTFKLEHRKNYQDETEERFRLKIF------------------NENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRA--ADESFKGVTFISPAHVTLPKSVDWRTKGAV---TAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVS--LSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGT--VGATDRGFTDIPQG--DEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEP----QCDAQNL--------DHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIAS--ASSYPLV 371          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0304021)

HSP 1 Score: 113.62 bits (283), Expect = 3.375e-28
Identity = 87/275 (31.64%), Postives = 133/275 (48.36%), Query Frame = 2
Query:  587 TLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFR-IRRANDECGIESLGVASEPIL 1399
            TL++ +R A      +    PA VT         +PKS DWR    V   + V++QG CGSC++F+S G LE ++  KS   +S  LS Q++V+CS    + GC GG          ++ G+  E   PY+  D  C   K      AT   +     G  +E  M   +   GP++V  +  ++ F  Y  GVY+      +  A           +H VLVVG+G   +GE +W VKNSWG+ WG+ G+ + +R   ++CGI S   +S P++
Sbjct:    7 TLHKQLRAADESFKGVTFISPAHVT---------LPKSVDWRTKGAV---TAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVS--LSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKG--TVGATDRGFTDIPQG--DEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNE----PQCDAQNL--------DHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIAS--ASSYPLV 249          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Zebrafish
Match: ctsc (cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9])

HSP 1 Score: 431.024 bits (1107), Expect = 3.265e-147
Identity = 224/460 (48.70%), Postives = 294/460 (63.91%), Query Frame = 2
Query:   47 LRIILSIGLLHFALSDTPANCSYQDAIGKW-----QVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK--HVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEK-TLYQIVRMAGGFSSKLHRPKPAPVT-EYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGET-ATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            L +I+    +  A +DTPANC+Y+D +G W      V         ST   V T T+ L   ++A+DD G+ G +TLIYNQGFEV I   K+FG+F + Q  S   +SYC++  P W HDVL   W CF  +K+  +  +    H+       L  L Y +    V+ IN+    W A  Y  FHE  ++++++R +GG +S++ R +  PVT      +   +P+ +DWRNVNGVN+VSPVRNQ  CGSCYSFA+ GMLEAR RI++NNT  P+ SPQ VV CS YSQGC+GGFPYLI GK+ +DFG+ +E C PY G D  C+    C +YYA+ Y Y+GGFYG  +E  M +ELV+NGP+ V  EVY DFM+Y+ G+YHH       T  +   NPFELTNHAVL+VGYG+   TGEK+W VKNSWGSGWGENG+FRIRR  DEC IES+ VA+ PI
Sbjct:    4 LSVIVLFAFIAGAAADTPANCTYEDLLGTWIFSVSNVGQDKTINCSSTGQAVSTVTVDLQKLSVAVDDLGHTGFFTLIYNQGFEVVINEYKWFGFFKYTQQGSE-VVSYCDQTLPGWVHDVLGSNWACFTGKKVQPIPPRVDRRHMLGFEHRLLMKLPYTNNMMFVDEINSVQKSWTATVY-SFHETLSIHEMLRRSGGPASRIPR-RVRPVTVAADSKAAAGLPQHWDWRNVNGVNFVSPVRNQAQCGSCYSFATMGMLEARVRIQTNNTQQPVFSPQQVVSCSQYSQGCDGGFPYLI-GKYIQDFGIVEEDCFPYTGSDSPCNLPAKCTKYYASDYHYVGGFYGGCSESAMMLELVKNGPMGVALEVYPDFMNYKEGIYHH-------TGLRDANNPFELTNHAVLLVGYGQCHKTGEKYWIVKNSWGSGWGENGFFRIRRGTDECAIESIAVAATPI 452          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Zebrafish
Match: ctss2.2 (cathepsin S, ortholog 2, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-55])

HSP 1 Score: 140.969 bits (354), Expect = 3.148e-37
Identity = 87/244 (35.66%), Postives = 129/244 (52.87%), Query Frame = 2
Query:  653 PVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYD-DFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIES 1372
            P  EY  +S   +P + DWR+     YV+ V+NQG CGSC++F+S G LE +    +   +   LSPQ++V+CS    + GC GG+         ++ G+  ES  PY+G  G C    + +    T YK++       +E  ++  L   GP++V  +     F+ Y+SGVY     T+K+             NH VL VGYG T +G+ +W VKNSWG+G+G+ GY RI R  N+ CGI S
Sbjct:  103 PTAEYVSSSFAVVPDTLDWRDKG---YVTSVKNQGACGSCWAFSSVGALEGQLMKTTGKLVD--LSPQNLVDCSSKYGNLGCNGGYMSQAFQYVIDNGGIDSESSYPYQGTQGSCRYDPSQRAANCTSYKFVS----QGDEQALKEALANIGPVSVAIDATRPQFIFYRSGVYDDPSCTQKV-------------NHGVLAVGYG-TLSGQDYWLVKNSWGAGFGDGGYIRIARNKNNMCGIAS 323          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Zebrafish
Match: ctss2.2 (cathepsin S, ortholog 2, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050626-55])

HSP 1 Score: 140.969 bits (354), Expect = 3.148e-37
Identity = 87/244 (35.66%), Postives = 129/244 (52.87%), Query Frame = 2
Query:  653 PVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYD-DFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIES 1372
            P  EY  +S   +P + DWR+     YV+ V+NQG CGSC++F+S G LE +    +   +   LSPQ++V+CS    + GC GG+         ++ G+  ES  PY+G  G C    + +    T YK++       +E  ++  L   GP++V  +     F+ Y+SGVY     T+K+             NH VL VGYG T +G+ +W VKNSWG+G+G+ GY RI R  N+ CGI S
Sbjct:  103 PTAEYVSSSFAVVPDTLDWRDKG---YVTSVKNQGACGSCWAFSSVGALEGQLMKTTGKLVD--LSPQNLVDCSSKYGNLGCNGGYMSQAFQYVIDNGGIDSESSYPYQGTQGSCRYDPSQRAANCTSYKFVS----QGDEQALKEALANIGPVSVAIDATRPQFIFYRSGVYDDPSCTQKV-------------NHGVLAVGYG-TLSGQDYWLVKNSWGAGFGDGGYIRIARNKNNMCGIAS 323          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Zebrafish
Match: ctsbb (cathepsin Bb [Source:ZFIN;Acc:ZDB-GENE-070323-1])

HSP 1 Score: 139.428 bits (350), Expect = 1.028e-36
Identity = 114/349 (32.66%), Postives = 155/349 (44.41%), Query Frame = 2
Query:  476 IFALNSLLYG-----SQKHIVNTINNQNIGWIA----KDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFD----WRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQ-GCEGGFP-----------YLIAGKFAEDFGMAQESCNPYK-----------GEDGKCSTTKNCQRYYATKYKYIGGFYG-----ATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            +FAL S+        +   +++ IN     W A     + P+ + K+L   V         L  P+  P T  H  +VK +P SFD    W N   +N +   R+QG CGSC++F +   +  R  I S    SP +S +D++ C      GC GGFP            +  G +  D G    S  P +           GE      T  C   Y+  YK    F        +++  +  EL  NGP+   F VY+DF  Y+SGVY H      LT S  G        HAV ++G+GE   G  FW V NSW S WG+NGYF+I R +DECGIES  VA  P L
Sbjct:    6 VFALLSVTCARPQLHTHDEMISFINAARSTWTAGVNFDNVPKKYLKSLCGTV---------LKGPR-LPHTVKHSTNVK-LPDSFDLRDQWPNCKTLNQI---RDQGSCGSCWAFGAVESISDRICIHSKGKQSPEISAEDLLSCCDQCGFGCSGGFPAEAWDYWRRSGLVTGGLYNSDVGCRPYSIAPCEHHVNGTRPPCSGEQDTPKCTGVCIPKYSVPYKQDKHFGSKVYNVPSDQQQIMTELYTNGPVEAAFTVYEDFPLYKSGVYQH------LTGSALG-------GHAVKILGWGE-ENGTPFWLVANSWNSDWGDNGYFKILRGHDECGIESEMVAGLPKL 326          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Zebrafish
Match: ctsk (cathepsin K [Source:ZFIN;Acc:ZDB-GENE-001205-4])

HSP 1 Score: 137.887 bits (346), Expect = 5.741e-36
Identity = 96/277 (34.66%), Postives = 139/277 (50.18%), Query Frame = 2
Query:  575 FHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDD-FMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIESLGVASEPIL 1399
            F + TL ++     G    ++R  PA  T    + V  +PKS D+R +    YV+ V+NQG CGSC++F+S G LE +        +   LSPQ++V+C   + GC GG+        + + G+  E   PY G D +C+   +        YK I       NE  +   +   GP++VG +     F+ Y+SGVY+ D    K           E  NHAVL VGYG T  G+K+W VKNSWG  WG+ GY  + R  N+ CGI +L  AS P++
Sbjct:   82 FGDMTLEEVAEKVMGLQMPMYR-DPAN-TFVPDDRVGKLPKSIDYRKLG---YVTSVKNQGSCGSCWAFSSVGALEGQLMKTKGQLVD--LSPQNLVDCVTENDGCGGGYMTNAFRYVSNNQGIDSEESYPYVGTDQQCAYNTSGVAASCRGYKEIP----QGNERALTAAVANVGPVSVGIDAMQSTFLYYKSGVYY-DPNCNK-----------EDVNHAVLAVGYGATPRGKKYWIVKNSWGEEWGKKGYVLMARNRNNACGIANL--ASFPVM 333          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Xenopus
Match: ctsc (cathepsin C [Source:NCBI gene;Acc:407938])

HSP 1 Score: 427.943 bits (1099), Expect = 8.860e-146
Identity = 227/456 (49.78%), Postives = 289/456 (63.38%), Query Frame = 2
Query:   71 LLHFALSDTPANCSYQDAIGKWQV-------XXXXXXXXXXXXXXVPTK-TLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLS-NLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKY--IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            L     +DTPANCS+ D  G W+           + S  CS    V TK T+T+    +A D +GN G +TLIYNQGFEV I N  +FG+F ++Q  S  T SYC+   P W HDVL R W CF  +K+S + G +    P      L S LY      V  IN     W A  YPE+   T+  ++R AGG +S++  RP+PAP+        KY  +P  +DWRN+ G N+V+PVRNQ  CGSCY+F+S GMLE+R +I+S  +  PILSPQ VV CS YSQGCEGGFPYLIAGK+  D+G+ +ES  PY G D  C+   + Q+YY  +Y Y+GGFYG  NE  M++ELV +GP++V FEVYDDFM Y+SGVYHH       T  +  FNPF+LTNHAVL+VGYG +  TGEK+W VKNSWG  WGE GYFRIRR  DEC IES+ V++EPI+
Sbjct:   13 LCRLGAADTPANCSFPDLEGTWEFQIGEGSGAARDKSIDCSQLGKVRTKLTVTMKELYIAEDQYGNLGGFTLIYNQGFEVKILNYLFFGFFKYEQRGSNVT-SYCHETFPGWVHDVLGRNWACFVGKKISADSGVRVNPDPFPKKEMLTSRLYNYNHDFVKQINEVQKSWTATAYPEYEGMTIEDLIRRAGGRNSRIPMRPRPAPLP----TDEKYQGLPTEWDWRNIAGYNFVTPVRNQASCGSCYAFSSMGMLESRIQIRSQLSQKPILSPQQVVSCSNYSQGCEGGFPYLIAGKYVSDYGIVEESDLPYTGSDSPCTLKDSQQKYYTAEYHYVGGFYGGCNEAYMKLELVLSGPLSVAFEVYDDFMHYRSGVYHH-------TGLQDKFNPFQLTNHAVLLVGYGTDQQTGEKYWIVKNSWGESWGEKGYFRIRRGTDECAIESIAVSAEPII 456          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Xenopus
Match: ctsc (cathepsin C [Source:NCBI gene;Acc:407938])

HSP 1 Score: 424.476 bits (1090), Expect = 2.136e-144
Identity = 226/458 (49.34%), Postives = 289/458 (63.10%), Query Frame = 2
Query:   71 LLHFALSDTPANCSYQDAIGKWQV-------XXXXXXXXXXXXXXVPTK-TLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVH---IPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKY--IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            L     +DTPANCS+ D  G W+           + S  CS    V TK T+T+    +A D +GN G +TLIYNQGFEV I N  +FG+F ++Q  S  T SYC+   P W HDVL R W CF  +K+S      V+    P+  I    + LY      V  IN     W A  YPE+   T+  ++R AGG +S++  RP+PAP+        KY  +P  +DWRN+ G N+V+PVRNQ  CGSCY+F+S GMLE+R +I+S  +  PILSPQ VV CS YSQGCEGGFPYLIAGK+  D+G+ +ES  PY G D  C+   + Q+YY  +Y Y+GGFYG  NE  M++ELV +GP++V FEVYDDFM Y+SGVYHH       T  +  FNPF+LTNHAVL+VGYG +  TGEK+W VKNSWG  WGE GYFRIRR  DEC IES+ V++EPI+
Sbjct:   13 LCRLGAADTPANCSFPDLEGTWEFQIGEGSGAARDKSIDCSQLGKVRTKLTVTMKELYIAEDQYGNLGGFTLIYNQGFEVKILNYLFFGFFKYEQRGSNVT-SYCHETFPGWVHDVLGRNWACFVGKKISADSGVRVNPDPFPKKEIGV--AQLYNYNHDFVKQINEVQKSWTATAYPEYEGMTIEDLIRRAGGRNSRIPMRPRPAPLP----TDEKYQGLPTEWDWRNIAGYNFVTPVRNQASCGSCYAFSSMGMLESRIQIRSQLSQKPILSPQQVVSCSNYSQGCEGGFPYLIAGKYVSDYGIVEESDLPYTGSDSPCTLKDSQQKYYTAEYHYVGGFYGGCNEAYMKLELVLSGPLSVAFEVYDDFMHYRSGVYHH-------TGLQDKFNPFQLTNHAVLLVGYGTDQQTGEKYWIVKNSWGESWGEKGYFRIRRGTDECAIESIAVSAEPII 456          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Xenopus
Match: ctsh (cathepsin H [Source:NCBI gene;Acc:496748])

HSP 1 Score: 138.272 bits (347), Expect = 8.685e-37
Identity = 90/258 (34.88%), Postives = 130/258 (50.39%), Query Frame = 2
Query:  638 RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCS-TTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGE------TATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASE 1390
            + KPAP   Y++   K I K  DWR+ N    +SPV+NQG CGSC++FA+ G+LEA + +  N   +  LS Q +V+C P   GC GGFP + A  +    G+ +     Y+ +   C   + N  +   +KY      Y   NE  M   + ++GPI VGF V  DFM Y  G++  +                   NHA+++VGYG          GE +W +KNSWG+ WGE+G+ +I R  D CGI     + E
Sbjct:   28 KHKPAP--RYNVKHAK-ISKGVDWRDSN---CISPVKNQGYCGSCWAFATVGVLEALHCLNGNELHN--LSEQQLVDCDPIDHGCCGGFP-INAIDYITQEGIMKSEDYEYEEKQFYCRYDSSNAIQLNVSKY------YVLPNEENMASSVAKDGPITVGFGVNRDFMLYSKGIFDGECAPS--------------PNHAIIIVGYGTLHCEEGKDDGEDYWIIKNSWGTEWGEDGFGKIMRNKDMCGISEFAASLE 256          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Xenopus
Match: ctsh (cathepsin H [Source:NCBI gene;Acc:496748])

HSP 1 Score: 137.887 bits (346), Expect = 1.171e-36
Identity = 90/258 (34.88%), Postives = 130/258 (50.39%), Query Frame = 2
Query:  638 RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCS-TTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGE------TATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASE 1390
            + KPAP   Y++   K I K  DWR+ N    +SPV+NQG CGSC++FA+ G+LEA + +  N   +  LS Q +V+C P   GC GGFP + A  +    G+ +     Y+ +   C   + N  +   +KY      Y   NE  M   + ++GPI VGF V  DFM Y  G++  +                   NHA+++VGYG          GE +W +KNSWG+ WGE+G+ +I R  D CGI     + E
Sbjct:   25 KHKPAP--RYNVKHAK-ISKGVDWRDSN---CISPVKNQGYCGSCWAFATVGVLEALHCLNGNELHN--LSEQQLVDCDPIDHGCCGGFP-INAIDYITQEGIMKSEDYEYEEKQFYCRYDSSNAIQLNVSKY------YVLPNEENMASSVAKDGPITVGFGVNRDFMLYSKGIFDGECAPS--------------PNHAIIIVGYGTLHCEEGKDDGEDYWIIKNSWGTEWGEDGFGKIMRNKDMCGISEFAASLE 253          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Xenopus
Match: ctsl (cathepsin L [Source:NCBI gene;Acc:548464])

HSP 1 Score: 134.806 bits (338), Expect = 1.022e-34
Identity = 81/252 (32.14%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  647 PAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGG-CGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEK------FWTVKNSWGSGWGENGYFRIRRANDECGIESLGV 1381
            P     Y   S+  IPK  DWR  N V   +PV+NQG  CGSC++FA+ G++E+RY I++   ++  LS Q +V+C   ++GC GGFP + A ++    G+ +     Y  +   C    +        +  +  FY    E  M   +   GPI VG  V  DF  Y  G++  D                E  NHAV++VGYG     +K      +W +KNSWG  WGE+GY +++R  ++C I  +  
Sbjct:  102 PVKAESYSYTSIT-IPKEVDWRKSNCV---TPVKNQGTFCGSCWAFATVGVMESRYCIRTKELLN--LSEQQLVDCDEINEGCCGGFP-IKALEYVAQHGVMRNKEYEYSQKKATCEYDSD-----KAIHMNVSKFYILPGEENMATSVAIEGPITVGIGVSSDFQLYSEGIFEGDCA--------------ESPNHAVIIVGYGTEHANDKEEEDKDYWIIKNSWGKEWGEDGYVKMKRNINQCSITEMAA 327          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Mouse
Match: Ctsc (cathepsin C [Source:MGI Symbol;Acc:MGI:109553])

HSP 1 Score: 428.328 bits (1100), Expect = 5.844e-146
Identity = 225/449 (50.11%), Postives = 295/449 (65.70%), Query Frame = 2
Query:   89 SDTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYP---NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSL-------LYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            SDTPANC+Y D +G W  QV   +  +  + S    T+   +++    + A D+ GN G +TLIYNQGFE+ + + K+F +F + ++     ISYC+     W HDVL R W CF  +K+    E H+     N   L  L       LY    + V  IN     W A  Y E+ + +L  ++R +G  S ++ RPKPAP+T+     +  +P+S+DWRNV GVNYVSPVRNQ  CGSCYSFAS GMLEAR RI +NN+ +PILSPQ+VV CSPY+QGC+GGFPYLIAGK+A+DFG+ +ESC PY  +D  C   +NC RYY++ Y Y+GGFYG  NE LM++ELV++GP+AV FEV+DDF+ Y SG+YHH       T     FNPFELTNHAVL+VGYG +  TG ++W +KNSWGS WGE+GYFRIRR  DEC IES+ VA+ PI
Sbjct:   24 SDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKY-EVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKV----ESHIEKVNMNAAHLGGLQERYSERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSG-HSQRIPRPKPAPMTDEIQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYYSSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHH-------TGLSDPFNPFELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIPI 459          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Mouse
Match: Ctsc (cathepsin C [Source:MGI Symbol;Acc:MGI:109553])

HSP 1 Score: 159.073 bits (401), Expect = 1.149e-44
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:   89 SDTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYPNL--AIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFAL----NSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCG 766
            SDTPANC+Y D +G W  QV   +  +  + S     + + +    L  A D+ GN G +TLIYNQGFE+ + + K+F +F + ++     ISYC+     W HDVL R W CF  +K+ +  EK V++  +++  L    +  LY    + V  IN     W A  Y E+ + +L  ++R +G  S ++ RPKPAP+T+     +  +P+S+DWRNV GVNYVSPVRNQ  CG
Sbjct:   24 SDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKY-EVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKVESHIEK-VNMNAAHLGGLQERYSERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSG-HSQRIPRPKPAPMTDEIQQQILNLPESWDWRNVQGVNYVSPVRNQESCG 254          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Mouse
Match: Ctsh (cathepsin H [Source:MGI Symbol;Acc:MGI:107285])

HSP 1 Score: 145.591 bits (366), Expect = 8.718e-39
Identity = 93/239 (38.91%), Postives = 126/239 (52.72%), Query Frame = 2
Query:  692 PKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGAT--NEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            P S DWR     N VSPV+NQG CGSC++F++ G LE+   I S   +S  L+ Q +V+C+    + GC+GG P         + G+ +E   PY G+D  C    N Q+  A    ++      T  +E  M   +    P++  FEV +DF+ Y+SGVY          +SK      +  NHAVL VGYGE   G  +W VKNSWGS WGENGYF I R  + CG+ +   AS PI
Sbjct:  115 PSSMDWRKKG--NVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMLS--LAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRF--NPQKAVA----FVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVY----------SSKSCHKTPDKVNHAVLAVGYGEQ-NGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAA--CASYPI 330          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Mouse
Match: Ctsk (cathepsin K [Source:MGI Symbol;Acc:MGI:107823])

HSP 1 Score: 132.88 bits (333), Expect = 2.799e-34
Identity = 82/232 (35.34%), Postives = 118/232 (50.86%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIESLG 1378
            +P S D+R      YV+PV+NQG CGSC++F+SAG LE + + K+   ++  LSPQ++V+C   + GC GG+         ++ G+  E   PY G+D  C      +      Y+ I       NE  ++  + R GPI+V  +     F  Y  GVY+ +   R            +  NHAVLVVGYG T  G K W +KNSWG  WG  GY  + R  N+ CGI ++ 
Sbjct:  115 VPDSIDYRKKG---YVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLA--LSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREI----PVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDR------------DNVNHAVLVVGYG-TQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMA 324          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Mouse
Match: Ctsll3 (cathepsin L-like 3 [Source:MGI Symbol;Acc:MGI:1917452])

HSP 1 Score: 132.494 bits (332), Expect = 4.576e-34
Identity = 88/243 (36.21%), Postives = 132/243 (54.32%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECS--PYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGA-TNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHH-DFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIESLGVASEPIL 1399
            +PKS DWR+     YV+PV++QG CGSC++F++ G LE +   K+   +   LS Q++V+CS    +QGC+GG P L      ++ G+      PY+  +G C    N +   AT    + GF    ++E  +   +   GPI+VG +  +  F  Y+ G+Y+  D  +  L             +HAVLVVGYGE + G K+W VKNSWG  WG NGY ++ +  N+ CGI S   AS P++
Sbjct:  115 VPKSVDWRDHG---YVTPVKDQGSCGSCWAFSAVGSLEGQMFRKTGKLVP--LSVQNLVDCSWSQGNQGCDGGLPDLAFQYVKDNGGLDTSVSYPYEALNGTCRY--NPKNSAAT----VTGFVNVQSSEDALMKAVATVGPISVGIDTKHKSFQFYKEGMYYEPDCSSTVL-------------DHAVLVVGYGEESDGRKYWLVKNSWGRDWGMNGYIKMAKDRNNNCGIAS--DASYPVV 331          
BLAST of Dipeptidyl peptidase 1 vs. UniProt/SwissProt
Match: sp|P53634|CATC_HUMAN (Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2)

HSP 1 Score: 460.685 bits (1184), Expect = 1.036e-157
Identity = 228/444 (51.35%), Postives = 301/444 (67.79%), Query Frame = 2
Query:   92 DTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYP---NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK-HVHIP--QSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            DTPANC+Y D +G W  QV +S      + S   P +   ++Y    + A DD GN G +T+IYNQGFE+ + + K+F +F +K+  S  T +YCN     W HDVL R W CF  +K+    E  +V+I   +++    ++ LY    + V  IN     W A  Y E+   TL  ++R +GG S K+ RPKPAP+T      + ++P S+DWRNV+G+N+VSPVRNQ  CGSCYSFAS GMLEAR RI +NN+ +PILSPQ+VV CS Y+QGCEGGFPYLIAGK+A+DFG+ +E+C PY G D  C   ++C RYY+++Y Y+GGFYG  NE LM++ELV +GP+AV FEVYDDF+ Y+ G+YHH       T  +  FNPFELTNHAVL+VGYG ++A+G  +W VKNSWG+GWGENGYFRIRR  DEC IES+ VA+ PI
Sbjct:   25 DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVT-TYCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHH-------TGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPI 460          
BLAST of Dipeptidyl peptidase 1 vs. UniProt/SwissProt
Match: sp|Q5RB02|CATC_PONAB (Dipeptidyl peptidase 1 OS=Pongo abelii OX=9601 GN=CTSC PE=2 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 1.138e-155
Identity = 226/445 (50.79%), Postives = 296/445 (66.52%), Query Frame = 2
Query:   92 DTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYP---NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK----HVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            DTPANC+Y D +G W  QV +S      + S   P +   +++    + A DD GN G +T+IYNQGFE+ + + K+F +F +K+  S  T +YCN     W HDVL R W CF  +K+    E       H+  S     N L Y    + V  IN     W A  Y E+   TL  ++R +GG S K+ RPKPAP+T      V ++P S+DWRN++G+N+VSPVRNQ  CGSCYSFAS GMLEAR RI ++N+ +PILSPQ+VV CS Y+QGCEGGFPYLIAGK+A+DFG+ +E+C PY G D  C   ++C RYY+++Y Y+GGFYG  NE LM++ELV +GP+AV FEVYDDF+ Y+ G+YHH       T  +  FNPFELTNHAVL+VGYG ++A+G  +W VKNSWG+GWGE+GYFRIRR  DEC IES+ VA+ PI
Sbjct:   25 DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVHLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVT-TYCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNTAHLKNSQEKYSNRL-YKYDHNFVKAINAIQKSWTATTYKEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKVLHLPTSWDWRNIHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTSNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHH-------TGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGEDGYFRIRRGTDECAIESIAVAATPI 460          
BLAST of Dipeptidyl peptidase 1 vs. UniProt/SwissProt
Match: sp|Q3ZCJ8|CATC_BOVIN (Dipeptidyl peptidase 1 OS=Bos taurus OX=9913 GN=CTSC PE=2 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 2.817e-154
Identity = 229/462 (49.57%), Postives = 304/462 (65.80%), Query Frame = 2
Query:   50 RIILSIGLLHFALS---DTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYP---NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFAL----NSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            R++  + L++ A S   DTPANC+Y D +G W  QV +S      + S   P +   +++    + A DDFGN G +T+IYNQGFE+ + + K+F +F +K+     T SYC+     W HDVL R   CF  +K  N  E +V++  + +  L    ++ LY      V  IN     W A  Y E+   TL +++R  GG S ++ RPKPAP+T      + ++P S+DWRNV+G+N+V+PVRNQG CGSCYSFAS GM+EAR RI +NNT +PILSPQ+VV CS Y+QGCEGGFPYLIAGK+A+DFG+ +E C PY G D  C   + C RYY+++Y Y+GGFYG  NE LM++ELV  GP+AV FEVYDDF+ Y+ GVYHH       T  +  FNPFELTNHAVL+VGYG + A+G  +W VKNSWG+ WGENGYFRIRR  DEC IES+ +A+ PI
Sbjct:    8 RLVALLLLVYGAGSVRGDTPANCTYPDLLGTWVFQVGSSGSQRDVNCSVMGPPEKKVVVHLKKLDTAYDDFGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGGKVT-SYCHETMTGWVHDVLGRNRACFTGRKTGNTSE-NVNVNTARLAGLEETYSNRLYRYNHDFVKAINAIQKSWTAAPYMEYETLTLKEMIRRGGGHSRRIPRPKPAPITAEIQKKILHLPTSWDWRNVHGINFVTPVRNQGSCGSCYSFASMGMMEARIRILTNNTQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEDCFPYTGTDSPCRLKEGCFRYYSSEYHYVGGFYGGCNEALMKLELVHQGPMAVAFEVYDDFLHYRKGVYHH-------TGLRDPFNPFELTNHAVLLVGYGTDAASGLDYWIVKNSWGTSWGENGYFRIRRGTDECAIESIALAATPI 460          
BLAST of Dipeptidyl peptidase 1 vs. UniProt/SwissProt
Match: sp|Q60HG6|CATC_MACFA (Dipeptidyl peptidase 1 OS=Macaca fascicularis OX=9541 GN=CTSC PE=2 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 2.894e-152
Identity = 223/445 (50.11%), Postives = 292/445 (65.62%), Query Frame = 2
Query:   92 DTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYP---NLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK----HVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            DTPANC+Y D +G W  QV +S      + S   P +   +++    + A DD GN G +T+IYNQGFE+ + + K+F +F +K+     TI YCN     W HDVL R W CF  +K+    E       H+  S     N L Y    + V  IN     W A  Y E+   TL  +++ +GG S K+ RPKP P+T      + ++P S+DWRNV+G+N+VSPVRNQ  CGSCYSFAS GMLEAR RI +NN+ +PILS Q+VV CS Y+QGCEGGFPYL AGK+A+DFG+ +E+C PY G D  C   ++C RYY+++Y Y+GGFYG  NE LM++ELV +GP+AV FEVYDDF+ YQ+G+YHH       T  +  FNPFELTNHAVL+VGYG ++A+G  +W VKNSWG+ WGE+GYFRIRR  DEC IES+ VA+ PI
Sbjct:   25 DTPANCTYLDLLGTWVFQVGSSGSLRDVNCSVMGPPEKKVVVHLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGIKVTI-YCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNTAHLKNSQEKYSNRL-YKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIKRSGGHSRKIPRPKPTPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASVGMLEARIRILTNNSQTPILSSQEVVSCSQYAQGCEGGFPYLTAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVYHGPLAVAFEVYDDFLHYQNGIYHH-------TGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTSWGEDGYFRIRRGTDECAIESIAVAATPI 460          
BLAST of Dipeptidyl peptidase 1 vs. UniProt/SwissProt
Match: sp|O97578|CATC_CANLF (Dipeptidyl peptidase 1 (Fragment) OS=Canis lupus familiaris OX=9615 GN=CTSC PE=1 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 2.228e-148
Identity = 223/446 (50.00%), Postives = 286/446 (64.13%), Query Frame = 2
Query:   92 DTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVPTKTLTLIYPNL--AIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK------HVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            DTPANC++ + +G W  QV  +   +   +    P K + +    L  A D+FGN G +T+IYNQGFE+ + + K+F +F +K+     T SYCN     W HDVL R W CF   K+    EK      H+   Q N    ++ LY      V  IN     W A  Y E+   TL  ++   GG   K+ RPKP P+T      +  +P S+DWRNV G N+VSPVRNQ  CGSCY+FAS  MLEAR RI +NNT +PILSPQ++V CS Y+QGCEGGFPYLIAGK+A+DFG+ +E+C PY G D  C    +C RYY+++Y Y+GGFYGA NE LM++ELVR+GP+AV FEVYDDF  YQ G+Y+H       T  +  FNPFELTNHAVL+VGYG ++A+G  +W VKNSWGS WGE+GYFRIRR  DEC IES+ VA+ PI
Sbjct:    1 DTPANCTHPELLGTWVFQVGPAGSRSVNCSVMGPPEKKVVVHLEKLDTAYDNFGNTGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGHKVT-SYCNETMTGWVHDVLGRNWACFTGTKMGTTSEKAKVNTKHIERLQENN---SNRLYKYNYEFVKAINTIQKSWTATRYIEYETLTLRDMMTRVGG--RKIPRPKPTPLTAEIHEEISRLPTSWDWRNVRGTNFVSPVRNQASCGSCYAFASTAMLEARIRILTNNTQTPILSPQEIVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYAGSDSPCK-PNDCFRYYSSEYYYVGGFYGACNEALMKLELVRHGPMAVAFEVYDDFFHYQKGIYYH-------TGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGSRWGEDGYFRIRRGTDECAIESIAVAATPI 432          
BLAST of Dipeptidyl peptidase 1 vs. TrEMBL
Match: T1IR55 (Pept_C1 domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 2.790e-157
Identity = 234/444 (52.70%), Postives = 290/444 (65.32%), Query Frame = 2
Query:   83 ALSDTPANCSYQDAIGKW-----QVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            +++DTPANC+Y D  G W     +   S         + V    L L +PNL +DD GN G WT+IYNQGFEV I  +KYF +  FKQ     T +YC++  P W HD+L+R W CF  +K+    EK++ + +S +  +    Y + K  +N INN+   W AK Y  F + +  +++ M GG  SK+ H PK +P++         +P  FDWRNV+GVNY+SP+RNQG CGSCYSFAS  MLEAR RI +NNT   I +PQDVV CS YSQGCEGGFPYLIAGK+A+DFG+  E+C PY G D KCS  K C R Y +KY Y+GGFYG  NE LMR  +V NGP+AVGF+VY DFM Y SG+YHH     K       FNPFELTNHAVLVVGYGE   G  FW VKNSWG+GWGENG+FRIRR NDEC IESLG+ + PI
Sbjct:   18 SVADTPANCTYDDIQGNWIFYETERSRSTNENCDKIGSVVYKTQLKLKFPNLVVDDLGNIGFWTIIYNQGFEVVINQRKYFAFSLFKQSGQNAT-NYCDQTFPGWSHDILVRNWACFMGKKVGLWPEKYISLSKSQVNGM----YRTNKGFINEINNKQTLWTAKVYSHFEKLSHEELLSMRGGRKSKIIHLPKSSPISREIEKLTSNLPLVFDWRNVSGVNYISPIRNQGTCGSCYSFASMAMLEARLRIYTNNTNQVIFAPQDVVSCSEYSQGCEGGFPYLIAGKYAQDFGVIPENCYPYSGRDEKCS-GKKCTRTYVSKYSYVGGFYGGCNEALMRYAIVHNGPVAVGFQVYPDFMQYSSGIYHHSGVLEK-------FNPFELTNHAVLVVGYGE-ENGVLFWIVKNSWGTGWGENGFFRIRRGNDECSIESLGMEAVPI 447          
BLAST of Dipeptidyl peptidase 1 vs. TrEMBL
Match: A0A023PJH7 (Cathepsin C OS=Sinonovacula constricta OX=98310 PE=2 SV=1)

HSP 1 Score: 463.381 bits (1191), Expect = 1.939e-156
Identity = 230/464 (49.57%), Postives = 298/464 (64.22%), Query Frame = 2
Query:   41 MILRIILSIGLLHFALSDTPANCSYQDAIGKW-----QVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEK-HVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLH-RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATG----EKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            +++ + + + +L    +DTPANC+Y+D  G W     Q   +N     S +       + L++P+LAID FGN G WTLIYNQGFE+ I  +KYF +  +KQ  ST  +S C+++ P W HDVL   W CF   K      K H  +P+     L    Y S   ++ TIN     W A  YP+F       ++RMAGG  S++H +P PAP+T+     +K +P  FDWRNV+G N+VSP+RNQ  CGSCY+F+S  M EAR RI +NNT  P+ S QD+VECS YSQGCEGGFPYLI GK+AEDFG+ +ESCNPYKG D  CST  NC R Y+T+Y+Y+GGFYGA NE LMR+ LV+ GP+AV FEVY+DFM Y+SGVYHH     K       FNPFE+TNHAVL+VGYG   +     + +W VKN WG+GWGE+ YFRI R  DEC IES+ V S P++
Sbjct:    6 VLVPVFVCLSVLSQVGADTPANCTYEDVKGTWVFQIGQEGYTNTLNCTSFNNPQVDYKVELLFPDLAIDQFGNKGFWTLIYNQGFELVIGGRKYFAFSKYKQSGST-VVSMCDQILPGWSHDVLGHNWACFLGAKNERQKVKVHTDLPR-----LTGYKYQSDIELIKTINQGQNSWKAVQYPQFENMDFEDMIRMAGGRKSRIHNKPSPAPITQEQHQQLKSLPAEFDWRNVDGSNFVSPIRNQASCGSCYAFSSLAMNEARVRILTNNTRQPVFSTQDIVECSEYSQGCEGGFPYLIGGKYAEDFGLVEESCNPYKGRDDACSTVPNCPREYSTRYEYVGGFYGACNEALMRINLVKYGPMAVAFEVYNDFMHYKSGVYHHTGAVNK-------FNPFEITNHAVLLVGYGTDTSDMNNPKDYWIVKNGWGTGWGEDDYFRILRGVDECSIESIAVQSFPVM 456          
BLAST of Dipeptidyl peptidase 1 vs. TrEMBL
Match: A0A493TDE3 (Cathepsin C OS=Anas platyrhynchos platyrhynchos OX=8840 GN=CTSC PE=3 SV=1)

HSP 1 Score: 463.381 bits (1191), Expect = 2.058e-156
Identity = 233/448 (52.01%), Postives = 290/448 (64.73%), Query Frame = 2
Query:   86 LSDTPANCSYQDAIGKWQVXXXXXXXXXXXXXXV-PTKTLTLI---YPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLS------NLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            ++DTPANCS+ D +G WQ+            +   P +   L+     ++A D  GN+G +TLIYNQGFE+ + N K+F +F +K+     T SYCN   P W HDVL   W CF  QK+S      ++ +  +H PQ     L+S  Y      VN IN Q   W A  Y E+    L ++ R AGG  S+  RPKPAP+T   L  V  +P+S+DWRNVNGVNYVSPVRNQ  CGSCY+FAS GMLEAR RI +NNT  PI SPQ VV CS YSQGC+GGFPYLIAGK+ +DFG+ +E C PY  +D  C   ++C  YY ++Y Y+GGFYG  NE LM++ELV  GP+AV FEVYDDFM Y+ G+YHH       T  K  FNPFELTNHAVL+VGYG +  +GEKFW VKNSWG+ WGE+GYFRIRR  DEC IES+ VA+ PI
Sbjct:   21 VADTPANCSFADLLGAWQLRVWRGGGRHGNCSQAGPVEKTVLVNLQKLDVAQDSLGNYGFFTLIYNQGFEIVLNNYKWFAFFKYKKEGQKVT-SYCNETLPGWVHDVLGHNWACFSGQKISSSPSDVHVNQLPLHKPQGR---LSSRRYVHNFDFVNAINTQQKSWRATRYKEYENFALEELTRRAGGLYSRTSRPKPAPLTPELLKKVSGLPESWDWRNVNGVNYVSPVRNQASCGSCYAFASMGMLEARIRILTNNTQKPIFSPQQVVSCSQYSQGCDGGFPYLIAGKYVQDFGVVEEDCFPYTAQDSPCLFKRSCYHYYTSEYHYVGGFYGGCNEALMKLELVLGGPMAVAFEVYDDFMLYKEGIYHH-------TGLKDDFNPFELTNHAVLLVGYGKDPRSGEKFWIVKNSWGTSWGEDGYFRIRRGTDECAIESIAVAATPI 457          
BLAST of Dipeptidyl peptidase 1 vs. TrEMBL
Match: F1NWG2 (Pept_C1 domain-containing protein OS=Gallus gallus OX=9031 GN=CTSC PE=3 SV=2)

HSP 1 Score: 465.692 bits (1197), Expect = 3.276e-156
Identity = 235/458 (51.31%), Postives = 298/458 (65.07%), Query Frame = 2
Query:   53 IILSIGLLHFAL-SDTPANCSYQDAIGKWQVXX-XXXXXXXXXXXXVPTKTLTLI---YPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNI----FALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            ++  + +L   L +DTPANCSY D +G W++          + S   P +   L+     ++A D  GNFG +TLIYNQGFE+ + N K+F +F +K+     T SYCN   P W HDVL R W CF  QK+S+     VH+ Q  +      L+S  +      VN IN     W A  Y E+   +L ++ R AGG  S+  RPKPAP+T   L  V  +P+S+DWRNVNGVNYVSPVRNQ  CGSCY+FAS GMLEAR RI +NNT  P+ SPQ VV CS YSQGC+GGFPYLIAGK+ +DFG+ +E C PY  +D  C   ++C  YY ++Y Y+GGFYGA NE LM++ELV +GP+AV FEVY+DFM Y+ G+YHH       T  K  FNPFELTNHAVL+VGYG +  +GEKFW VKNSWG+ WGE+GYFRIRR  DEC IES+ VA+ PI
Sbjct:   81 VVAVLAMLPAGLRADTPANCSYADLLGSWELRVWRAGGRHGNCSQAAPVEKTVLVNLQKLDVAQDSLGNFGFFTLIYNQGFEIVLNNYKWFAFFKYKKEGLNVT-SYCNETLPGWVHDVLGRNWACFTGQKISS-SSSDVHVRQLPLQKPRVGLSSRRFVHNFDFVNAINAHQKSWRATRYEEYENFSLEELTRRAGGLYSRTSRPKPAPLTPELLKKVSGLPESWDWRNVNGVNYVSPVRNQASCGSCYAFASMGMLEARIRILTNNTQKPVFSPQQVVSCSQYSQGCDGGFPYLIAGKYVQDFGVVEEDCFPYTAKDTPCLFKRSCYHYYTSEYHYVGGFYGACNEALMKLELVLSGPMAVAFEVYNDFMFYKEGIYHH-------TGLKDEFNPFELTNHAVLLVGYGKDPESGEKFWIVKNSWGTSWGEDGYFRIRRGTDECAIESIAVAATPI 529          
BLAST of Dipeptidyl peptidase 1 vs. TrEMBL
Match: A0A2T7NUA9 (Pept_C1 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15246 PE=3 SV=1)

HSP 1 Score: 461.455 bits (1186), Expect = 1.542e-155
Identity = 233/474 (49.16%), Postives = 310/474 (65.40%), Query Frame = 2
Query:   23 RYKIV*MILRIILSIGLLHFALSDTPANCSYQDAIGKWQVXXXX---XXXXXXXXXXVPTKT---LTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQK------HIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGED-GKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            R + V  IL I  +   +     DTPANC+Y+D  GKW  +       +T    +   P K+   + L+YP++A+D FGN G WT+IYNQGFEV +  +KYF + ++     + T SYCN L P W HD+L   W C+  ++ + L  +     +  I + +S+L   ++      ++V  IN     W A  YP    + + +++ MAGG  SK+  RP PAPVT+  L +V  +P++FDWR+V G+NYVSPVR+QG CGSCY+FAS  M EAR RI +NNT  P+ SPQDV++CSPYSQGC+GGFPYLI GK+AED+G+  ES NPY+G+D G C T  + +R+Y+TKY+YIGG+YGA NEPLMR  L  NGP+AVGFEV DDFM Y+ G+YHH       T    GF PF+LTNHAVLVVGYG +  TGE +W VKNSWG+ WGENG+FRIRR NDEC  ES+ + S PI+
Sbjct:    4 RMQDVCKILFIFFA--FMTVVYGDTPANCTYEDIKGKWTFYIGQGNFDNTINCQNFSGPFKSDLQVQLLYPDIAVDQFGNTGFWTIIYNQGFEVVVAGRKYFAFSNYTSDGQSVT-SYCNELLPGWTHDLLGHDWACYVGKRAAPLAGQVHESGKKTISSASSVLRFQKRKFYNDMNLVAKINAAQSSWTAVAYPHLEGRDMQELLMMAGGPRSKVVSRPSPAPVTKKVLEAVSLMPEAFDWRDVGGINYVSPVRDQGSCGSCYAFASMAMNEARVRIMTNNTEQPVFSPQDVLDCSPYSQGCDGGFPYLIGGKYAEDYGLVLESENPYRGQDQGSCRTPSSAKRHYSTKYEYIGGYYGACNEPLMRKNLYENGPLAVGFEVLDDFMHYKGGIYHH-------TGLTNGFEPFQLTNHAVLVVGYGTDVETGEDYWIVKNSWGTEWGENGFFRIRRGNDECAFESMALQSTPII 467          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Cavefish
Match: ctsc (cathepsin C [Source:NCBI gene;Acc:103046262])

HSP 1 Score: 451.055 bits (1159), Expect = 5.350e-155
Identity = 228/459 (49.67%), Postives = 296/459 (64.49%), Query Frame = 2
Query:   44 ILRIILSIGLLHFALSDTPANCSYQDAIGKW-----QVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKH-VHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGET-ATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            +L ++L++     + +DTPANC+Y++ +G W      V   +     +    V T T+TL   ++A+DD G+ G +TLIYNQGFEV + + K+FG+F + Q  S  T SYC++  P W HDVL R W CF  +K+ +L  K  ++ P +  +     +Y      VN IN+    W A  Y E    T  +++  AGG SS+   R +PAPVT   L     +P+ +DWRNVNGVNYVSPVRNQ  CGSCYSFA+ GMLEAR RI +NNT +P+ SPQ VV CS YSQGC+GGFPYLI GK+ +DFG+ +ESC PY  +D  C+    C RYY + Y Y+GGFYG  +E  M +ELVR+GP+ V  EVY DFM+Y+ G+YHH       T  +   NPFELTNHAVL+VGYG    TGEK+W VKNSWGSGWGENGYFRIRR  DEC IES+ VA+ PI
Sbjct:    6 VLALVLAL-WAGVSRADTPANCTYEELLGTWVFQVSNVGQGSSINCTAPGPAVKTVTVTLQKLSVAVDDLGHTGFFTLIYNQGFEVVVNDYKWFGFFKYSQQGSVVT-SYCDQTLPGWVHDVLGRNWACFTGKKVQSLKPKSSINPPHALSYNPYVQMYKENTDFVNKINSVQKSWRAAVYSEHQTLTTQELLLRAGGLSSRTPQRVRPAPVTAETLKMAAGLPERWDWRNVNGVNYVSPVRNQASCGSCYSFATMGMLEARVRILTNNTRTPVFSPQQVVSCSEYSQGCDGGFPYLI-GKYVQDFGIVEESCFPYTAKDSPCNVPAKCLRYYTSDYHYVGGFYGGCSETAMMLELVRDGPMGVALEVYPDFMNYKEGIYHH-------TGLRDVLNPFELTNHAVLLVGYGRCHKTGEKYWIVKNSWGSGWGENGYFRIRRGTDECAIESIAVAATPI 454          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Cavefish
Match: ctsc (cathepsin C [Source:NCBI gene;Acc:103046262])

HSP 1 Score: 448.743 bits (1153), Expect = 4.229e-154
Identity = 231/466 (49.57%), Postives = 299/466 (64.16%), Query Frame = 2
Query:   44 ILRIILSIGLLHFALSDTPANCSYQDAIGKW-----QVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKH--------IVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGET-ATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            +L ++L++     + +DTPANC+Y++ +G W      V   +     +    V T T+TL   ++A+DD G+ G +TLIYNQGFEV + + K+FG+F + Q  S  T SYC++  P W HDVL R W CF  +K+ +L       P+S+I   ++L Y   K+         VN IN+    W A  Y E    T  +++  AGG SS+   R +PAPVT   L     +P+ +DWRNVNGVNYVSPVRNQ  CGSCYSFA+ GMLEAR RI +NNT +P+ SPQ VV CS YSQGC+GGFPYLI GK+ +DFG+ +ESC PY  +D  C+    C RYY + Y Y+GGFYG  +E  M +ELVR+GP+ V  EVY DFM+Y+ G+YHH       T  +   NPFELTNHAVL+VGYG    TGEK+W VKNSWGSGWGENGYFRIRR  DEC IES+ VA+ PI
Sbjct:    6 VLALVLAL-WAGVSRADTPANCTYEELLGTWVFQVSNVGQGSSINCTAPGPAVKTVTVTLQKLSVAVDDLGHTGFFTLIYNQGFEVVVNDYKWFGFFKYSQQGSVVT-SYCDQTLPGWVHDVLGRNWACFTGKKVQSLK------PKSSINPPHALSYNPYKYSVFKYNTDFVNKINSVQKSWRAAVYSEHQTLTTQELLLRAGGLSSRTPQRVRPAPVTAETLKMAAGLPERWDWRNVNGVNYVSPVRNQASCGSCYSFATMGMLEARVRILTNNTRTPVFSPQQVVSCSEYSQGCDGGFPYLI-GKYVQDFGIVEESCFPYTAKDSPCNVPAKCLRYYTSDYHYVGGFYGGCSETAMMLELVRDGPMGVALEVYPDFMNYKEGIYHH-------TGLRDVLNPFELTNHAVLLVGYGRCHKTGEKYWIVKNSWGSGWGENGYFRIRRGTDECAIESIAVAATPI 455          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Cavefish
Match: ctsk (cathepsin K [Source:NCBI gene;Acc:103044235])

HSP 1 Score: 140.198 bits (352), Expect = 5.692e-37
Identity = 91/240 (37.92%), Postives = 128/240 (53.33%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIG-GFYGATNEPLMRMELVRNGPIAVGFEVYDD-FMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIESLGVASEPIL 1399
            +PKS D+R +    YVSPVRNQG CGSC++F+S G LE +    +   +   LSPQ++V+C   + GC GG+          + G+  E   PY GED +C+  K+ +      +K +  G  GA    L ++     GP++VG +     F  Y+ GVY+ D    K           E  NHAVL VGYG T  G+K+W VKNSWG  WG+ GY  + R  N+ CGI +L  AS P++
Sbjct:  116 LPKSIDYRKLG---YVSPVRNQGSCGSCWAFSSVGALEGQLMKTTGQLVE--LSPQNLVDCVKENDGCGGGYMTNAFNYVKTNKGIDSEEAYPYVGEDQQCAYNKSGKAAACRGFKEVKKGSEGALTSALAKV-----GPVSVGIDAMQSTFQFYKRGVYY-DPNCDK-----------ENINHAVLAVGYGVTPKGKKYWIVKNSWGEEWGKQGYVLMARNRNNACGIANL--ASFPVM 331          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Cavefish
Match: ctsh (cathepsin H [Source:NCBI gene;Acc:103043563])

HSP 1 Score: 139.043 bits (349), Expect = 1.660e-36
Identity = 90/259 (34.75%), Postives = 125/259 (48.26%), Query Frame = 2
Query:  632 LHRPKPAPVTE-YHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSP--YSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            L  P+    T+  H++S    P S DWR     N+V+ V+NQG CGSC++F++ G LE+   I S     P+LS Q +V+C+    + GC GG P         + G+  E   PY   DG C         +      I  +    +E  M   + R  P++  ++V  DFMSY SGVY           S    N  +  NHAVL VGYGE   G  +W VKNSWGS WG +GYF I R  + CG+ +      P++
Sbjct:   94 LTEPQNCSATKGSHVSSNGPYPDSIDWRKKG--NFVTAVKNQGSCGSCWTFSTTGCLESVTAIASGKL--PLLSEQQLVDCAGDFNNHGCNGGLPSQAFEYIKYNKGIMTEDDYPYTARDGPCKYNPKQAAAFVKDVVNITIY----DEMGMVDAVARLNPVSFAYQVTSDFMSYTSGVY----------TSTECHNTTDTVNHAVLAVGYGE-QNGTPYWIVKNSWGSSWGMDGYFFIERGKNMCGLAACSSYPLPLV 333          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Cavefish
Match: ctss2.1 (cathepsin S [Source:NCBI gene;Acc:103044830])

HSP 1 Score: 133.65 bits (335), Expect = 1.242e-34
Identity = 89/268 (33.21%), Postives = 135/268 (50.37%), Query Frame = 2
Query:  581 EKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYD-DFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIES 1372
            + T  +I+ M  G     H  K +    +   +   +P S DWR      YV+ V+ QG CGSC++F++AG LE +    +   +S  LSPQ++V+CS    ++GC GGF         ++ G+  ++  PY G DG+C    + +    T Y     F    NE  ++  +   GP++V  +     F+ Y+SGVY+    T+ +             NH VLVVGYG T  GE +W VKNSWG+G+G+ GY R+ R   + CGI S
Sbjct:   80 DLTREEILDMMAGTRVPSHLKKRSSFVSF---AGVQVPDSVDWREKG---YVTNVKQQGACGSCWAFSAAGALEGQLMRTTGQLVS--LSPQNLVDCSSKYGNKGCHGGFMSRAFQYVIDNGGIDSDASYPYNGMDGQCKYNPSDRAANCTSYS----FLPEGNEEALKTAVATIGPVSVAIDATRPQFILYRSGVYYDPSCTKNV-------------NHGVLVVGYG-TLNGEDYWLVKNSWGTGFGDGGYIRMARNKGNMCGIAS 321          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Sea Lamprey
Match: ctsc (cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9])

HSP 1 Score: 411.764 bits (1057), Expect = 3.604e-140
Identity = 226/464 (48.71%), Postives = 296/464 (63.79%), Query Frame = 2
Query:   65 IGLLHFALSDTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVP---TKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKH--------IVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKL-HRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKC-STTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETA-----TGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
             G L    +DTP NCSY D +G W  QV     ++S   S+  P   + T+ L   +LA D+ G  G +T++YNQGFE+ + N K+F +F ++Q      ISYC++  P W HD L   W CF+ +++S+       +P+S    L++  Y S+           V+ IN+    W A  Y +   + + +IVR +GG  S + +RP+ A  ++        +P ++DWR+V GV+YVSPVR+QG CGSCYSFAS  MLEAR RI SNNT  P+ SPQ +V CSPYSQGC+GGFPYLIAGKFA+DFG+ +ESC PY G+D KC     +C RYY  +Y Y+GGFYGA +E LMR+ELV NGP+A+GF+VYDDFM+YQ G+YHH       T  +  FNPFE TNHAVL+VGYG  A     TGE FW VKNSWG GWGE GYFRIRR NDEC  ES+ +A+ PI
Sbjct:   17 FGALGGGWADTPVNCSYADLLGTWVLQVGKGGQNSSIDCSSMGPPVQSVTVHLQKFDLASDELGRPGFFTIVYNQGFEIELNNYKWFAFFKYEQAGGK-VISYCDQTFPGWVHDSLGHNWACFQGKRVSS----GPSVPRST--PLDAATYKSEPQKLYEYNPAFVHAINSAQSSWRAGRYLDMERRPMEEIVRRSGGTGSIIPNRPRAAAASDETRRRAAVLPAAWDWRDVRGVSYVSPVRDQGACGSCYSFASMAMLEARVRILSNNTQQPVFSPQHIVSCSPYSQGCDGGFPYLIAGKFAQDFGVIEESCYPYIGQDSKCLPKDPSCLRYYTARYHYVGGFYGACSEELMRLELVENGPLAIGFQVYDDFMAYQGGIYHH-------TGLRDQFNPFEETNHAVLLVGYGTDAAGPEGTGEPFWIVKNSWGEGWGEGGYFRIRRGNDECAFESIAMAATPI 466          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Sea Lamprey
Match: ctsc (cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9])

HSP 1 Score: 207.608 bits (527), Expect = 4.781e-64
Identity = 105/236 (44.49%), Postives = 143/236 (60.59%), Query Frame = 2
Query:  185 VPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLH-RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQG 889
            V    L L+  N+A D+ GN GT+T+IYNQGFEV +   K+F +F+F Q+ +  T S C   +  W HDVL R W CF+ +++     +  H        +  +LY      V  +N+    W A  YP +   +L ++ R AGG +S++H RPKPA VTE        +P S+DWRNVNG+NYVSP+RNQG CGSCYSF+S  MLEAR RI +N + +PILS Q +V CS +SQG
Sbjct:    8 VQVVRLHLLKMNVAADEKGNQGTFTIIYNQGFEVVLAGYKWFAFFNFTQVGTVVT-SLCAETRAGWVHDVLGRNWACFRGRQVKPRSWR-AHAACLLAKQVRHMLYEHNAAFVQRVNDAQRSWRAVRYPLYDGLSLGELTRRAGGRASRIHGRPKPAVVTEETRRLASSLPTSWDWRNVNGINYVSPIRNQGSCGSCYSFSSMAMLEARIRILTNASQTPILSTQQIVSCSKFSQG 241          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Sea Lamprey
Match: ctsc (cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9])

HSP 1 Score: 204.142 bits (518), Expect = 1.103e-62
Identity = 108/240 (45.00%), Postives = 144/240 (60.00%), Query Frame = 2
Query:  185 VPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSL----LYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLH-RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQG 889
            V    L L+  N+A D+ GN GT+T+IYNQGFEV +   K+F +F+F Q+ +  T S C   +  W HDVL R W CF+ +++S       +     I A   L    LY      V  +N+    W A  YP +   +L ++ R AGG +S++H RPKPA VTE        +P S+DWRNVNG+NYVSP+RNQG CGSCYSF+S  MLEAR RI +N + +PILS Q +V CS +SQG
Sbjct:    8 VQVVRLHLLKMNVAADEKGNQGTFTIIYNQGFEVVLAGYKWFAFFNFTQVGTVVT-SLCAETRAGWVHDVLGRNWACFRGRQVSV--HNGFYFSPDGITAEVHLSTRWLYEHNAAFVQRVNDAQRSWRAVRYPLYDGLSLGELTRRAGGRASRIHGRPKPAVVTEETRRLASSLPTSWDWRNVNGINYVSPIRNQGSCGSCYSFSSMAMLEARIRILTNASQTPILSTQQIVSCSKFSQG 244          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007755.1 (pep scaffold:Pmarinus_7.0:GL476381:1843:17023:-1 gene:ENSPMAG00000007008.1 transcript:ENSPMAT00000007755.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.953e-36
Identity = 91/274 (33.21%), Postives = 142/274 (51.82%), Query Frame = 2
Query:  572 EFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSP--YSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGY-FRIRRANDECGIESLGV 1381
            E+HEK + +   +  G      R + AP   + L S+  +P+  DWR + G  YV+PV+ QG CGS ++F++ G LE ++   + N  S  LS Q +V+C+   Y+ GC GG          ++ G+  E   PY+  DGKC           + Y+++     ++NE ++R  +   GPIA+      D F  Y+SG+++     +               NHA+LVVGYG + +G  FW VKNSWG  WGE GY + IR  +++CGI S+G+
Sbjct:   86 EYHEKVVGRFWNLRNGT-----RRRGAP---FPLRSMDNLPEQVDWR-LKG--YVTPVKEQGLCGSSWAFSATGSLEGQHFAATGNLTS--LSEQQLVDCTKSYYNNGCNGGRSERALQYIIDNNGIDSELSYPYEHADGKCRFKPANVATKCSSYQFV---EPSSNEEVLRQAVASVGPIAIAMNADLDTFKHYKSGLFNEPSCDKS-------------PNHAMLVVGYG-SLSGNDFWIVKNSWGEDWGEKGYIYMIRNKDNQCGIASIGI 329          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Sea Lamprey
Match: ctsf (cathepsin F [Source:ZFIN;Acc:ZDB-GENE-030131-9831])

HSP 1 Score: 130.183 bits (326), Expect = 1.708e-34
Identity = 85/245 (34.69%), Postives = 125/245 (51.02%), Query Frame = 2
Query:  632 LHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGI 1366
            L RP+   + +  +     IP +FDWR+   V   + V+NQG CGSC++F+  G +E ++ IK  + +S  LS Q++V+C     GC GG          E  G+  ES   YKG+  +C  ++   R Y       G    +++E  M   LV++GPI++          Y+ G+ H           K     +EL NHAVL+VGYG T  G  FW +KNSWG GWGE GY+R+ R +  CG+
Sbjct:   56 LSRPREVGLRQAQIPPGP-IPPAFDWRDRGAV---TEVKNQGECGSCWAFSVTGNIEGQWAIKKGSLLS--LSEQELVDCDKLDYGCGGGLQMNAYKTIQELGGLMTESDYSYKGDMEQCGFSQAKVRAYIN-----GSVSISSDEDEMAAWLVKHGPISIALNALG-MQFYKHGIAH---------PWKILCWSWEL-NHAVLIVGYG-TEKGVPFWIIKNSWGVGWGEEGYYRVFRGDGVCGL 277          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Nematostella
Match: EDO38122 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDR5])

HSP 1 Score: 164.466 bits (415), Expect = 1.317e-46
Identity = 103/307 (33.55%), Postives = 152/307 (49.51%), Query Frame = 2
Query:  512 KHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESC-NPYKGEDGKCSTTKNC----------QRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            + +V+ IN  N+GW A  YP+F   T      M G   S+   P+ +   E  +   + IP++FD R       + P+RNQG CGSC++F ++ +L  R+ I S N I   LS Q +V+C   + GC GG+P + A  +    G+  E C  PY  +   C  T N            R+Y  K  Y      A N   ++ +++ NGP+   F ++ DF +Y+SG+Y H   T K           +L  HA+ ++G+G T     +W   NSWG+ WG  GYF+IRR  DECGIE    A  P+L
Sbjct:   27 RDLVDKINTLNVGWEATLYPQFENLTFESAKSMLG---SRGAWPEGSLPPEIEVRVAENIPENFDARK-QWPGSIHPIRNQGQCGSCWAFGASEVLSDRFAIASKNQIYVTLSAQQLVDCDLDNSGCSGGWP-INAWNYMVKTGLLTEQCYGPYYAKQYTCRLTANTTDCPWQPGVKARFYHAKSAYK---LPAKNVEAIQTDIMNNGPVEADFTIFQDFYAYRSGIYVH--ATGK-----------QLGGHAIKILGWG-TEDNVDYWLCANSWGANWGIQGYFKIRRGTDECGIEDGLAAGLPLL 311          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Nematostella
Match: EDO42751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0K3])

HSP 1 Score: 142.895 bits (359), Expect = 6.884e-39
Identity = 91/257 (35.41%), Postives = 132/257 (51.36%), Query Frame = 2
Query:  605 RMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESL 1375
            +M  G+   L+  K A +       +  IP+S DWR+  GV  V+PV+NQG CGSC++F++ G +E +Y IK+   +S  LS Q++V+C    +GCEGG P     +  +  G+  ES  PYKG D KC   K   +        I     + +E  +   L +NGPI++G     + M +  G   H +K           NP  L NH VL+VGYG    G  +W +KNSWG  WGE GY+ I R    CG+ ++
Sbjct:   41 KMMPGWGKPLYEMKDAEIP------LGDIPESVDWRD-KGV--VTPVKNQGSCGSCWAFSTTGNIEGQYAIKTGKLVS--LSEQELVDCDTIDKGCEGGLPSNAYKQIEKLGGLESESDYPYKGADSKCKFNKAEVKVTINSSVVI-----SKDEKEIAAWLAKNGPISIGINA--NAMQFYMGGIAHPWKIF--------CNPSSL-NHGVLIVGYG-VKNGTPYWIIKNSWGPSWGEKGYYLIYRGGGCCGLNTM 269          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Nematostella
Match: EDO34588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX0])

HSP 1 Score: 127.102 bits (318), Expect = 2.020e-33
Identity = 88/269 (32.71%), Postives = 128/269 (47.58%), Query Frame = 2
Query:  689 IPKSFDWRNV-NGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY-SQGCEGGFP-----------YLIAGKFAEDFGMAQESCNPYK---------GEDGKC---STTKNCQRYYATKY-------KYIG-GFYGATNEPL-MRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEP 1393
            +P  FD R        +  VR+QG CGSC++F +   +  RY IKS   + P +S +D++ C      GC GG+P            +  G++      + + C PYK         G+   C   S T  C+R     Y       K+ G   Y   ++P  ++ E++ NGP+   F VY DF +Y+SGVY H       + S  G        HA+ ++G+GE   G  +W V NSW S WG+ G+F+I+R NDECGIES  V   P
Sbjct:    4 VPDHFDSREQWPHCPTIKEVRDQGACGSCWAFGAVEAMSDRYCIKSEGKVMPHISAEDLLSCCETCGMGCNGGYPESAWDHWKSKGLVTGGQYD-----SHKGCQPYKIAACDHHVVGKLKPCKGDSPTPKCERKCEAGYNVSYSDDKHFGQSAYSVRSDPAEIQKEIMTNGPVEGAFTVYADFPTYKSGVYQH------TSGSALG-------GHAIKILGWGEE-NGTPYWLVANSWNSDWGDEGFFKIKRGNDECGIESGIVGGLP 253          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Nematostella
Match: EDO45852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL9])

HSP 1 Score: 126.331 bits (316), Expect = 2.419e-32
Identity = 111/365 (30.41%), Postives = 167/365 (45.75%), Query Frame = 2
Query:  332 INSTYTISYCNRLQ-PNWYHDVLIRQWRCFKAQKLSNLGEKHVH--IPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLH-RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPY--SQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDD-FMSYQSGVYHH-DFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRAN-DECGIESLGVASEPIL 1399
            I+S   +     LQ PNW      + W+ F  ++  N  E+ +   I Q+N+  +  + +   KH      N              + T  +I +   G   K H   +P   T     +VK +  S DWR+     YV+PV+NQG CGSC++F++ G LE ++  K+   +S  LS Q++V+CS    + GCEGG          E+ G+  E   PY  +DG C   K+      T +  I       +E  ++  L   GPI++  +     F  Y  GVY   D  + +L             +H VL VGYG T  G+ +W VKNSWG  WGE GY +I R + D+CG+ S   AS P++
Sbjct:   12 ISSALAMPPMEPLQDPNW------KAWKSFHGKEYPNKNEETMRNFIWQNNLKKI--VTHNEGKHSFKLAMNH-----------LGDMTSLEISQTLLGLKLKKHAESQPKGATFLPPANVKVV-DSIDWRSKG---YVTPVKNQGQCGSCWAFSTTGALEGQHFRKTGKLVS--LSEQNLVDCSGKYGNNGCEGGLMDNAFQYIKENGGIDTEKSYPYLAKDGVCHYNKSAIGAKDTGFVDI----PTGDENALQQALASVGPISIAIDASQSTFHFYHQGVYDDPDCSSTRL-------------DHGVLAVGYG-TDDGKDYWLVKNSWGPSWGEEGYIKIARNDHDKCGVAS--KASYPLV 331          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Nematostella
Match: EDO44165 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWG6])

HSP 1 Score: 124.02 bits (310), Expect = 1.990e-30
Identity = 115/406 (28.33%), Postives = 175/406 (43.10%), Query Frame = 2
Query:  197 TLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKP----APVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECS--PYSQGCEGGFPYLIAGKFAEDFGMA-QESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVY-DDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASE 1390
            TL   Y +  I D+ NF  W   Y+  FE+  T+ K F +   K + +   I+      P  +  V    +  FKA         H H  + +I+  N          + + N Q++G+  K      + T  ++ RM G     LH   P    +P +    +    +P   DWR    VN    V++QG CGSCY+FA AG LE  + IK+   +   LS Q +V+C+    ++GC+GG+PY       +  G+A +ES   Y  ++G C            KY  I       N   +++ +   GP+++        F  Y SG+Y+    T  L             +HA L VGYGE   G  +W VKNSW + WGE GY +I   +D CG+    V  +
Sbjct:  144 TLLSSYYDHYILDYHNFSAWKYQYSV-FEIP-TDIKCFEFSHEKNVGAVGEINPMFEFMP--HTAVQHHLFNAFKASYRKRYPSAHEHEKRKDIYRHNM-------RFIKSRNRQHLGYSLKP-NHMADMTDAEVNRMKG----LLHEEPPLIGDSPFSIPDKDRGVPLPPHVDWRKAGAVN---SVKSQGICGSCYAFAVAGALEGAHFIKTGLKLD--LSEQQIVDCTWGFGNRGCKGGYPYRAMQWILKHGGLATEESYGRYLAQEGYCHFKNTSIGARLDKYMSIR----QGNTSQLKLAVAFYGPVSILVNTQPKTFKFYGSGIYYDTQCTHAL-------------DHAALAVGYGEE-KGVSYWIVKNSWSAMWGEEGYIKIAMKDDNCGVAQKAVVVD 510          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Medaka
Match: ctsc (cathepsin C [Source:NCBI gene;Acc:101170449])

HSP 1 Score: 426.402 bits (1095), Expect = 1.800e-145
Identity = 225/449 (50.11%), Postives = 290/449 (64.59%), Query Frame = 2
Query:   71 LLHFALSDTPANCSYQDAIGKW--QVXXXXXXXXXXXXXXVP---TKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLH-RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGET-ATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            L+  A  DTPANC+Y+D +G W  QV       + + SA      + T+TL   ++A D+ GN G +TLIYNQGFEV I   K+FG+F + Q  S  T SYC++  P W HDVL   W CF  +K+ ++  +  + P  NI  L    Y   +  ++ IN+    W A  +PE    TL ++   AGG +S++  R +PAPVT         +P+S+DWRNV GVN+VSPVRNQ  CGSCYSFA+ GMLEAR R+ +NN+ +P+ SPQ VV CS YSQGC+GGFPYLI GK+++DFG+ +ESC PY  +D  C   +NC R Y  +YKY+GGFYG  +E  M  ELV +GP+AV FEVY DFM Y  G+YHH       T     FNPFELTNHAVL+VGYG    TGEK+W VKNSWG+ WGENG+FRIRR +DEC IES+ VA+ PI
Sbjct:   12 LIVGAWGDTPANCTYEDLLGTWVFQVSKGGHDQTINCSAEATGERSVTVTLEKLSVATDELGNTGFFTLIYNQGFEVVIGGYKWFGFFKYSQKGSEVT-SYCDQTLPGWVHDVLGNNWGCFVGKKVKSVPLRTDYKPVPNIRLLQKP-YKHNQDFIHLINSVQKSWRAAPHPEHEMYTLQELHYRAGGPASRVPVRVRPAPVTADLAKVAAALPESWDWRNVGGVNFVSPVRNQAACGSCYSFATMGMLEARVRVLTNNSQTPVFSPQQVVSCSEYSQGCDGGFPYLI-GKYSQDFGIVEESCFPYIAKDSPCGVPQNCGRAYTAEYKYVGGFYGGCSEMAMMKELVHHGPMAVAFEVYPDFMHYAGGIYHH-------TGLADPFNPFELTNHAVLLVGYGRCHKTGEKYWIVKNSWGTSWGENGFFRIRRGSDECSIESIAVAATPI 450          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Medaka
Match: ctsc (cathepsin C [Source:NCBI gene;Acc:101170449])

HSP 1 Score: 426.402 bits (1095), Expect = 2.499e-145
Identity = 223/458 (48.69%), Postives = 291/458 (63.54%), Query Frame = 2
Query:   53 IILSIGLLHFALSDTPANCSYQDAIGKWQVXXXXXXXXXXXXXXVPTK--------TLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLH-RPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGET-ATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
            + + + L+  A  DTPANC+Y+D +G W    S      + +    +K        T+TL   ++A D+ GN G +TLIYNQGFEV I   K+FG+F + Q  S  T SYC++  P W HDVL   W CF  +K+ ++  +  + P  NI  L    Y   +  ++ IN+    W A  +PE    TL ++   AGG +S++  R +PAPVT         +P+S+DWRNV GVN+VSPVRNQ  CGSCYSFA+ GMLEAR R+ +NN+ +P+ SPQ VV CS YSQGC+GGFPYLI GK+++DFG+ +ESC PY  +D  C   +NC R Y  +YKY+GGFYG  +E  M  ELV +GP+AV FEVY DFM Y  G+YHH       T     FNPFELTNHAVL+VGYG    TGEK+W VKNSWG+ WGENG+FRIRR +DEC IES+ VA+ PI
Sbjct:    6 VCVFLFLIVGAWGDTPANCTYEDLLGTWVFQVSKGGHDQTINCSSCSKYTTGERSVTVTLEKLSVATDELGNTGFFTLIYNQGFEVVIGGYKWFGFFKYSQKGSEVT-SYCDQTLPGWVHDVLGNNWGCFVGKKVKSVPLRTDYKPVPNIRLLQKP-YKHNQDFIHLINSVQKSWRAAPHPEHEMYTLQELHYRAGGPASRVPVRVRPAPVTADLAKVAAALPESWDWRNVGGVNFVSPVRNQAACGSCYSFATMGMLEARVRVLTNNSQTPVFSPQQVVSCSEYSQGCDGGFPYLI-GKYSQDFGIVEESCFPYIAKDSPCGVPQNCGRAYTAEYKYVGGFYGGCSEMAMMKELVHHGPMAVAFEVYPDFMHYAGGIYHH-------TGLADPFNPFELTNHAVLLVGYGRCHKTGEKYWIVKNSWGTSWGENGFFRIRRGSDECSIESIAVAATPI 453          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Medaka
Match: ctsk (cathepsin K [Source:NCBI gene;Acc:101164922])

HSP 1 Score: 140.969 bits (354), Expect = 3.028e-37
Identity = 97/278 (34.89%), Postives = 141/278 (50.72%), Query Frame = 2
Query:  572 EFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEV-YDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRI-RRANDECGIESLGVASEPIL 1399
            +F + T  ++V    G    L+ P+P    E   + +K +PKS D+R       V+ V+NQG CGSC++F+S G LE +   K+ N +   LSPQ++V+C   + GC GG+         E+ G+  E+  PY GED  C    +        YK +       +E  + + L + GP++VG +   + F+ YQ G+Y  D    K           E  NHAVL VGYG  A G+KFW VKNSWG  WG  GY  + R   + CGI +L  AS P++
Sbjct:   79 QFGDMTQEEVVERMTGLQMPLN-PEPRVPMETDGSLIK-LPKSVDYRKKG---MVTSVKNQGSCGSCWAFSSVGALEGQLAKKTGNLVD--LSPQNLVDCVTENDGCGGGYMTNAFKYVQENGGIDSEAAYPYMGEDQPCRYNVSGLAAQIKGYKEVP----EGDEHALAVALFKAGPVSVGIDASQNSFLYYQKGIYF-DRNCNK-----------EDINHAVLAVGYGVNAKGKKFWIVKNSWGETWGNKGYVLMARNRGNVCGIANL--ASYPVM 331          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Medaka
Match: ctsh (cathepsin H [Source:NCBI gene;Acc:111947539])

HSP 1 Score: 138.272 bits (347), Expect = 2.527e-36
Identity = 85/246 (34.55%), Postives = 124/246 (50.41%), Query Frame = 2
Query:  668 HLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSP--YSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            HL+S    P S DWR     NY++PV+NQG CGSC++F++ G LE+   I +   +S  LS Q +V+C+    + GC GG P         + G+  E   PY   + KC    +    +  +   +  +    +E  M   +  + P++  FEV  DFM+Y  GVY           S    +  +  NHAVL VGYG+   G  +W VKNSWGS WG +GYF I R  + CG+ +   AS P++
Sbjct:  100 HLSSKGPYPDSIDWRKKG--NYITPVKNQGACGSCWTFSTTGCLESVTAIATGKLLS--LSEQQLVDCAQDFNNHGCNGGLPSQAFEYIMYNKGLMTEQDYPYTAMEDKCMYKPSLAAAFVKEVVNVTAY----DEMGMVDAVATHNPVSFAFEVTSDFMNYHQGVY----------TSTECHSTADKVNHAVLAVGYGQ-ENGTPYWIVKNSWGSKWGMDGYFLIERGKNMCGLAA--CASFPVV 324          
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Medaka
Match: ctsbb (cathepsin B [Source:NCBI gene;Acc:101165526])

HSP 1 Score: 134.42 bits (337), Expect = 7.068e-35
Identity = 102/327 (31.19%), Postives = 152/327 (46.48%), Query Frame = 2
Query:  515 HIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFD----WRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVEC-SPYSQGCEGGFPYLIAGKFAEDFGM-------AQESCNPY----------------KGEDGKCSTTKNCQRYYATKY---KYIG--GFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPI 1396
             +++ +N  N  W A     FH K    +  + G   + L  PK  P   + +  +K +P SFD    W N   +  +   R+QG CGSC++F +A  +  R  I+S   IS  +S +D++ C      GC GGFP   A +F  + G+       ++  C PY                +GE         C   Y+  Y   K+ G   +   + +  +  EL +NGP+   F VY DF+ Y++GVY H      +T    G        HAV ++G+GE   G  +W V NSW S WG+ G+F+I+R NDECGIES  VA  P+
Sbjct:   28 EMIDFVNKLNTTWTAGQ--NFHNKDSSFVKGLCG---TILKGPK-LPELAHDVEGIK-LPDSFDPREQWPNCPTLKQI---RDQGNCGSCWAFGAAEAISDRICIQSGGKISLEISAEDLLTCCDECGMGCFGGFPS-AAWEFWTNKGLVTGGLFDSKVGCRPYTLAPCEHHVNGSRPPCQGEVETPKCVTQCNNGYSLSYPKDKHFGQRSYSIPSQQEQIMTELYKNGPVEAAFSVYADFLLYKNGVYQH------VTGDMLG-------GHAVKILGWGEE-NGTPYWLVANSWNSDWGDKGFFKIKRGNDECGIESEMVAGAPL 329          
BLAST of Dipeptidyl peptidase 1 vs. Planmine SMEST
Match: SMESG000077202.1 (SMESG000077202.1)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 453/453 (100.00%), Postives = 453/453 (100.00%), Query Frame = 2
Query:   41 MILRIILSIGLLHFALSDTPANCSYQDAIGKWQVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            MILRIILSIGLLHFALSDTPANCSYQDAIGKWQVFTSNFSTSCSTSAFVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL
Sbjct:    1 MILRIILSIGLLHFALSDTPANCSYQDAIGKWQVFTSNFSTSCSTSAFVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 453          
BLAST of Dipeptidyl peptidase 1 vs. Planmine SMEST
Match: SMESG000077197.1 (SMESG000077197.1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 315/453 (69.54%), Postives = 373/453 (82.34%), Query Frame = 2
Query:   41 MILRIILSIGLLHFALSDTPANCSYQDAIGKWQVXXXXXXXXXXXXXXVPTKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINSTYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALNSLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHRPKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASEPIL 1399
            M+++ ++   L+  +  DTPANC++QDA+GKW+++T++ + +CST +F   KT  LIYPN  +DDFGNFG WTLIYNQGFE+TI N  YFGYFDFK INSTY ISYC+RLQPNWYHDVLIRQWRCF+A+K+     K +    SN   L +  +GSQK +V+ IN +N+GW AKDYPEFH +TL+ I++M+GGF+S  +RPK APVT+    + +  PKSFDWRNVNGVN+VSPVR+QG CGSCYSFASAGMLEARYRIKSNNTI PILSPQDVVECSPYSQGC GGFPYLIAGK+A+DFGMA E CNPYKG+DGKCST KNC+RYYATKY+Y+GGFYG+TNEPLMRMELV NGPIAVGFEVY DF  Y++G+YHH FK   L  S+FGFNPFELTNHAVLVVGYGET  GEK+W VKNSWG  WGE GYF+IRR NDECGIESL VAS+PI+
Sbjct:    1 MLVKFLILFYLIQLSQCDTPANCTFQDAVGKWKIYTADLTKNCSTRSFTFQKTFFLIYPNTVMDDFGNFGKWTLIYNQGFEITINNMVYFGYFDFKTINSTYAISYCDRLQPNWYHDVLIRQWRCFRAEKVKKQNPKLIAFQYSNSRFLKTQKFGSQKALVDLINEKNVGWTAKDYPEFHNRTLHDIIQMSGGFNSLHNRPKSAPVTKIVRLTAEKFPKSFDWRNVNGVNFVSPVRSQGHCGSCYSFASAGMLEARYRIKSNNTIKPILSPQDVVECSPYSQGCNGGFPYLIAGKYAQDFGMADEKCNPYKGKDGKCSTIKNCKRYYATKYQYLGGFYGSTNEPLMRMELVINGPIAVGFEVYSDFRQYKNGIYHHVFKADNLMTSRFGFNPFELTNHAVLVVGYGETPAGEKYWIVKNSWGPKWGEGGYFKIRRGNDECGIESLAVASQPII 453          
BLAST of Dipeptidyl peptidase 1 vs. Planmine SMEST
Match: SMESG000063517.1 (SMESG000063517.1)

HSP 1 Score: 139.043 bits (349), Expect = 1.793e-36
Identity = 87/237 (36.71%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGED-----GKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGV 1381
            +P SFDWR    V   + V+NQG CGSCY+FA+ G LEA+   K+   IS  LS Q +V+C     GC+GGF          + G+  E   PY   +      KC+  K+  +  AT   ++     A +E  M+  LV  GPI+V          Y SG++H D +  KL             NHAVL+VGYG +  +G  +W +KNSW S WGENGYFR+ R  + C +  + V
Sbjct:  139 LPDSFDWREKGAV---TEVKNQGFCGSCYAFATTGTLEAQIWRKTGKLIS--LSEQQIVDCDTNDDGCDGGFVQDALSYIKSNGGIENEESYPYISSETFKPNSKCNFFKS--KVVATDTGFVQ--MPANDETKMKEALVTIGPISVAISATKSLKRYTSGIFHED-ECDKLKL-----------NHAVLIVGYGTDQTSGTPYWIIKNSWSSFWGENGYFRLPRNINACKVAMMPV 354          
BLAST of Dipeptidyl peptidase 1 vs. Planmine SMEST
Match: SMESG000063517.1 (SMESG000063517.1)

HSP 1 Score: 139.043 bits (349), Expect = 1.999e-36
Identity = 87/237 (36.71%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  689 IPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGED-----GKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYG-ETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGV 1381
            +P SFDWR    V   + V+NQG CGSCY+FA+ G LEA+   K+   IS  LS Q +V+C     GC+GGF          + G+  E   PY   +      KC+  K+  +  AT   ++     A +E  M+  LV  GPI+V          Y SG++H D +  KL             NHAVL+VGYG +  +G  +W +KNSW S WGENGYFR+ R  + C +  + V
Sbjct:  136 LPDSFDWREKGAV---TEVKNQGFCGSCYAFATTGTLEAQIWRKTGKLIS--LSEQQIVDCDTNDDGCDGGFVQDALSYIKSNGGIENEESYPYISSETFKPNSKCNFFKS--KVVATDTGFVQ--MPANDETKMKEALVTIGPISVAISATKSLKRYTSGIFHED-ECDKLKL-----------NHAVLIVGYGTDQTSGTPYWIIKNSWSSFWGENGYFRLPRNINACKVAMMPV 351          
BLAST of Dipeptidyl peptidase 1 vs. Planmine SMEST
Match: SMESG000005279.1 (SMESG000005279.1)

HSP 1 Score: 134.42 bits (337), Expect = 5.607e-34
Identity = 80/231 (34.63%), Postives = 115/231 (49.78%), Query Frame = 2
Query:  695 KSFDWRNVNGVNYVSPVRNQGGCGSCYSFASAGMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDFGMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMELVRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAVLVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVAS 1387
            ++ DWR + GV   S V+NQG CGSC++F++ G +E ++ +K+   +S  LS Q +V+C     GC GG P        +  G+  E   PY    G C+  K+    Y      I      ++E  M      NGPI++G   +     YQ G+ H          S F  NP  L +H VL+VG+  T +GE FW VKNSWG  WGENGY+ + R +  CG+  +   S
Sbjct:  247 QAVDWRALGGV---SAVKNQGSCGSCWAFSTTGNVEGQWFLKTKRLVS--LSEQQLVDCDTIDNGCNGGLPSQAYKAIQQMGGLESEDSYPYNANKGNCALDKSKIAVYINGSASID-----SSESFMANWCSVNGPISIGINAFA-MQFYQGGISH--------PFSIF-CNPNHL-DHGVLIVGFNSTTSGEPFWIVKNSWGESWGENGYYLVYRGSGVCGLNKMATTS 456          
The following BLAST results are available for this feature:
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTSC2.157e-15851.35cathepsin C [Source:HGNC Symbol;Acc:HGNC:2528][more]
CTSC2.823e-5946.08cathepsin C [Source:HGNC Symbol;Acc:HGNC:2528][more]
CTSH1.380e-3536.78cathepsin H [Source:HGNC Symbol;Acc:HGNC:2535][more]
CTSH2.300e-3536.29cathepsin H [Source:HGNC Symbol;Acc:HGNC:2535][more]
CTSB1.429e-3331.71cathepsin B [Source:HGNC Symbol;Acc:HGNC:2527][more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpr-13.152e-3835.29Gut-specific cysteine proteinase [Source:UniProtK... [more]
W07B8.43.900e-3530.88pep chromosome:WBcel235:V:1130088:1131942:-1 gene:... [more]
tag-1963.846e-3434.33pep chromosome:WBcel235:V:8594914:8597500:1 gene:W... [more]
tag-1963.846e-3434.33pep chromosome:WBcel235:V:8594914:8597469:1 gene:W... [more]
cpr-23.242e-3332.39Cysteine PRotease related [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Swim2.763e-3630.39gene:FBgn0034709 transcript:FBtr0071785[more]
Swim2.763e-3630.39gene:FBgn0034709 transcript:FBtr0071784[more]
Cp11.261e-2827.75gene:FBgn0013770 transcript:FBtr0087592[more]
Cp11.859e-2827.75gene:FBgn0013770 transcript:FBtr0087593[more]
Cp13.375e-2831.64gene:FBgn0013770 transcript:FBtr0304021[more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsc3.265e-14748.70cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9][more]
ctss2.23.148e-3735.66cathepsin S, ortholog 2, tandem duplicate 2 [Sourc... [more]
ctss2.23.148e-3735.66cathepsin S, ortholog 2, tandem duplicate 2 [Sourc... [more]
ctsbb1.028e-3632.66cathepsin Bb [Source:ZFIN;Acc:ZDB-GENE-070323-1][more]
ctsk5.741e-3634.66cathepsin K [Source:ZFIN;Acc:ZDB-GENE-001205-4][more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsc8.860e-14649.78cathepsin C [Source:NCBI gene;Acc:407938][more]
ctsc2.136e-14449.34cathepsin C [Source:NCBI gene;Acc:407938][more]
ctsh8.685e-3734.88cathepsin H [Source:NCBI gene;Acc:496748][more]
ctsh1.171e-3634.88cathepsin H [Source:NCBI gene;Acc:496748][more]
ctsl1.022e-3432.14cathepsin L [Source:NCBI gene;Acc:548464][more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctsc5.844e-14650.11cathepsin C [Source:MGI Symbol;Acc:MGI:109553][more]
Ctsc1.149e-4438.46cathepsin C [Source:MGI Symbol;Acc:MGI:109553][more]
Ctsh8.718e-3938.91cathepsin H [Source:MGI Symbol;Acc:MGI:107285][more]
Ctsk2.799e-3435.34cathepsin K [Source:MGI Symbol;Acc:MGI:107823][more]
Ctsll34.576e-3436.21cathepsin L-like 3 [Source:MGI Symbol;Acc:MGI:1917... [more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53634|CATC_HUMAN1.036e-15751.35Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q5RB02|CATC_PONAB1.138e-15550.79Dipeptidyl peptidase 1 OS=Pongo abelii OX=9601 GN=... [more]
sp|Q3ZCJ8|CATC_BOVIN2.817e-15449.57Dipeptidyl peptidase 1 OS=Bos taurus OX=9913 GN=CT... [more]
sp|Q60HG6|CATC_MACFA2.894e-15250.11Dipeptidyl peptidase 1 OS=Macaca fascicularis OX=9... [more]
sp|O97578|CATC_CANLF2.228e-14850.00Dipeptidyl peptidase 1 (Fragment) OS=Canis lupus f... [more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IR552.790e-15752.70Pept_C1 domain-containing protein OS=Strigamia mar... [more]
A0A023PJH71.939e-15649.57Cathepsin C OS=Sinonovacula constricta OX=98310 PE... [more]
A0A493TDE32.058e-15652.01Cathepsin C OS=Anas platyrhynchos platyrhynchos OX... [more]
F1NWG23.276e-15651.31Pept_C1 domain-containing protein OS=Gallus gallus... [more]
A0A2T7NUA91.542e-15549.16Pept_C1 domain-containing protein OS=Pomacea canal... [more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsc5.350e-15549.67cathepsin C [Source:NCBI gene;Acc:103046262][more]
ctsc4.229e-15449.57cathepsin C [Source:NCBI gene;Acc:103046262][more]
ctsk5.692e-3737.92cathepsin K [Source:NCBI gene;Acc:103044235][more]
ctsh1.660e-3634.75cathepsin H [Source:NCBI gene;Acc:103043563][more]
ctss2.11.242e-3433.21cathepsin S [Source:NCBI gene;Acc:103044830][more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsc3.604e-14048.71cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9][more]
ctsc4.781e-6444.49cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9][more]
ctsc1.103e-6245.00cathepsin C [Source:ZFIN;Acc:ZDB-GENE-030619-9][more]
ENSPMAT00000007755.11.953e-3633.21pep scaffold:Pmarinus_7.0:GL476381:1843:17023:-1 g... [more]
ctsf1.708e-3434.69cathepsin F [Source:ZFIN;Acc:ZDB-GENE-030131-9831][more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO381221.317e-4633.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427516.884e-3935.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345882.020e-3332.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458522.419e-3230.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441651.990e-3028.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsc1.800e-14550.11cathepsin C [Source:NCBI gene;Acc:101170449][more]
ctsc2.499e-14548.69cathepsin C [Source:NCBI gene;Acc:101170449][more]
ctsk3.028e-3734.89cathepsin K [Source:NCBI gene;Acc:101164922][more]
ctsh2.527e-3634.55cathepsin H [Source:NCBI gene;Acc:111947539][more]
ctsbb7.068e-3531.19cathepsin B [Source:NCBI gene;Acc:101165526][more]
back to top
BLAST of Dipeptidyl peptidase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077202.10.000e+0100.00SMESG000077202.1[more]
SMESG000077197.10.000e+069.54SMESG000077197.1[more]
SMESG000063517.11.793e-3636.71SMESG000063517.1[more]
SMESG000063517.11.999e-3636.71SMESG000063517.1[more]
SMESG000005279.15.607e-3434.63SMESG000005279.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002110 ID=SMED30002110|Name=Dipeptidyl peptidase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1584bp
GCCACTTGATTAATAATTTACTAGGTACAAAATCGTCTAAATGATTTTAA
GAATTATTTTATCAATTGGGCTATTACATTTTGCCTTATCAGATACACCA
GCAAACTGTTCTTATCAAGATGCCATAGGAAAATGGCAAGTTTTTACTTC
AAACTTTTCTACATCATGTAGTACAAGTGCATTTGTACCGACTAAAACGT
TGACACTTATCTATCCTAATTTGGCAATTGATGATTTTGGAAATTTTGGA
ACATGGACTCTTATTTACAATCAAGGTTTTGAAGTTACTATAACGAACAA
GAAATATTTTGGATATTTCGATTTCAAACAAATTAATAGTACCTATACCA
TTTCATACTGCAATCGTTTGCAACCTAATTGGTATCATGACGTTTTGATC
AGACAATGGAGGTGTTTTAAGGCACAAAAATTATCCAATCTCGGTGAAAA
ACATGTCCATATACCTCAATCGAATATTTTTGCTCTTAATTCATTGCTTT
ATGGATCTCAAAAACATATAGTTAATACAATCAATAATCAAAATATTGGA
TGGATAGCTAAAGATTATCCTGAATTTCACGAGAAAACTTTATATCAAAT
AGTTAGGATGGCTGGAGGATTCTCGTCGAAATTGCATCGCCCAAAACCAG
CACCAGTAACGGAATACCATTTGAACTCGGTGAAATATATACCGAAATCA
TTTGATTGGCGAAACGTAAATGGCGTTAATTACGTCAGCCCGGTTAGAAA
TCAAGGCGGTTGTGGAAGCTGTTACTCATTTGCATCAGCTGGAATGTTAG
AAGCCCGTTATCGCATAAAATCAAATAATACAATTTCACCTATTTTGTCT
CCTCAAGACGTTGTTGAATGCAGCCCATATTCTCAAGGATGTGAAGGAGG
ATTTCCGTATCTAATCGCAGGAAAGTTTGCCGAAGATTTTGGAATGGCCC
AAGAATCATGCAATCCATACAAAGGTGAGGATGGAAAATGTAGCACTACA
AAGAATTGCCAACGATATTATGCAACCAAATACAAATATATCGGCGGATT
TTATGGAGCTACAAATGAGCCATTGATGAGAATGGAATTGGTACGAAATG
GGCCAATTGCAGTTGGATTTGAAGTCTACGATGATTTCATGAGCTATCAA
TCTGGCGTGTATCACCACGACTTCAAAACTCGTAAATTGACAGCTTCGAA
ATTCGGATTCAATCCATTTGAATTGACCAATCACGCAGTATTGGTTGTTG
GATACGGTGAAACGGCAACAGGAGAAAAGTTCTGGACAGTCAAGAACAGC
TGGGGATCTGGTTGGGGTGAAAATGGATATTTCAGAATTCGTCGCGCTAA
CGATGAGTGTGGAATCGAAAGTCTTGGTGTTGCATCGGAACCGATTTTGT
AGACGATATAATTTCGATAATATTGATTTTATGTGATAATTTTTCAAATA
ATAAATTATTGATTTTTAAAAAAAAGAATTTATTGGATTTCACTTGAAAA
ATCGAATTATGATTTGGTTTTATAGATTTTTTGTTAGAATTATTTGTTTA
TGTAGAATATAAATTTTGTCTTTTGAAAAAAAAA
back to top

protein sequence of SMED30002110-orf-1

>SMED30002110-orf-1 ID=SMED30002110-orf-1|Name=SMED30002110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MILRIILSIGLLHFALSDTPANCSYQDAIGKWQVFTSNFSTSCSTSAFVP
TKTLTLIYPNLAIDDFGNFGTWTLIYNQGFEVTITNKKYFGYFDFKQINS
TYTISYCNRLQPNWYHDVLIRQWRCFKAQKLSNLGEKHVHIPQSNIFALN
SLLYGSQKHIVNTINNQNIGWIAKDYPEFHEKTLYQIVRMAGGFSSKLHR
PKPAPVTEYHLNSVKYIPKSFDWRNVNGVNYVSPVRNQGGCGSCYSFASA
GMLEARYRIKSNNTISPILSPQDVVECSPYSQGCEGGFPYLIAGKFAEDF
GMAQESCNPYKGEDGKCSTTKNCQRYYATKYKYIGGFYGATNEPLMRMEL
VRNGPIAVGFEVYDDFMSYQSGVYHHDFKTRKLTASKFGFNPFELTNHAV
LVVGYGETATGEKFWTVKNSWGSGWGENGYFRIRRANDECGIESLGVASE
PIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036496CathepsinC_exc_dom_sf
IPR039412CatC
IPR038765Papain-like_cys_pep_sf
IPR000169Pept_cys_AS
IPR025661Pept_asp_AS
IPR025660Pept_his_AS
IPR000668Peptidase_C1A_C
IPR014882CathepsinC_exc
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0008233peptidase activity
GO:0016505peptidase activator activity involved in apoptotic process
GO:0016787hydrolase activity
GO:0019902phosphatase binding
GO:0031404chloride ion binding
GO:0042802identical protein binding
GO:0043621protein self-association
GO:0051087chaperone binding
GO:0004197cysteine-type endopeptidase activity
GO:0004252serine-type endopeptidase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0006888ER to Golgi vesicle-mediated transport
GO:0006915apoptotic process
GO:0006955immune response
GO:0007568aging
GO:0010033response to organic substance
GO:0043312neutrophil degranulation
GO:0048208COPII vesicle coating
GO:0051603proteolysis involved in cellular protein catabolic process
GO:1903052positive regulation of proteolysis involved in cellular protein catabolic process
GO:2001235positive regulation of apoptotic signaling pathway
GO:0001913T cell mediated cytotoxicity
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005764lysosome
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0016020membrane
GO:0030134ER to Golgi transport vesicle
GO:0033116endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0035578azurophil granule lumen
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
GO:0000139Golgi membrane
GO:0005576extracellular region
GO:0005615extracellular space
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000668Peptidase C1A, papain C-terminalPRINTSPR00705PAPAINcoord: 238..253
score: 48.84
coord: 398..408
score: 59.66
coord: 414..420
score: 60.4
IPR000668Peptidase C1A, papain C-terminalSMARTSM00645pept_c1coord: 217..450
e-value: 3.7E-74
score: 262.4
IPR000668Peptidase C1A, papain C-terminalPFAMPF00112Peptidase_C1coord: 217..445
e-value: 3.1E-59
score: 200.7
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 217..453
e-value: 1.2E-87
score: 295.6
NoneNo IPR availablePANTHERPTHR12411CYSTEINE PROTEASE FAMILY C1-RELATEDcoord: 76..442
NoneNo IPR availablePANTHERPTHR12411:SF354DIPEPTIDYL PEPTIDASE 1coord: 76..442
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.855
IPR036496Cathepsin C, exclusion domain superfamilyGENE3DG3DSA:2.40.128.80coord: 18..130
e-value: 1.1E-32
score: 114.6
IPR036496Cathepsin C, exclusion domain superfamilySUPERFAMILYSSF75001Dipeptidyl peptidase I (cathepsin C), exclusion domaincoord: 18..131
IPR014882Cathepsin C exclusionPFAMPF08773CathepsinC_exccoord: 18..130
e-value: 4.6E-31
score: 107.6
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 238..249
IPR025660Cysteine peptidase, histidine active sitePROSITEPS00639THIOL_PROTEASE_HIScoord: 396..406
IPR025661Cysteine peptidase, asparagine active sitePROSITEPS00640THIOL_PROTEASE_ASNcoord: 414..433
IPR039412Cathepsin CCDDcd02621Peptidase_C1A_CathepsinCcoord: 218..452
e-value: 1.01052E-114
score: 334.739
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 156..451