TFIIS N-terminal domain-containing protein

Overview
NameTFIIS N-terminal domain-containing protein
Smed IDSMED30002106
Length (bp)1636
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TFIIS N-terminal domain-containing protein (SMED30002106) t-SNE clustered cells

Violin plots show distribution of expression levels for TFIIS N-terminal domain-containing protein (SMED30002106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TFIIS N-terminal domain-containing protein (SMED30002106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TFIIS N-terminal domain-containing protein (SMED30002106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002106SMESG000058491.1 SmedASXL_011344SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002106SMESG000058491.1 dd_Smed_v4_995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002106SMESG000058491.1 Contig48633newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002106SMESG000058491.1 Contig48633uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Human
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:25467])

HSP 1 Score: 192.586 bits (488), Expect = 2.264e-52
Identity = 104/248 (41.94%), Postives = 154/248 (62.10%), Query Frame = 3
Query:  597 DILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEMP-DETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            D L  FE ++++++      R + R    F+++ DD ++ ++ KM  AA ED +L +  +P +KK+ LL AV   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD        +  S   + P +  +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  524 DFLSDFEMMLQRKKS-MSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRR--DLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 768          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Human
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:25467])

HSP 1 Score: 147.517 bits (371), Expect = 1.334e-40
Identity = 78/157 (49.68%), Postives = 104/157 (66.24%), Query Frame = 3
Query:  873 VMAA---WLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSA------NIKKEMP-DETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            VM+A   WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD      R+  + +       +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:    1 VMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 157          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Celegans
Match: F13B12.1 (IWS1-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q19375])

HSP 1 Score: 181.8 bits (460), Expect = 1.389e-50
Identity = 113/308 (36.69%), Postives = 167/308 (54.22%), Query Frame = 3
Query:  678 VEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLD--FPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD----------KAISITRKVPDKSANIKKEM---PDETA------TKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            ++ +N+ D  ++ L+ +M+ AA  D       +P  +K+++L  VK ++ R+ I E LIE+ F+  ++ WL PLP+  LP LDIRI +LK L +  F  L    L++S +GKAVM L KHP ET ENK IA  LI EW+RPI+HL ++Y  ++R+ER ERD          K  S   + P+     K+      DE         KPGD+G+IPRA VPK S KDY+IRP+W+  G  +                    +K+S  NN       +++TFR  +E  K+ K   R   +S++GR MG+
Sbjct:  230 IDIINDDDGTVSRLVERMKHAAKSDRNANIERKPAFQKIKMLPEVKAIMLRAGIVEVLIENGFMSALSEWLAPLPDKCLPALDIRITVLKLLHNPRFWKLDRSTLKQSGLGKAVMMLYKHPNETKENKGIANKLIGEWARPIYHLDTDYSTVSRQEREERDYSRMPEKRKKKINSRDEEEPNDDDQPKRPRIRDADEMGPTKSDDLKPGDKGYIPRARVPKPSTKDYVIRPEWRVTGAFKG-------------------EKKSTGNN------RYDQTFRDFQERTKKSKA-NRIVKVSLEGRNMGI 511          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Fly
Match: CG9915 (gene:FBgn0030738 transcript:FBtr0336976)

HSP 1 Score: 178.333 bits (451), Expect = 1.029e-47
Identity = 110/284 (38.73%), Postives = 156/284 (54.93%), Query Frame = 3
Query:  717 LMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKA-ISITR-KVPDKSANIKKEMPDETAT--------KPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            L+  M+ A+ +D +L  +GQP  KK+ +L  V   L + +++ A +E   L V+  WL PLPN  LP L IR  +LK L DFPT+   +L++S IGKAVMYL KHP+ET  N+  A  LI+EW+RPIF++S N+  M++EER ERD A +S  R K PD   +   + P    T        +PGD GW+ RA VP  SNKDY+IRP+   +G            E      R P +              +EK  ++  ++ K+ K  +RA  ISI+GR M +
Sbjct:  564 LIVSMKNASDDDRQLNMIGQPATKKISMLKQVMSQLIKKHLQLAFLEHNILNVLTDWLAPLPNKSLPCLQIRESILKLLSDFPTIEKGLLKQSGIGKAVMYLYKHPQETKSNRDRAGRLISEWARPIFNVSCNFSAMSKEERQERDLAQMSRHRHKSPDTEPSSSSKAPTLNQTLSNEDKMLRPGDPGWVARARVPMPSNKDYVIRPKSTVEG------------EVSASTKRKPNR--------------YEKHMKRFLDS-KRLKESRRAVEISIEGRKMAL 820          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Fly
Match: CG9915 (gene:FBgn0030738 transcript:FBtr0112992)

HSP 1 Score: 178.333 bits (451), Expect = 1.029e-47
Identity = 110/284 (38.73%), Postives = 156/284 (54.93%), Query Frame = 3
Query:  717 LMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKA-ISITR-KVPDKSANIKKEMPDETAT--------KPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            L+  M+ A+ +D +L  +GQP  KK+ +L  V   L + +++ A +E   L V+  WL PLPN  LP L IR  +LK L DFPT+   +L++S IGKAVMYL KHP+ET  N+  A  LI+EW+RPIF++S N+  M++EER ERD A +S  R K PD   +   + P    T        +PGD GW+ RA VP  SNKDY+IRP+   +G            E      R P +              +EK  ++  ++ K+ K  +RA  ISI+GR M +
Sbjct:  564 LIVSMKNASDDDRQLNMIGQPATKKISMLKQVMSQLIKKHLQLAFLEHNILNVLTDWLAPLPNKSLPCLQIRESILKLLSDFPTIEKGLLKQSGIGKAVMYLYKHPQETKSNRDRAGRLISEWARPIFNVSCNFSAMSKEERQERDLAQMSRHRHKSPDTEPSSSSKAPTLNQTLSNEDKMLRPGDPGWVARARVPMPSNKDYVIRPKSTVEG------------EVSASTKRKPNR--------------YEKHMKRFLDS-KRLKESRRAVEISIEGRKMAL 820          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01044053.1 (IWS1, SUPT6H interacting protein [Source:NCBI gene;Acc:100329390])

HSP 1 Score: 182.956 bits (463), Expect = 2.304e-49
Identity = 102/249 (40.96%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLER--DKAISITRKV-----------------PDKSA------NIKKEM-PDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDG 1325
            R + R    F+++ DD ++ ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  W+ PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +R  D+ I+  R++                 P  S       +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W  DG
Sbjct:  505 RRRNRDGGTFISDADDVVSAMITKMTEAAEEDRTLNSQKKPALKKLMLLPTVVMHLKKQDLKETFIDSGVMAAIKEWISPLPDKSLPALRIREELLKILQELPSVSQETLKFSGIGRAVMYLYKHPKESRPNKDLALKLINEWSRPIFGLTSNYKGMTREERQQRDLDQQIAPRRRLSEPQTTDRPLESDVFASPRSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVDG 753          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Xenopus
Match: fgfr3 (fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) [Source:Xenbase;Acc:XB-GENE-479255])

HSP 1 Score: 187.193 bits (474), Expect = 1.015e-50
Identity = 100/242 (41.32%), Postives = 141/242 (58.26%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW-------KYDGVKRSF 1340
            R + R    F+++ DD +  ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK IA  LINEWSRPIF L+SNY GMTREER +RD + +   R++        +         +E A +PGD G+  RA VP  SNKDY++RP+W       +Y G ++  
Sbjct:  490 RRRNRDGGTFISDADDVVNAMIMKMNEAAEEDRNLNSSKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLTPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRPNKDIAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMSSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPLPSNKDYVVRPKWNVEMESARYGGARKGI 731          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Xenopus
Match: fgfr3 (fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) [Source:Xenbase;Acc:XB-GENE-479255])

HSP 1 Score: 186.422 bits (472), Expect = 1.807e-50
Identity = 98/226 (43.36%), Postives = 136/226 (60.18%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            R + R    F+++ DD +  ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK IA  LINEWSRPIF L+SNY GMTREER +RD + +   R++        +         +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  490 RRRNRDGGTFISDADDVVNAMIMKMNEAAEEDRNLNSSKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLTPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRPNKDIAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMSSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPLPSNKDYVVRPKW 715          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Xenopus
Match: fgfr3 (fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) [Source:Xenbase;Acc:XB-GENE-479255])

HSP 1 Score: 187.193 bits (474), Expect = 1.994e-50
Identity = 100/240 (41.67%), Postives = 140/240 (58.33%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW-----KYDGVKRSF 1340
            R + R    F+++ DD +  ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK IA  LINEWSRPIF L+SNY GMTREER +RD + +   R++        +         +E A +PGD G+  RA VP  SNKDY++RP+W      Y G ++  
Sbjct:  570 RRRNRDGGTFISDADDVVNAMIMKMNEAAEEDRNLNSSKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLTPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRPNKDIAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMSSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPLPSNKDYVVRPKWNVEMESYGGARKGI 809          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Xenopus
Match: fgfr3 (fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) [Source:Xenbase;Acc:XB-GENE-479255])

HSP 1 Score: 187.578 bits (475), Expect = 2.102e-50
Identity = 100/242 (41.32%), Postives = 141/242 (58.26%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW-------KYDGVKRSF 1340
            R + R    F+++ DD +  ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK IA  LINEWSRPIF L+SNY GMTREER +RD + +   R++        +         +E A +PGD G+  RA VP  SNKDY++RP+W       +Y G ++  
Sbjct:  618 RRRNRDGGTFISDADDVVNAMIMKMNEAAEEDRNLNSSKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLTPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRPNKDIAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMSSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPLPSNKDYVVRPKWNVEMESARYGGARKGI 859          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Mouse
Match: Iws1 (IWS1, SUPT6 interacting protein [Source:MGI Symbol;Acc:MGI:1920723])

HSP 1 Score: 190.274 bits (482), Expect = 7.585e-52
Identity = 104/251 (41.43%), Postives = 155/251 (61.75%), Query Frame = 3
Query:  597 DILRCFEEVVEKQRI---EKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEMP-DETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            D L  FE ++++++    ++R NR        F+++ DD ++ ++ KM  AA ED +L +  +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD        +  S   + P +  +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  471 DFLSDFEMMLQRKKSMCGKRRRNRDGGT----FISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRLSSTGGQTPRR--DLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 715          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Mouse
Match: Iws1 (IWS1, SUPT6 interacting protein [Source:MGI Symbol;Acc:MGI:1920723])

HSP 1 Score: 189.889 bits (481), Expect = 7.972e-52
Identity = 101/246 (41.06%), Postives = 149/246 (60.57%), Query Frame = 3
Query:  597 DILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            D L  FE ++++++      R + R    F+++ DD ++ ++ KM  AA ED +L +  +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD + +   R++        +         +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  471 DFLSDFEMMLQRKKS-MCGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRLSSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 715          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Mouse
Match: Iws1 (IWS1, SUPT6 interacting protein [Source:MGI Symbol;Acc:MGI:1920723])

HSP 1 Score: 154.451 bits (389), Expect = 1.536e-43
Identity = 80/167 (47.90%), Postives = 105/167 (62.87%), Query Frame = 3
Query:  837 IKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEMPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            +KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD        +  S   + P +    K    +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:    2 LKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRLSSTGGQTPRRDLE-KVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 167          
BLAST of TFIIS N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96ST2|IWS1_HUMAN (Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 1.087e-51
Identity = 104/248 (41.94%), Postives = 154/248 (62.10%), Query Frame = 3
Query:  597 DILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEMP-DETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            D L  FE ++++++      R + R    F+++ DD ++ ++ KM  AA ED +L +  +P +KK+ LL AV   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD        +  S   + P +  +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  524 DFLSDFEMMLQRKKS-MSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRR--DLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 768          
BLAST of TFIIS N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3SWT4|IWS1_RAT (Protein IWS1 homolog OS=Rattus norvegicus OX=10116 GN=Iws1 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 4.034e-51
Identity = 103/248 (41.53%), Postives = 153/248 (61.69%), Query Frame = 3
Query:  597 DILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEMP-DETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            D L  FE ++++++      R + R    F+++ DD ++ ++ KM  AA ED +L +  +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD        +  S   + P +  +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  470 DFLSDFEMMLQRKKS-MCGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMSSTGGQTPRR--DLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 714          
BLAST of TFIIS N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C1D8|IWS1_MOUSE (Protein IWS1 homolog OS=Mus musculus OX=10090 GN=Iws1 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 5.306e-51
Identity = 104/251 (41.43%), Postives = 155/251 (61.75%), Query Frame = 3
Query:  597 DILRCFEEVVEKQRI---EKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEMP-DETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            D L  FE ++++++    ++R NR        F+++ DD ++ ++ KM  AA ED +L +  +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK +A  LINEWSRPIF L+SNY GMTREER +RD        +  S   + P +  +++K +  +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  471 DFLSDFEMMLQRKKSMCGKRRRNRDGGT----FISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRLSSTGGQTPRR--DLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 715          
BLAST of TFIIS N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q19375|IWS1_CAEEL (IWS1-like protein OS=Caenorhabditis elegans OX=6239 GN=F13B12.1 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.767e-49
Identity = 113/308 (36.69%), Postives = 167/308 (54.22%), Query Frame = 3
Query:  678 VEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLD--FPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD----------KAISITRKVPDKSANIKKEM---PDETA------TKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            ++ +N+ D  ++ L+ +M+ AA  D       +P  +K+++L  VK ++ R+ I E LIE+ F+  ++ WL PLP+  LP LDIRI +LK L +  F  L    L++S +GKAVM L KHP ET ENK IA  LI EW+RPI+HL ++Y  ++R+ER ERD          K  S   + P+     K+      DE         KPGD+G+IPRA VPK S KDY+IRP+W+  G  +                    +K+S  NN       +++TFR  +E  K+ K   R   +S++GR MG+
Sbjct:  230 IDIINDDDGTVSRLVERMKHAAKSDRNANIERKPAFQKIKMLPEVKAIMLRAGIVEVLIENGFMSALSEWLAPLPDKCLPALDIRITVLKLLHNPRFWKLDRSTLKQSGLGKAVMMLYKHPNETKENKGIANKLIGEWARPIYHLDTDYSTVSRQEREERDYSRMPEKRKKKINSRDEEEPNDDDQPKRPRIRDADEMGPTKSDDLKPGDKGYIPRARVPKPSTKDYVIRPEWRVTGAFKG-------------------EKKSTGNN------RYDQTFRDFQERTKKSKA-NRIVKVSLEGRNMGI 511          
BLAST of TFIIS N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q505H7|IWS1_XENTR (Protein IWS1 homolog OS=Xenopus tropicalis OX=8364 GN=iws1 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 2.698e-49
Identity = 98/226 (43.36%), Postives = 136/226 (60.18%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            R + R    F+++ DD +  ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  WL PLP+  LP L IR  +LK L + P++S + L+ S IG+AVMYL KHPKE+  NK IA  LINEWSRPIF L+SNY GMTREER +RD + +   R++        +         +E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  633 RRRNRDGGTFISDADDVVNAMIMKMNEAAEEDRNLNSSKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLTPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRPNKDIAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMSSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPLPSNKDYVVRPKW 858          
BLAST of TFIIS N-terminal domain-containing protein vs. TrEMBL
Match: A0A183P9S2 (TFIIS N-terminal domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS11108 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.444e-57
Identity = 123/296 (41.55%), Postives = 178/296 (60.14%), Query Frame = 3
Query:  675 DVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSA----NIKKEMPDETAT--KPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNA-NSTANWEKTFRKIR-EAGKQRKMIQRAANISIQGRGMGV 1538
            D+EFLN+ DD I + +++M+ AA ED +L    +P  KK+ +L  V  +L R+++K ALIE+  L  +  WL PLP H LP L IR  ML +L +F +LSS+VL+ES IGKA+MYL KHP+ET ENK  A  LINEW RPIF+L+S+Y  +T+EER + D      R+  D  A    +I +E+  E     +PGD GW+ RA VP+ SNKDYIIRP+W+        D D++ ++++   ++   +K  K   +   +T+  E   R +   A K      RA  +SI+GR M +
Sbjct:  320 DIEFLNDSDDLIVETISRMKSAADEDRQLLTASRPATKKLNMLKEVLAILRRADLKSALIENGMLSAITEWLSPLPGHTLPNLVIRDSMLTSLSEFQSLSSEVLQESGIGKALMYLYKHPRETRENKDRAGRLINEWLRPIFNLTSDYRTLTKEERKQLDYEHLPKRRNIDNEAYNHRDINRELDGEAKGLLRPGDPGWVNRARVPQPSNKDYIIRPKWRVRENATGDDNDEEGNDDQTEQSQSLSRKHRKTRTSGFGATSRIESHIRNLSNSARKSHAKAARAVPMSIEGRNMSL 615          
BLAST of TFIIS N-terminal domain-containing protein vs. TrEMBL
Match: A0A183KKG7 (TFIIS N-terminal domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15529 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.625e-57
Identity = 123/296 (41.55%), Postives = 178/296 (60.14%), Query Frame = 3
Query:  675 DVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSA----NIKKEMPDETAT--KPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNA-NSTANWEKTFRKIR-EAGKQRKMIQRAANISIQGRGMGV 1538
            D+EFLN+ DD I + +++M+ AA ED +L    +P  KK+ +L  V  +L R+++K ALIE+  L  +  WL PLP H LP L IR  ML +L +F +LSS+VL+ES IGKA+MYL KHP+ET ENK  A  LINEW RPIF+L+S+Y  +T+EER + D      R+  D  A    +I +E+  E     +PGD GW+ RA VP+ SNKDYIIRP+W+        D D++ ++++   ++   +K  K   +   +T+  E   R +   A K      RA  +SI+GR M +
Sbjct:  327 DIEFLNDSDDLIVETISRMKSAADEDRQLLTASRPATKKLNMLKEVLAILRRADLKSALIENGMLSAITEWLSPLPGHTLPNLVIRDSMLTSLSEFQSLSSEVLQESGIGKALMYLYKHPRETRENKDRAGRLINEWLRPIFNLTSDYRTLTKEERKQLDYEHLPKRRNIDNEAYNHRDINRELDGEAKGLLRPGDPGWVNRARVPQPSNKDYIIRPKWRVRENATGEDNDEEGNDDQTEQSQSLSRKHRKTRTSGFGATSRIESHIRNLSNSARKSHAKAARAVPMSIEGRNMSL 622          
BLAST of TFIIS N-terminal domain-containing protein vs. TrEMBL
Match: A0A183LKS3 (TFIIS N-terminal domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS4398 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.036e-56
Identity = 123/296 (41.55%), Postives = 178/296 (60.14%), Query Frame = 3
Query:  675 DVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSA----NIKKEMPDETAT--KPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNA-NSTANWEKTFRKIR-EAGKQRKMIQRAANISIQGRGMGV 1538
            D+EFLN+ DD I + +++M+ AA ED +L    +P  KK+ +L  V  +L R+++K ALIE+  L  +  WL PLP H LP L IR  ML +L +F +LSS+VL+ES IGKA+MYL KHP+ET ENK  A  LINEW RPIF+L+S+Y  +T+EER + D      R+  D  A    +I +E+  E     +PGD GW+ RA VP+ SNKDYIIRP+W+        D D++ ++++   ++   +K  K   +   +T+  E   R +   A K      RA  +SI+GR M +
Sbjct:  320 DIEFLNDSDDLIVETISRMKSAADEDRQLLTASRPATKKLNMLKEVLAILRRADLKSALIENGMLSAITEWLSPLPGHTLPNLVIRDSMLTSLSEFQSLSSEVLQESGIGKALMYLYKHPRETRENKDRAGRLINEWLRPIFNLTSDYRTLTKEERKQLDYEHLPKRRNIDNEAYNHRDINRELDGEAKGLLRPGDPGWVNRARVPQPSNKDYIIRPKWRVRENATGDDNDEEGNDDQTEQSQSLSRKHRKTRTSGFGATSRIESHIRNLSNSARKSHAKAARAVPMSIEGRNMSL 615          
BLAST of TFIIS N-terminal domain-containing protein vs. TrEMBL
Match: A0A0R3T825 (TFIIS N-terminal domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS3212 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 1.689e-56
Identity = 131/327 (40.06%), Postives = 200/327 (61.16%), Query Frame = 3
Query:  585 EHSSDILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKEMPDETA--TKPGDEGWIPRATVPKQSNKDYIIRPQWKY--DGVKRSFXXXXXXXXXXGRNNRGPPKKRS---KINNNANSTANWEKTFRKIREAG---KQRKMIQRAANISIQGRGM 1532
            E  + ++  F+E+VEK R E+R  R K   +V+FLN++DD + D++N+MR AA ED  L    +P IKK+ +L  V+ +L R++  +ALI++  L  +A WL P+   ILP L IR  +LK L +F    +D+L+ES IGKAVM++ KHP ETP NKK+A  LI  WSRPIF L  +Y  ++REER E D + ++  R   DK +   KE  +E++   KPGDEG+I RA VP+ SNKDY+IRP+WK   +  +   D+ + D++   R +    ++R     +++  +ST   EK  + I  A    ++R+ +  A  +S++GR M
Sbjct:  226 EGGTSLVAIFDEIVEKMRRERRRRRRK---NVDFLNDLDDVVRDIVNRMRDAAEEDRRLLASNKPAIKKVGMLKDVEQLLLRADAGQALIDNGMLTAIAEWLSPVSGRILPSLSIRDCLLKHLKEFHIEETDLLKESGIGKAVMFIYKHPLETPANKKLAYSLITAWSRPIFKLPLDYSSLSREERKEMDLRNLNRHRVTDDKKS---KEEDEESSRPLKPGDEGFIARARVPQPSNKDYVIRPKWKVPAESTRSDSDDGETDEQNANRPSTSTQRRRRVQPSVSSGVSSTKRLEKHIKNISRAAEMNRKRRYVG-AVRMSVEGRNM 545          
BLAST of TFIIS N-terminal domain-containing protein vs. TrEMBL
Match: R7VFW2 (TFIIS N-terminal domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183017 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 2.504e-56
Identity = 120/306 (39.22%), Postives = 174/306 (56.86%), Query Frame = 3
Query:  642 EKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            E++  R KKR +V+ +N+ DD I +L+ +M+ AA ED EL    QP IKK++LL  V   L +S++  A ++   L  +  WL PLP+  LP L +R  +LK LLDFP +SS+ L+ S IGKAVMYL KHP+ET ++K+ A  LINEWSRPIF+L+SNY  +TREER +RD + +   R++  + AN  +          +  +KPG  G+I RA VP+ S KDY+IRP+W  D                          RS +    N     ++ F + ++  KQ    QRA  IS++G+ M +
Sbjct:    7 EEQGRRRKKRKNVDIINDSDDLIMELITQMKEAAEEDRELNQQKQPAIKKLRLLTKVNAQLKKSDLHHAFLDCGILNGITEWLAPLPDRSLPHLTVRESLLKHLLDFPPISSESLKMSGIGKAVMYLYKHPRETRQHKEFAGKLINEWSRPIFNLTSNYKTLTREEREQRDYEQLPKRRRLSLEGANTPRRDLEKILAGKDKNSKPGMPGFIQRARVPQPSKKDYVIRPKWNID----------------------EQPSRSSMKKELNKYEKHQRAFAERKKNKKQ----QRAVPISVEGKNMAL 286          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Cavefish
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:NCBI gene;Acc:103025803])

HSP 1 Score: 192.971 bits (489), Expect = 1.458e-53
Identity = 114/299 (38.13%), Postives = 167/299 (55.85%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLER--DKAISITRKVPDKSANIKKEM-----PDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGM 1532
            R + R    F+++ DD ++ ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  W+ PLP+  LP L IR  +LK L + P++S + L+ S IG+AVM+L KHPKE+  NK +A  LINEWSRPIF LSSNY GMTREER +R  D+ I+  R++       ++++      +E A +PGD G+  RA VP  SNKDY++RP+W  +                  + RG  K  S++          EK  R+  E  KQR+ +Q A  IS++G  M
Sbjct:  370 RKRHRDGGTFISDADDVVSAMITKMTEAAEEDRTLNSQKKPALKKLMLLPTVVMHLKKQDLKETFIDSGVMAAIKEWISPLPDKSLPALKIREELLKILQELPSVSQETLKMSGIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFGLSSNYKGMTREERQQRDLDQQIAPRRRLSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVESES---------------SRRGFKKGISRL----------EKHKRRFAEQRKQRR-VQGAVKISVEGNRM 642          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Cavefish
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:NCBI gene;Acc:103025803])

HSP 1 Score: 188.348 bits (477), Expect = 9.493e-52
Identity = 115/319 (36.05%), Postives = 165/319 (51.72%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLER--DKAISITRKVPDKSANIKKEMPD-----------------------ETATKPGDEGWIPRATVPKQSNKDYIIRPQW--KYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGM 1532
            R + R    F+++ DD ++ ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  W+ PLP+  LP L IR  +LK L + P++S + L+ S IG+AVM+L KHPKE+  NK +A  LINEWSRPIF LSSNY GMTREER +R  D+ I+  R++ +     + E PD                       E A +PGD G+  RA VP  SNKDY++RP+W  + +  +R F                               +  EK  R+  E  KQR+ +Q A  IS++G  M
Sbjct:  370 RKRHRDGGTFISDADDVVSAMITKMTEAAEEDRTLNSQKKPALKKLMLLPTVVMHLKKQDLKETFIDSGVMAAIKEWISPLPDKSLPALKIREELLKILQELPSVSQETLKMSGIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFGLSSNYKGMTREERQQRDLDQQIAPRRRLSEPQQVERAEEPDVFGPLSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVESESSRRGFK---------------------------KGISRLEKHKRRFAEQRKQRR-VQGAVKISVEGNRM 660          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Cavefish
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:NCBI gene;Acc:103025803])

HSP 1 Score: 185.652 bits (470), Expect = 6.532e-51
Identity = 100/244 (40.98%), Postives = 141/244 (57.79%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLER--DKAISITRKVPDKSANIKKEMPD-----------------------ETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            R + R    F+++ DD ++ ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  W+ PLP+  LP L IR  +LK L + P++S + L+ S IG+AVM+L KHPKE+  NK +A  LINEWSRPIF LSSNY GMTREER +R  D+ I+  R++ +     + E PD                       E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  352 RKRHRDGGTFISDADDVVSAMITKMTEAAEEDRTLNSQKKPALKKLMLLPTVVMHLKKQDLKETFIDSGVMAAIKEWISPLPDKSLPALKIREELLKILQELPSVSQETLKMSGIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFGLSSNYKGMTREERQQRDLDQQIAPRRRLSEPQQVERAEEPDVFGPLSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 595          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Cavefish
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:NCBI gene;Acc:103025803])

HSP 1 Score: 185.652 bits (470), Expect = 7.115e-51
Identity = 100/244 (40.98%), Postives = 141/244 (57.79%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLER--DKAISITRKVPDKSANIKKEMPD-----------------------ETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            R + R    F+++ DD ++ ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  W+ PLP+  LP L IR  +LK L + P++S + L+ S IG+AVM+L KHPKE+  NK +A  LINEWSRPIF LSSNY GMTREER +R  D+ I+  R++ +     + E PD                       E A +PGD G+  RA VP  SNKDY++RP+W
Sbjct:  370 RKRHRDGGTFISDADDVVSAMITKMTEAAEEDRTLNSQKKPALKKLMLLPTVVMHLKKQDLKETFIDSGVMAAIKEWISPLPDKSLPALKIREELLKILQELPSVSQETLKMSGIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFGLSSNYKGMTREERQQRDLDQQIAPRRRLSEPQQVERAEEPDVFGPLSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKW 613          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Sea Lamprey
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:25467])

HSP 1 Score: 187.963 bits (476), Expect = 9.700e-52
Identity = 101/249 (40.56%), Postives = 151/249 (60.64%), Query Frame = 3
Query:  594 SDILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD---------KAISITRKVPDKSANIKKEMPDETATKPGDEGWIPRATVPKQSNKDYIIRPQW 1313
            ++ +  F+ +++++R   R  R   R    F+++ DD I+ ++ +M  AA ED++L    +P +KKM +L  V   L + ++ E+ I+S  L  +  WL PLP+  LP L IR  +LK L D P++  + L+ S IG++VMYL KHPKET +NK +A  LINEWSRPIF L+SNY GM+REER +RD          + S   + P +  + K    +E A +PGD G+  RA VP  SN+DY+IRP+W
Sbjct:  514 TEFISDFDMMLQRKRELNRRQRRGHRDGGTFISDADDLISAMITRMNEAAEEDKKLNTERKPALKKMVMLPTVIKHLRKQDLVESFIDSGILSAIRDWLCPLPDKSLPNLKIREELLKVLQDLPSVPQETLKSSGIGRSVMYLYKHPKETRQNKDLAGKLINEWSRPIFGLTSNYKGMSREEREQRDLEQMPHRRRLSFSTGGQTPRRDLD-KVLTGEEKALRPGDPGFCSRARVPMPSNRDYVIRPKW 761          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Yeast
Match: SPN1 (Protein involved in RNA polymerase II transcription; is constitutively recruited to the CYC1 promoter and is required for recruitment of chromatin remodeling factors for the expression of CYC1 gene; interacts genetically or physically with RNAP II, TBP, TFIIS, and chromatin remodelling factors; central domain highly conserved throughout eukaryotes; mutations confer an Spt- phenotype [Source:SGD;Acc:S000006337])

HSP 1 Score: 83.1889 bits (204), Expect = 1.435e-17
Identity = 64/229 (27.95%), Postives = 117/229 (51.09%), Query Frame = 3
Query:  486 EAQKPQEKAVYEDFR----KQSEYKDQ---PKYELEIPTPEHSSDILRCFEEVVEKQRIEKRLNRPK----KRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFH----MGQPGIKKMQ---LLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNY 1118
            EA + + K +  DF     ++ E+ DQ   P  E        SS      +E+ EK  +++ L +PK    +R + +    +D++I  L ++M +AA  D +  +     G   +  MQ   LL  V  +L+++N+ + ++++  L  +  WL+PLP+  LP  +I+  +  AL D P + ++ L+ES +G+ V++  K  +   +  ++A  LI EW+RPI   S NY
Sbjct:   75 EAAERKRKHISTDFSDDDLEKEEHNDQSLQPTVENRASKDRDSSATPSSRQELEEK--LDRILKKPKVRRTRRDEDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLP-VKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIGASDNY 300          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Nematostella
Match: EDO36344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU4])

HSP 1 Score: 171.785 bits (434), Expect = 1.492e-49
Identity = 102/299 (34.11%), Postives = 167/299 (55.85%), Query Frame = 3
Query:  675 DVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINE--WSRPIFHLSSNYDGMTREERLERD-KAISITRKVPDKSANIKKE--------MPDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            D + +++ DD + +++ +M+ AA +D+ L    Q   KK++LL  +   +N+++++   I+S  L V+  WL PLP+  +P L IR  +LK L  FP L +  L+ S +G+AVMYL +HPKET +NK++A  LI+E  W+RPIF ++SN+  ++REER ERD + +S  R++        K           ++ A +PGD+G++ RA VP  SNKDY++RP+   +G    F                       + +   +    +K  RK+++  +  KM QRA NISI+GR M +
Sbjct:    2 DGDIISDNDDLVVEMIKQMKQAADDDKLLNEANQAATKKLKLLPVILKHMNKADLQYTFIDSGVLNVLKEWLSPLPDGSMPHLQIRTGILKILSTFPALDTGALKMSGLGRAVMYLYRHPKETRQNKQVAGKLISEYDWARPIFGVTSNFKSLSREEREERDYQNMSKRRRLSSADGEGGKTPRSIDSALQGEKKALRPGDKGFVMRARVPLPSNKDYVVRPKTNAEG--SDF-----------------------VRSTKKTVTKADKLTRKLKDKKRANKM-QRAVNISIEGRKMNL 274          
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Medaka
Match: IWS1 (interacts with SUPT6H, CTD assembly factor 1 [Source:NCBI gene;Acc:101175620])

HSP 1 Score: 185.267 bits (469), Expect = 1.270e-50
Identity = 96/232 (41.38%), Postives = 144/232 (62.07%), Query Frame = 3
Query:  657 RPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERD--------KAISITRKVPDKSANIKKEM-PDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDG 1325
            R + R    F+++ DD ++ ++ KM  AA ED  L    +P +KK+ LL  V   L + ++KE  I+S  +  +  W+ PLP+  LP L IR  +L+ L + P++S + L+ S IG+AVM+L KHPKE+  NK +A  LINEWSRPIF L+SNY  MTREER +RD        + +S   + P +  +++K++  +E A +PGD G+  RA VP  SNKDY++RP+W  +G
Sbjct:  409 RRRHRDGGTFISDADDVVSAMITKMNEAAEEDRTLNKQKKPALKKLTLLPQVVMHLKKQDLKETFIDSGVMSAITEWISPLPDKSLPALRIREELLRILQELPSVSQETLKHSKIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFGLTSNYKSMTREERQQRDLDQQMPQRRRLSSGGQTPRR--DLEKQLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEG 638          
BLAST of TFIIS N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000058491.1 (SMESG000058491.1)

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 3
Query:   81 MYSPESTEYTIKEEVFDTEYIPSKVECTDAYEEKVNENQSRHPYGVDMDNYEENNRLDIDLKSEVKLSAPFSANDNYEDYVXXXXXXXXXXXXXXXXXXXXXXXTGRPERVMNXXXXXXXXXXXXXXXNPNEIEKEAQKPQEKAVYEDFRKQSEYKDQPKYELEIPTPEHSSDILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSANIKKEMPDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 1538
            MYSPESTEYTIKEEVFDTEYIPSKVECTDAYEEKVNENQSRHPYGVDMDNYEENNRLDIDLKSEVKLSAPFSANDNYEDYVNQENEELDEEDNRENEEFDGFNETGRPERVMNDIFGDSDEEEDFEGFNPNEIEKEAQKPQEKAVYEDFRKQSEYKDQPKYELEIPTPEHSSDILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSANIKKEMPDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFDEDDDDDEEEGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV
Sbjct:    1 MYSPESTEYTIKEEVFDTEYIPSKVECTDAYEEKVNENQSRHPYGVDMDNYEENNRLDIDLKSEVKLSAPFSANDNYEDYVNQENEELDEEDNRENEEFDGFNETGRPERVMNDIFGDSDEEEDFEGFNPNEIEKEAQKPQEKAVYEDFRKQSEYKDQPKYELEIPTPEHSSDILRCFEEVVEKQRIEKRLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSANIKKEMPDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFDEDDDDDEEEGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV 486          
BLAST of TFIIS N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000034974.1 (SMESG000034974.1)

HSP 1 Score: 213.386 bits (542), Expect = 7.325e-62
Identity = 122/297 (41.08%), Postives = 188/297 (63.30%), Query Frame = 3
Query:  648 RLNRPKKRTDVEFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNRSNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSDVLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMTREERLERDKAISITRKVPDKSANIK-KEMPDETATKPGDEGWIPRATVPKQSNKDYIIRPQWKYDGVKRSFXXXXXXXXXXGRNNRGPPKKRSKINNNANSTANWEKTFRKIREAGKQRKMIQRAANISIQGRGMG 1535
            ++ R +K+ +V ++N + D+++DL+N+M+LA +ED++LF +G+P  KK+ L+  +  +L  +++   LI+S+FL V+A WL+PL  HILPPLDIRIV L+ALL+FP LSSD L +SNIGKAVMYL KHP+ET ENK  A  LI++WSR +F    N + +  EE+  +D +++I RK P  +A +   E+ D  A     +  I R  +PK SN +Y+IRP+W+ D  KR  D D D D  +  N        +++    N T   ++  +K  +  +Q K++ RA N+SI GR + 
Sbjct:  284 KVQRNRKQRNVAYVNNLQDKVSDLINRMKLAVIEDKKLFSLGKPAFKKIILMPEITPILELTHLSNILIQSQFLTVIATWLQPLGKHILPPLDIRIVFLQALLNFPPLSSDDLLKSNIGKAVMYLSKHPEETIENKTKAKKLIDKWSRIVFRNPIN-ENLNTEEKQTKDSSMNIVRKSPGLNAKLSFDEVSDNEAVDKTKQK-IERVAIPKSSNTEYVIRPKWRVDDRKRPADIDSDSDSAKMEN--------TELEIEENKTH--KRVIKKYCQTKRQ-KLVDRAFNVSICGRNLN 567          
The following BLAST results are available for this feature:
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IWS12.264e-5241.94interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
IWS11.334e-4049.68interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F13B12.11.389e-5036.69IWS1-like protein [Source:UniProtKB/Swiss-Prot;Ac... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG99151.029e-4738.73gene:FBgn0030738 transcript:FBtr0336976[more]
CG99151.029e-4738.73gene:FBgn0030738 transcript:FBtr0112992[more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01044053.12.304e-4940.96IWS1, SUPT6H interacting protein [Source:NCBI gene... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fgfr31.015e-5041.32fibroblast growth factor receptor 3 (achondroplasi... [more]
fgfr31.807e-5043.36fibroblast growth factor receptor 3 (achondroplasi... [more]
fgfr31.994e-5041.67fibroblast growth factor receptor 3 (achondroplasi... [more]
fgfr32.102e-5041.32fibroblast growth factor receptor 3 (achondroplasi... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Iws17.585e-5241.43IWS1, SUPT6 interacting protein [Source:MGI Symbol... [more]
Iws17.972e-5241.06IWS1, SUPT6 interacting protein [Source:MGI Symbol... [more]
Iws11.536e-4347.90IWS1, SUPT6 interacting protein [Source:MGI Symbol... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96ST2|IWS1_HUMAN1.087e-5141.94Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IW... [more]
sp|Q3SWT4|IWS1_RAT4.034e-5141.53Protein IWS1 homolog OS=Rattus norvegicus OX=10116... [more]
sp|Q8C1D8|IWS1_MOUSE5.306e-5141.43Protein IWS1 homolog OS=Mus musculus OX=10090 GN=I... [more]
sp|Q19375|IWS1_CAEEL1.767e-4936.69IWS1-like protein OS=Caenorhabditis elegans OX=623... [more]
sp|Q505H7|IWS1_XENTR2.698e-4943.36Protein IWS1 homolog OS=Xenopus tropicalis OX=8364... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183P9S28.444e-5741.55TFIIS N-terminal domain-containing protein OS=Schi... [more]
A0A183KKG78.625e-5741.55TFIIS N-terminal domain-containing protein OS=Schi... [more]
A0A183LKS31.036e-5641.55TFIIS N-terminal domain-containing protein OS=Schi... [more]
A0A0R3T8251.689e-5640.06TFIIS N-terminal domain-containing protein OS=Rode... [more]
R7VFW22.504e-5639.22TFIIS N-terminal domain-containing protein OS=Capi... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
IWS11.458e-5338.13interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
IWS19.493e-5236.05interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
IWS16.532e-5140.98interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
IWS17.115e-5140.98interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IWS19.700e-5240.56interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPN11.435e-1727.95Protein involved in RNA polymerase II transcriptio... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO363441.492e-4934.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IWS11.270e-5041.38interacts with SUPT6H, CTD assembly factor 1 [Sour... [more]
back to top
BLAST of TFIIS N-terminal domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000058491.10.000e+0100.00SMESG000058491.1[more]
SMESG000034974.17.325e-6241.08SMESG000034974.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002106 ID=SMED30002106|Name=TFIIS N-terminal domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1636bp
CATAAATTTGTTTAAGTATCGAATGATATTTGAAACTTAATCTTGTAATT
ATTTAGTATAAAATATTTTTAAGCCCAGATATGTATTCTCCAGAAAGTAC
TGAGTATACAATAAAAGAAGAAGTCTTTGATACTGAATATATACCGAGTA
AAGTAGAATGTACTGATGCGTATGAAGAGAAAGTTAATGAAAATCAATCC
AGACATCCTTATGGAGTAGATATGGACAATTACGAGGAGAATAATCGATT
GGACATTGATTTGAAAAGTGAAGTAAAATTATCGGCTCCGTTTTCAGCCA
ATGATAACTATGAAGATTATGTTAATCAAGAAAATGAAGAATTAGACGAA
GAAGATAATCGTGAAAATGAGGAATTTGATGGATTTAATGAAACTGGGCG
CCCCGAAAGGGTTATGAATGATATTTTCGGTGATAGTGACGAAGAAGAAG
ACTTTGAAGGTTTCAATCCAAACGAAATCGAAAAAGAAGCACAAAAGCCT
CAAGAAAAAGCCGTATATGAAGATTTCAGAAAACAATCTGAATACAAAGA
TCAACCAAAGTATGAACTTGAAATTCCAACTCCAGAACATAGTAGTGACA
TTTTACGATGCTTTGAAGAAGTCGTGGAGAAGCAAAGAATTGAAAAAAGA
TTGAATCGACCGAAAAAAAGAACAGACGTAGAATTTCTAAATGAAATGGA
TGATAGAATAGCAGATCTAATGAATAAAATGAGATTAGCCGCAGTGGAAG
ATGAAGAACTTTTTCACATGGGACAACCAGGAATTAAAAAAATGCAACTT
TTGAATGCAGTTAAGGATATGCTAAACAGATCAAATATAAAAGAAGCTCT
AATTGAGTCGAAATTTCTAGTTGTTATGGCAGCTTGGTTAAAGCCATTAC
CAAATCATATTTTACCTCCGTTGGATATTCGAATCGTTATGCTTAAGGCT
TTATTAGATTTTCCAACCCTTTCATCAGACGTGTTGCGTGAAAGCAACAT
CGGGAAAGCAGTCATGTATCTTTGCAAGCATCCTAAAGAAACTCCAGAAA
ACAAAAAAATCGCAACCTATCTCATTAATGAGTGGTCGAGGCCGATTTTT
CACCTGTCCAGTAATTATGATGGCATGACTCGTGAAGAGCGACTGGAAAG
AGATAAAGCAATCAGTATAACTAGAAAAGTACCCGATAAAAGTGCCAATA
TAAAAAAAGAAATGCCCGATGAAACTGCTACAAAACCTGGTGATGAAGGT
TGGATTCCTCGAGCTACCGTTCCGAAGCAGTCAAACAAAGACTATATAAT
CAGACCACAATGGAAATATGATGGTGTTAAGCGTTCGTTTGATGAGGATG
ATGATGACGACGAAGAGGAAGGTCGCAACAATCGTGGTCCGCCTAAAAAA
CGATCTAAAATCAATAATAATGCAAACAGTACTGCAAATTGGGAGAAAAC
GTTCAGAAAAATCCGTGAAGCTGGTAAACAACGTAAAATGATCCAGCGAG
CTGCAAACATCAGTATACAAGGACGAGGCATGGGTGTTTAATATGTCGAT
TATTCATTGACATTTGCTGTTCATGTATTTGCTGTAATAAAATAATAAAT
TGTTTTCTATCTTAGCTCATTCTGTATTCTTTCTTT
back to top

protein sequence of SMED30002106-orf-1

>SMED30002106-orf-1 ID=SMED30002106-orf-1|Name=SMED30002106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MYSPESTEYTIKEEVFDTEYIPSKVECTDAYEEKVNENQSRHPYGVDMDN
YEENNRLDIDLKSEVKLSAPFSANDNYEDYVNQENEELDEEDNRENEEFD
GFNETGRPERVMNDIFGDSDEEEDFEGFNPNEIEKEAQKPQEKAVYEDFR
KQSEYKDQPKYELEIPTPEHSSDILRCFEEVVEKQRIEKRLNRPKKRTDV
EFLNEMDDRIADLMNKMRLAAVEDEELFHMGQPGIKKMQLLNAVKDMLNR
SNIKEALIESKFLVVMAAWLKPLPNHILPPLDIRIVMLKALLDFPTLSSD
VLRESNIGKAVMYLCKHPKETPENKKIATYLINEWSRPIFHLSSNYDGMT
REERLERDKAISITRKVPDKSANIKKEMPDETATKPGDEGWIPRATVPKQ
SNKDYIIRPQWKYDGVKRSFDEDDDDDEEEGRNNRGPPKKRSKINNNANS
TANWEKTFRKIREAGKQRKMIQRAANISIQGRGMGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035441TFIIS/LEDGF_dom_sf
IPR017923TFIIS_N
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 203..223
NoneNo IPR availableCOILSCoilCoilcoord: 74..94
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..98
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 366..384
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 366..397
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 440..455
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 417..455
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 74..105
NoneNo IPR availablePANTHERPTHR46010FAMILY NOT NAMEDcoord: 63..484
IPR017923Transcription factor IIS, N-terminalPFAMPF08711Med26coord: 287..339
e-value: 4.2E-14
score: 52.3
IPR017923Transcription factor IIS, N-terminalPROSITEPS51319TFIIS_Ncoord: 264..342
score: 17.988
IPR035441TFIIS/LEDGF domain superfamilyGENE3DG3DSA:1.20.930.10coord: 203..345
e-value: 2.2E-42
score: 146.1
IPR035441TFIIS/LEDGF domain superfamilySUPERFAMILYSSF47676Conserved domain common to transcription factors TFIIS, elongin A, CRSP70coord: 290..338