Cilia- and flagella-associated protein 97

Overview
NameCilia- and flagella-associated protein 97
Smed IDSMED30002078
Length (bp)1242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia- and flagella-associated protein 97 (SMED30002078) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia- and flagella-associated protein 97 (SMED30002078) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia- and flagella-associated protein 97 (SMED30002078) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia- and flagella-associated protein 97 (SMED30002078) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002078

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002078SMESG000032495.1 SmedASXL_001445SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30002078SMESG000032495.1 OX_Smed_1.0.16975ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Human
Match: CFAP97 (cilia and flagella associated protein 97 [Source:HGNC Symbol;Acc:HGNC:29276])

HSP 1 Score: 54.6842 bits (130), Expect = 1.844e-7
Identity = 31/92 (33.70%), Postives = 55/92 (59.78%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVRRTNSS 1050
            +LYH+A+NR KE+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + N S    RARS +   +P  R   +++++SG+  R   S+
Sbjct:  420 KLYHSALNRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRARSTLGQYSP-LRASRTSSATSGLSCRSERSA 510          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Zebrafish
Match: cfap97 (cilia and flagella associated protein 97 [Source:ZFIN;Acc:ZDB-GENE-030131-9405])

HSP 1 Score: 61.6178 bits (148), Expect = 7.091e-10
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRF 939
            RLYH+A+NR +E++RI KEN     RL  ++P+PGITKDE L +Y +  R+
Sbjct:  353 RLYHSALNRQREQERIQKENLAFLKRLESVKPTPGITKDEQLADYQRQCRY 403          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Zebrafish
Match: cfap97 (cilia and flagella associated protein 97 [Source:ZFIN;Acc:ZDB-GENE-030131-9405])

HSP 1 Score: 60.4622 bits (145), Expect = 1.577e-9
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRF 939
            RLYH+A+NR +E++RI KEN     RL  ++P+PGIT+DE L +Y +  R+
Sbjct:  353 RLYHSALNRQREQERIQKENLAFLKRLESVKPTPGITRDEQLADYQRQCRY 403          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Zebrafish
Match: cfap97 (cilia and flagella associated protein 97 [Source:ZFIN;Acc:ZDB-GENE-030131-9405])

HSP 1 Score: 60.4622 bits (145), Expect = 1.577e-9
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRF 939
            RLYH+A+NR +E++RI KEN     RL  ++P+PGIT+DE L +Y +  R+
Sbjct:  353 RLYHSALNRQREQERIQKENLAFLKRLESVKPTPGITRDEQLADYQRQCRY 403          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Xenopus
Match: mtss1.2 (metastasis suppressor 1, gene 2 [Source:Xenbase;Acc:XB-GENE-5824175])

HSP 1 Score: 52.373 bits (124), Expect = 8.259e-7
Identity = 33/99 (33.33%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRF-----SNPSRARSRVASTTPTCRPQS-SANSSSGMKVRRTNSSTIISR 1065
            RLYH+AINR KE+ RI++EN  +  RL  ++P+ G+T+ E L +Y +   +      +P   ++ V+  +P+      S  SS+  +  RT SS  + R
Sbjct:  357 RLYHSAINRQKEQQRIERENMALLKRLESVKPTVGMTRTEQLMDYQRQAGYLSATALSPRPGKASVSRLSPSVSSGGFSRMSSATNRSERTGSSGALLR 455          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Mouse
Match: Cfap97 (cilia and flagella associated protein 97 [Source:MGI Symbol;Acc:MGI:1914006])

HSP 1 Score: 53.5286 bits (127), Expect = 3.416e-7
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVR 1035
            +LYH+A+NR +E+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + NPS    R RS +   +P      +++++SG+  +
Sbjct:  429 KLYHSALNRQREQQRIERENMALLKRLEAVKPTVGMKRSEQLMDYHRNMSYLNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCK 515          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Mouse
Match: Cfap97 (cilia and flagella associated protein 97 [Source:MGI Symbol;Acc:MGI:1914006])

HSP 1 Score: 53.5286 bits (127), Expect = 3.416e-7
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVR 1035
            +LYH+A+NR +E+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + NPS    R RS +   +P      +++++SG+  +
Sbjct:  429 KLYHSALNRQREQQRIERENMALLKRLEAVKPTVGMKRSEQLMDYHRNMSYLNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCK 515          
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Mouse
Match: Cfap97 (cilia and flagella associated protein 97 [Source:MGI Symbol;Acc:MGI:1914006])

HSP 1 Score: 53.1434 bits (126), Expect = 3.719e-7
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVR 1035
            +LYH+A+NR +E+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + NPS    R RS +   +P      +++++SG+  +
Sbjct:  429 KLYHSALNRQREQQRIERENMALLKRLEAVKPTVGMKRSEQLMDYHRNMSYLNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCK 515          
BLAST of Cilia- and flagella-associated protein 97 vs. UniProt/SwissProt
Match: sp|Q9P2B7|CFA97_HUMAN (Cilia- and flagella-associated protein 97 OS=Homo sapiens OX=9606 GN=CFAP97 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 8.856e-7
Identity = 31/92 (33.70%), Postives = 55/92 (59.78%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVRRTNSS 1050
            +LYH+A+NR KE+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + N S    RARS +   +P  R   +++++SG+  R   S+
Sbjct:  420 KLYHSALNRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRARSTLGQYSP-LRASRTSSATSGLSCRSERSA 510          
BLAST of Cilia- and flagella-associated protein 97 vs. UniProt/SwissProt
Match: sp|Q6ZPR1|CFA97_MOUSE (Cilia- and flagella-associated protein 97 OS=Mus musculus OX=10090 GN=Cfap97 PE=1 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 2.390e-6
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVR 1035
            +LYH+A+NR +E+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + NPS    R RS +   +P      +++++SG+  +
Sbjct:  429 KLYHSALNRQREQQRIERENMALLKRLEAVKPTVGMKRSEQLMDYHRNMSYLNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCK 515          
BLAST of Cilia- and flagella-associated protein 97 vs. UniProt/SwissProt
Match: sp|Q5RD75|CFA97_PONAB (Cilia- and flagella-associated protein 97 OS=Pongo abelii OX=9601 GN=CFAP97 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.021e-6
Identity = 29/92 (31.52%), Postives = 54/92 (58.70%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVRRTNSS 1050
            +LYH+A++R KE+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + N S    RARS +   +P      +++++SG+  R   S+
Sbjct:  417 KLYHSALSRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRARSTLGQYSPLRGASRTSSATSGLSCRSERSA 508          
BLAST of Cilia- and flagella-associated protein 97 vs. UniProt/SwissProt
Match: sp|Q66H34|CFA97_RAT (Cilia- and flagella-associated protein 97 OS=Rattus norvegicus OX=10116 GN=Cfap97 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.539e-6
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPS----RARSRVASTTPTCRPQSSANSSSGMKVR 1035
            +LYH+A+NR +E+ RI++EN  +  RL  ++P+ G+ + E L +Y +   + NPS    R RS +   +P      +++++SG+  +
Sbjct:  430 KLYHSALNRQREQQRIERENMALLKRLEAVKPTVGMKRSEQLMDYHRNISYLNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCK 516          
BLAST of Cilia- and flagella-associated protein 97 vs. UniProt/SwissProt
Match: sp|A4IJ15|CFA97_XENTR (Cilia- and flagella-associated protein 97 OS=Xenopus tropicalis OX=8364 GN=cfap97 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 4.414e-6
Identity = 33/99 (33.33%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  787 RLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRF-----SNPSRARSRVASTTPTCRPQS-SANSSSGMKVRRTNSSTIISR 1065
            RLYH+AINR KE+ RI++EN  +  RL  ++P+ G+T+ E L +Y +   +      +P   ++ V+  +P+      S  SS+  +  RT SS  + R
Sbjct:  357 RLYHSAINRQKEQQRIERENMALLKRLESVKPTVGMTRTEQLMDYQRQAGYLSATALSPRPGKASVSRLSPSVSSGGFSRMSSATNRSERTGSSGALLR 455          
BLAST of Cilia- and flagella-associated protein 97 vs. TrEMBL
Match: A0A504YM61 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_07424 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.289e-8
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  415 SESESDVTNVSS-LDSANSPRMPVTRKPPKEVVKPHNSKYHTHISTMDDVDM--IPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVSMPKRNIRSNPFYSHNVDIE-KRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKL 930
            SE ESDVT+VS+     ++   P+   P        N K        D  +M  +  + + +AM RI+++ + + + +P W DPN+         +  +L  E       R I  N  +    +I   R YH  +NR ++++RI  EN  +  RL+ +RPSPG+T+ E L+EY + 
Sbjct:  157 SEDESDVTDVSNEFPEPHTNNTPIYSSP--------NRKNQLQQDNSDPSEMRQLQAQQLTKAMNRINKKLQTM-RFRPPWRDPNSNPLPSDRTASFYDLYEEFTRKSKDRPISDNGQWVAQAEIAVCRPYHATLNRYRQQERIQMENYALARRLQNVRPSPGMTRKEQLREYKRY 323          
BLAST of Cilia- and flagella-associated protein 97 vs. TrEMBL
Match: A0A4E0R6H0 (DNA topoisomerase III OS=Fasciola hepatica OX=6192 GN=D915_006301 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.356e-8
Identity = 49/174 (28.16%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  415 SESESDVTNVSS-LDSANSPRMPVTRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVSMPKRNIRSNPFYSHNVDIE-KRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKL 930
            SE ESDVT+VS+     ++   P+   P ++      ++     S   ++  I  + + +AM RI+++ + + + +P W DPN+         +  +L  E       R I  N  +    +I   R YH  +NR ++++RI  EN  +  RL+ +RPSPG+T+ E L+EY + 
Sbjct:  157 SEDESDVTDVSNEFPEPHTNNTPIYSSPSRK------NQLQQDNSDPSEMRQIQAKQLTKAMNRINKKLQTM-RFRPPWRDPNSNPLPSDRTASFYDLYEEFTRKSKDRPISDNGQWVAQAEIAVCRPYHATLNRYRQQERIQMENYALARRLQNVRPSPGMTRKEQLREYKRY 323          
BLAST of Cilia- and flagella-associated protein 97 vs. TrEMBL
Match: A0A267GPN4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020102g3 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 8.729e-8
Identity = 65/220 (29.55%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  430 DVTNVSSLDSA---NSPRMPV--------TRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVS--MPKRNIRSNPFYSHNVDIE-KRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNP-------SRARSRVASTTPTCRPQSSANSSSGM 1026
            DVT+VS L S    +SPR            RKPP+          H   +   D D I  E I++A++ +  ++R  Q   P+    ++   S+S I   +    +R++   M  +N    P   +N+D   KR +H+ +NR KE+ RI++EN++I  RL+QIRP+ G+++DE++ +Y +   F  P       S  R    +  P C+P S  +SS+ +
Sbjct:  165 DVTDVSPLSSPRGHDSPRAAAMGDAADLSARKPPRVAAG------HQGGAEDRDEDRINMETIVRALVEL--DKRRGQSAGPQRSGLHSGTQSMSRIHD-IEAENQRLLYNLMRTKNRAKKP---NNIDPPVKRPHHSTVNRQKEQRRIEEENRKIFQRLKQIRPTRGMSRDEMISDYKRQASFGLPLSLLGEESNYRQPRITQNPYCQPVSRVHSSTSI 372          
BLAST of Cilia- and flagella-associated protein 97 vs. TrEMBL
Match: A0A267EVU0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020102g2 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.675e-7
Identity = 64/217 (29.49%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  430 DVTNVSSLDSA---NSPRMPV--------TRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVS--MPKRNIRSNPFYSHNVDIE-KRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNP-------SRARSRVASTTPTCRPQSSANSS 1017
            DVT+VS L S    +SPR            RKPP+          H   +   D D I  E I++A++ +  ++R  Q   P+    ++   S+S I   +    +R++   M  +N    P   +N+D   KR +H+ +NR KE+ RI++EN++I  RL++IRP+ G+++DE++ +Y +   F  P       S  R    +  P C+P S  +SS
Sbjct:  165 DVTDVSPLSSPRGHDSPRAAAMGDAADLSARKPPRVAAG------HQGGAEDRDEDRINMETIVRALVEL--DKRRGQSAGPQRSGLHSGTQSMSRIHD-IEAENQRLLYNLMRTKNRAKKP---NNIDPPVKRPHHSTVNRQKEQRRIEEENRKIFQRLKRIRPTRGMSRDEMISDYKRQASFGLPLSLLGEESNYRQPRITQNPYCQPVSRVHSS 369          
BLAST of Cilia- and flagella-associated protein 97 vs. TrEMBL
Match: A0A267F424 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020102g1 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.537e-7
Identity = 64/220 (29.09%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  430 DVTNVSSLDSA---NSPRMPV--------TRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVS--MPKRNIRSNPFYSHNVDIE-KRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNP-------SRARSRVASTTPTCRPQSSANSSSGM 1026
            DVT+VS L S    +SPR            RKPP+          H   +   D D I  E I++A++ +  ++R  Q   P+    ++   S+S I   +    +R++   M  +N    P   +N+D   KR +H+ +NR KE+ RI++EN++I  RL++IRP+ G+++DE++ +Y +   F  P       S  R    +  P C+P S  +SS+ +
Sbjct:  165 DVTDVSPLSSPRGHDSPRAAAMGDAADLSARKPPRVAAG------HQGGAEDCDEDRINMETIVRALVEL--DKRRGQSAGPQRSGLHSGTQSMSRIHD-IEAENQRLLYNLMRTKNRAKKP---NNIDPPVKRPHHSTVNRQKEQRRIEEENRKIFQRLKRIRPTRGMSRDEMISDYKRQASFGLPLSLLGEESNYRQPRITQNPYCQPVSRVHSSTSI 372          
BLAST of Cilia- and flagella-associated protein 97 vs. Planmine SMEST
Match: SMESG000032495.1 (SMESG000032495.1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 367/369 (99.46%), Postives = 368/369 (99.73%), Query Frame = 1
Query:   31 MAKFDDSNDELNHEVDFDFFDDQNSELPNSNNNAVIKSSKSDLNKVINSQADSFEKPYHDSERSNTSKLKHXXXXXXXXXXXXXXXXXXXXXXXXXXXKFEXXXXXXXXXXXXXXXXXXXXHELCDENSESESDVTNVSSLDSANSPRMPVTRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVSMPKRNIRSNPFYSHNVDIEKRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPSRARSRVASTTPTCRPQSSANSSSGMKVRRTNSSTIISRFVESRQSNSRKSEPKRVMSAISLA 1137
            MAKFDDSNDELNHEVDFDFFDDQNSEL NSNNNAVIKSSKSDLNKVINSQADSFEKPYHDSERSNTSKLKHSDDSEDETSSSSSLSSKSSKSLSKYSEKFEKISIDENKSSNSSSKLSNSIHELCDENSESESDVTNVSSLDSANSPRMPVTRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVSMPKRNIRSNPFYSHNVDIEKRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPSRARSRVASTTPTCRPQSSANSSSGMKVRRTNSSTIISRFVESRQSNSRKS+PKRVMSAISLA
Sbjct:    1 MAKFDDSNDELNHEVDFDFFDDQNSELSNSNNNAVIKSSKSDLNKVINSQADSFEKPYHDSERSNTSKLKHSDDSEDETSSSSSLSSKSSKSLSKYSEKFEKISIDENKSSNSSSKLSNSIHELCDENSESESDVTNVSSLDSANSPRMPVTRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQKMKPKWVDPNTKDYSVSGITTKLNLIPERVVSMPKRNIRSNPFYSHNVDIEKRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKLNRFSNPSRARSRVASTTPTCRPQSSANSSSGMKVRRTNSSTIISRFVESRQSNSRKSDPKRVMSAISLA 369          
The following BLAST results are available for this feature:
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CFAP971.844e-733.70cilia and flagella associated protein 97 [Source:H... [more]
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap977.091e-1050.98cilia and flagella associated protein 97 [Source:Z... [more]
cfap971.577e-949.02cilia and flagella associated protein 97 [Source:Z... [more]
cfap971.577e-949.02cilia and flagella associated protein 97 [Source:Z... [more]
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mtss1.28.259e-733.33metastasis suppressor 1, gene 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cfap973.416e-731.03cilia and flagella associated protein 97 [Source:M... [more]
Cfap973.416e-731.03cilia and flagella associated protein 97 [Source:M... [more]
Cfap973.719e-731.03cilia and flagella associated protein 97 [Source:M... [more]
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P2B7|CFA97_HUMAN8.856e-733.70Cilia- and flagella-associated protein 97 OS=Homo ... [more]
sp|Q6ZPR1|CFA97_MOUSE2.390e-631.03Cilia- and flagella-associated protein 97 OS=Mus m... [more]
sp|Q5RD75|CFA97_PONAB3.021e-631.52Cilia- and flagella-associated protein 97 OS=Pongo... [more]
sp|Q66H34|CFA97_RAT3.539e-631.03Cilia- and flagella-associated protein 97 OS=Rattu... [more]
sp|A4IJ15|CFA97_XENTR4.414e-633.33Cilia- and flagella-associated protein 97 OS=Xenop... [more]
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YM614.289e-828.98Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4E0R6H05.356e-828.16DNA topoisomerase III OS=Fasciola hepatica OX=6192... [more]
A0A267GPN48.729e-829.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EVU04.675e-729.49Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F4245.537e-729.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia- and flagella-associated protein 97 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032495.10.000e+099.46SMESG000032495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002078 ID=SMED30002078|Name=Cilia- and flagella-associated protein 97|organism=Schmidtea mediterranea sexual|type=transcript|length=1242bp
AAAACAAATAAATGTTTATCTTAAATTTGAATGGCAAAATTTGATGATTC
AAATGATGAATTAAATCATGAAGTTGATTTTGATTTTTTCGATGATCAGA
ATTCAGAATTACCTAACTCGAATAATAATGCTGTAATTAAATCATCAAAA
AGTGATTTAAACAAGGTAATAAATTCACAAGCAGATTCATTTGAGAAACC
ATATCATGATTCAGAAAGGTCTAATACTTCTAAGTTAAAGCATTCTGATG
ACAGTGAAGACGAGACTTCAAGTTCTTCTTCTCTTTCGTCAAAATCATCA
AAAAGTTTGTCGAAATATTCAGAAAAATTCGAAAAAATATCTATTGATGA
AAATAAAAGTTCAAATTCTTCTTCAAAACTCAGCAATTCAATCCATGAAT
TATGCGATGAGAACTCAGAGAGCGAGTCTGACGTGACAAACGTATCATCA
CTCGACTCAGCAAATTCTCCTCGCATGCCAGTGACTAGAAAACCACCTAA
AGAAGTAGTGAAGCCACATAATTCAAAATATCATACTCATATATCAACTA
TGGACGATGTCGACATGATACCAACAGAAGTAATTCTACAAGCTATGATG
AGAATTCACGAAGAGCGCAGATTGGTTCAGAAAATGAAACCGAAATGGGT
TGATCCGAATACGAAAGATTATTCGGTTTCTGGAATAACGACCAAATTGA
ATCTGATACCCGAACGGGTCGTTTCAATGCCGAAAAGGAATATCCGATCA
AATCCCTTTTATTCCCATAATGTCGATATCGAAAAACGACTTTATCACAC
GGCAATAAACAGGAGCAAAGAAAAAGATCGCATTGATAAAGAAAATAAGG
AAATCGAGCTACGTTTGCGACAGATTCGCCCAAGTCCTGGAATTACAAAA
GATGAATTATTGAAAGAATATTCTAAATTAAATAGGTTTTCGAATCCCTC
GAGAGCTAGATCTCGTGTCGCATCTACGACGCCAACGTGTCGACCCCAAT
CATCCGCTAATAGCAGTAGTGGCATGAAAGTTCGACGAACGAATAGCTCA
ACAATCATATCGAGATTTGTCGAGAGTCGTCAGTCCAATTCTAGAAAATC
AGAACCGAAACGAGTCATGTCTGCCATTTCGTTGGCATCGAGTAATACGA
GACGAAGCAATACTTCAGTTCGTTTAGAAAATATATGATAATTATTTTAA
TATCGTGATCAAATACTGTTATTATTATCATTATTATTATCA
back to top

protein sequence of SMED30002078-orf-1

>SMED30002078-orf-1 ID=SMED30002078-orf-1|Name=SMED30002078-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
MAKFDDSNDELNHEVDFDFFDDQNSELPNSNNNAVIKSSKSDLNKVINSQ
ADSFEKPYHDSERSNTSKLKHSDDSEDETSSSSSLSSKSSKSLSKYSEKF
EKISIDENKSSNSSSKLSNSIHELCDENSESESDVTNVSSLDSANSPRMP
VTRKPPKEVVKPHNSKYHTHISTMDDVDMIPTEVILQAMMRIHEERRLVQ
KMKPKWVDPNTKDYSVSGITTKLNLIPERVVSMPKRNIRSNPFYSHNVDI
EKRLYHTAINRSKEKDRIDKENKEIELRLRQIRPSPGITKDELLKEYSKL
NRFSNPSRARSRVASTTPTCRPQSSANSSSGMKVRRTNSSTIISRFVESR
QSNSRKSEPKRVMSAISLASSNTRRSNTSVRLENI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 107..122
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 304..362
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 304..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 107..162
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..93