Macrophage migration inhibitory factor

Overview
NameMacrophage migration inhibitory factor
Smed IDSMED30002076
Length (bp)727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Macrophage migration inhibitory factor (SMED30002076) t-SNE clustered cells

Violin plots show distribution of expression levels for Macrophage migration inhibitory factor (SMED30002076) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Macrophage migration inhibitory factor (SMED30002076) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Macrophage migration inhibitory factor (SMED30002076) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002076

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002076SMESG000075635.1 dd_Smed_v4_2244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002076SMESG000075635.1 dd_Smed_v4_2244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002076SMESG000075635.1 dd_Smed_v4_2244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002076SMESG000075635.1 dd_Smed_v4_2244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002076SMESG000075635.1 Contig42696newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002076SMESG000075635.1 Contig42696uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Macrophage migration inhibitory factor vs. Ensembl Human
Match: MIF (macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097])

HSP 1 Score: 102.834 bits (255), Expect = 2.419e-27
Identity = 47/115 (40.87%), Postives = 73/115 (63.48%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV ++ VP+G     +Q+ A+  GKP  Y+A ++  D +MAFGGSSEPCAL +L  +G+    ++ +YSK +  LL E L IS +R Y+++   +A N+G+   TFA
Sbjct:    1 MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Human
Match: MIF (macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097])

HSP 1 Score: 102.834 bits (255), Expect = 2.419e-27
Identity = 47/115 (40.87%), Postives = 73/115 (63.48%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV ++ VP+G     +Q+ A+  GKP  Y+A ++  D +MAFGGSSEPCAL +L  +G+    ++ +YSK +  LL E L IS +R Y+++   +A N+G+   TFA
Sbjct:    1 MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Human
Match: DDT (D-dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2732])

HSP 1 Score: 64.6994 bits (156), Expect = 7.174e-13
Identity = 34/112 (30.36%), Postives = 58/112 (51.79%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP L + TN+  ++VP GL        A ++GKP D V   +     MA  GS+EPCA ++++ +G   +A+ + ++S    E L + L + ++R  + F    +  IG  G
Sbjct:    1 MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIG 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Human
Match: DDT (D-dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2732])

HSP 1 Score: 64.6994 bits (156), Expect = 7.174e-13
Identity = 34/112 (30.36%), Postives = 58/112 (51.79%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP L + TN+  ++VP GL        A ++GKP D V   +     MA  GS+EPCA ++++ +G   +A+ + ++S    E L + L + ++R  + F    +  IG  G
Sbjct:    1 MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIG 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Human
Match: DDT (D-dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2732])

HSP 1 Score: 64.6994 bits (156), Expect = 7.174e-13
Identity = 34/112 (30.36%), Postives = 58/112 (51.79%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP L + TN+  ++VP GL        A ++GKP D V   +     MA  GS+EPCA ++++ +G   +A+ + ++S    E L + L + ++R  + F    +  IG  G
Sbjct:    1 MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIG 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Celegans
Match: mif-2 (MIF-like protein mif-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18785])

HSP 1 Score: 65.0846 bits (157), Expect = 4.081e-13
Identity = 30/116 (25.86%), Postives = 59/116 (50.86%), Query Frame = 3
Query:   18 KMPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            KMP++ + TN+   KVP    I  +   A+ MGKP + +A  I+    +  G + +P  ++++  +G  SA+ +   +  ++E   + LG+ K++  + F       +G+ G T A
Sbjct:   21 KMPMVRVATNLPNEKVPVDFEIRLTDLLARSMGKPRERIAVEIAAGARLVHGATHDPVTVISIKSIGAVSAEDNIRNTAAITEFCGKELGLPKDKVVITFHDLPPATVGFNGTTVA 136          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Celegans
Match: mif-2 (MIF-like protein mif-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18785])

HSP 1 Score: 63.1586 bits (152), Expect = 1.048e-12
Identity = 29/115 (25.22%), Postives = 58/115 (50.43%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP++ + TN+   KVP    I  +   A+ MGKP + +A  I+    +  G + +P  ++++  +G  SA+ +   +  ++E   + LG+ K++  + F       +G+ G T A
Sbjct:    1 MPMVRVATNLPNEKVPVDFEIRLTDLLARSMGKPRERIAVEIAAGARLVHGATHDPVTVISIKSIGAVSAEDNIRNTAAITEFCGKELGLPKDKVVITFHDLPPATVGFNGTTVA 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Celegans
Match: mif-1 (MIF (Macrophage migration Inhibitory Factor) related [Source:UniProtKB/TrEMBL;Acc:Q9U228])

HSP 1 Score: 61.6178 bits (148), Expect = 4.547e-12
Identity = 39/120 (32.50%), Postives = 59/120 (49.17%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVP----EGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQ-ASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+ +I  NV   KVP      +    S    KL+ KP  Y+  +   D  + + G++EP     L  +G   SA+++   S  +  ++ +HLGI  NR Y+ FV   A +I Y G TFA
Sbjct:    1 MPVFSINVNV---KVPAEKQNEILKELSTVLGKLLNKPEQYMCIHFHEDQGILYAGTTEPAGFAVLKSIGGVGSAKQNNAISAVVFPIIEKHLGIPGNRLYIEFVNLGAADIAYNGQTFA 117          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Celegans
Match: mif-2 (MIF-like protein mif-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18785])

HSP 1 Score: 45.4394 bits (106), Expect = 1.820e-6
Identity = 20/85 (23.53%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  111 MGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MGKP + +A  I+    +  G + +P  ++++  +G  SA+ +   +  ++E   + LG+ K++  + F       +G+ G T A
Sbjct:    1 MGKPRERIAVEIAAGARLVHGATHDPVTVISIKSIGAVSAEDNIRNTAAITEFCGKELGLPKDKVVITFHDLPPATVGFNGTTVA 85          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Celegans
Match: mif-3 (MIF-like protein mif-3 [Source:UniProtKB/Swiss-Prot;Acc:P90835])

HSP 1 Score: 46.595 bits (109), Expect = 1.865e-6
Identity = 26/112 (23.21%), Postives = 55/112 (49.11%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGH 356
            MP++ + TNV K  V +G  +  +   AK+M +P   +  ++  ++ M  G  ++P A++ +T     +      Y+  + E   + L +  +   +++ + S E IG+ GH
Sbjct:    1 MPVIKVQTNVKK--VSDGFEVRLAIHMAKVMKRPESQIFVSLDMNSRMTRGQLTDPLAVLDVTSSTVLTPILTEEYTVALCEFFSQELALDSDAVLINYRSLSPELIGFNGH 110          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Zebrafish
Match: mif (macrophage migration inhibitory factor [Source:ZFIN;Acc:ZDB-GENE-080708-1])

HSP 1 Score: 105.145 bits (261), Expect = 1.824e-28
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV+K  VP  L    +QE AK MGKP  Y+A  +  D +M FGG  +PCAL +LT +G+ S  ++  YSK +  LL++HLG+S +R Y++FV     N+ +   TF 
Sbjct:    1 MPMFVVNTNVAKDSVPAELLSEATQELAKAMGKPQQYIAVQVVPDQMMMFGGKGDPCALCSLTSIGKISGAQNKQYSKLLMGLLNKHLGVSADRIYINFVDMDPANVAWNNSTFG 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Zebrafish
Match: mif (macrophage migration inhibitory factor [Source:ZFIN;Acc:ZDB-GENE-080708-1])

HSP 1 Score: 105.145 bits (261), Expect = 1.824e-28
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV+K  VP  L    +QE AK MGKP  Y+A  +  D +M FGG  +PCAL +LT +G+ S  ++  YSK +  LL++HLG+S +R Y++FV     N+ +   TF 
Sbjct:    1 MPMFVVNTNVAKDSVPAELLSEATQELAKAMGKPQQYIAVQVVPDQMMMFGGKGDPCALCSLTSIGKISGAQNKQYSKLLMGLLNKHLGVSADRIYINFVDMDPANVAWNNSTFG 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Zebrafish
Match: ddt (D-dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-040625-160])

HSP 1 Score: 68.1662 bits (165), Expect = 2.166e-14
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP +NI TN+  SK PE          A  +GKP D +   +  D  M F GSS PC L+T++ +G   +A+K+  +S ++ + L    G+S +R  + F       IG +G
Sbjct:    1 MPFINIETNLPASKFPEDFLKRLCSTLAAALGKPEDRMNLVVKPDLPMLFAGSSSPCVLMTVSAIGVTDTAEKNKQHSAKIFQFLQGEFGLSDDRILVLFYPLEPSQIGKKG 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Zebrafish
Match: ddt (D-dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-040625-160])

HSP 1 Score: 68.1662 bits (165), Expect = 2.166e-14
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP +NI TN+  SK PE          A  +GKP D +   +  D  M F GSS PC L+T++ +G   +A+K+  +S ++ + L    G+S +R  + F       IG +G
Sbjct:    1 MPFINIETNLPASKFPEDFLKRLCSTLAAALGKPEDRMNLVVKPDLPMLFAGSSSPCVLMTVSAIGVTDTAEKNKQHSAKIFQFLQGEFGLSDDRILVLFYPLEPSQIGKKG 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Xenopus
Match: cd2ap (CD2-associated protein [Source:Xenbase;Acc:XB-GENE-987810])

HSP 1 Score: 92.0485 bits (227), Expect = 2.731e-23
Identity = 40/115 (34.78%), Postives = 70/115 (60.87%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP   + TNV +  +P+ L    ++  AK  GKP +Y+A +I  D +M+FG S++PCA+ +L+ +G+    ++ +YSK + + L + + I  NR Y++F   +  N+G+ G TFA
Sbjct:    1 MPTFTVCTNVCRDSMPDTLLSDLTKLLAKATGKPAEYIAIHIMPDQMMSFGDSTDPCAVCSLSSIGKIGGPQNKSYSKLLCDYLTKQMNIPANRVYINFHDLNPANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Xenopus
Match: ddt (D-dopachrome tautomerase [Source:NCBI gene;Acc:550015])

HSP 1 Score: 57.3806 bits (137), Expect = 3.393e-10
Identity = 29/112 (25.89%), Postives = 56/112 (50.00%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP + + TN+   +VP+ L        A ++ KP + V   + T   M  GGS  PC  + ++ +G   +A+++  +S +  + L E++G+ ++R  L FV      +G + 
Sbjct:    1 MPFVELDTNLPPQQVPQDLAEKLCSATATILSKPRERVNVTVRTGVSMVVGGSCAPCTQLLVSSIGVVGTAEQNKEHSAKFFQFLTENMGLEQDRILLRFVPLEPWQVGKKA 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Mouse
Match: Mif (macrophage migration inhibitory factor (glycosylation-inhibiting factor) [Source:MGI Symbol;Acc:MGI:96982])

HSP 1 Score: 97.4413 bits (241), Expect = 2.089e-25
Identity = 43/115 (37.39%), Postives = 71/115 (61.74%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV ++ VPEG     +Q+ A+  GKP  Y+A ++  D +M F G+++PCAL +L  +G+    ++  YSK +  LL + L IS +R Y+++   +A N+G+ G TFA
Sbjct:    1 MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Mouse
Match: Ddt (D-dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:1298381])

HSP 1 Score: 59.3066 bits (142), Expect = 5.104e-11
Identity = 32/112 (28.57%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQA-SAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP + + TN+  S++P GL        A ++ KP D V+  I     +    S+EPCA + ++ +G   +A+++ T+S    + L E L + ++R  + F    A  IG +G
Sbjct:    1 MPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKG 112          
BLAST of Macrophage migration inhibitory factor vs. UniProt/SwissProt
Match: sp|Q1ZZU7|MIF_SHEEP (Macrophage migration inhibitory factor OS=Ovis aries OX=9940 GN=MIF PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.218e-28
Identity = 49/115 (42.61%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV ++ VP+GL    +Q+ A+  GKP  Y+A ++  D +M FGGSSEPCAL +L  +G+    ++ +YSK +  LL E L IS +R Y++F   +A N+G+ G TFA
Sbjct:    1 MPMFVVNTNVPRASVPDGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLTERLRISPDRIYINFCDMNAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. UniProt/SwissProt
Match: sp|P80177|MIF_BOVIN (Macrophage migration inhibitory factor OS=Bos taurus OX=9913 GN=MIF PE=1 SV=6)

HSP 1 Score: 107.842 bits (268), Expect = 1.218e-28
Identity = 49/115 (42.61%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV ++ VP+GL    +Q+ A+  GKP  Y+A ++  D +M FGGSSEPCAL +L  +G+    ++ +YSK +  LL E L IS +R Y++F   +A N+G+ G TFA
Sbjct:    1 MPMFVVNTNVPRASVPDGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLTERLRISPDRIYINFCDMNAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. UniProt/SwissProt
Match: sp|Q02960|MIF_CHICK (Macrophage migration inhibitory factor OS=Gallus gallus OX=9031 GN=MIF PE=3 SV=3)

HSP 1 Score: 107.457 bits (267), Expect = 1.542e-28
Identity = 47/115 (40.87%), Postives = 76/115 (66.09%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  I TNV K  VP+ L    +Q+ AK  GKP  Y+A +I  D +M+FGGS++PCAL +L  +G+   Q++ TY+K + +++ +HL +S +R Y+++   +A N+G+ G TFA
Sbjct:    1 MPMFTIHTNVCKDAVPDSLLGELTQQLAKATGKPAQYIAVHIVPDQMMSFGGSTDPCALCSLYSIGKIGGQQNKTYTKLLCDMIAKHLHVSADRVYINYFDINAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. UniProt/SwissProt
Match: sp|P80928|MIF_PIG (Macrophage migration inhibitory factor OS=Sus scrofa OX=9823 GN=MIF PE=1 SV=3)

HSP 1 Score: 106.686 bits (265), Expect = 3.000e-28
Identity = 48/115 (41.74%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV ++ VP+G     +Q+  + MGKP  Y+A ++  D +MAFGGSSEPCAL +L  +G+    ++ +YSK +  LL E L IS +R Y+++   +A N+G+ G TFA
Sbjct:    1 MPMFVVNTNVPRASVPDGFLSELTQQLVQAMGKPAQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRIYINYYDMNAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. UniProt/SwissProt
Match: sp|O55052|MIF_MERUN (Macrophage migration inhibitory factor OS=Meriones unguiculatus OX=10047 GN=MIF PE=3 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 2.592e-27
Identity = 48/115 (41.74%), Postives = 73/115 (63.48%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV +S VPEGL    +Q+ A+  GKP  Y+A ++  D +M F GSS+PCAL +L  +G+    ++ TYSK +  LL + L IS +R Y+++   +A N+G+ G TFA
Sbjct:    1 MPMFIVNTNVPRSSVPEGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGSSDPCALCSLHSIGKIGGAQNRTYSKLLCGLLADRLRISPDRIYINYYDMNAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. TrEMBL
Match: A0A402EDW5 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0002115 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 5.881e-28
Identity = 53/115 (46.09%), Postives = 75/115 (65.22%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+L I TNVS+  VPE LP   +Q+ AK  GKP  Y+A +I TD +M FGGS+EPCAL +L  +G+    ++  YSK + ELL + L I  +R Y+++   +A N+G+ G TFA
Sbjct:    1 MPMLVINTNVSRQAVPESLPGELTQQLAKATGKPAQYIAIHIVTDQLMTFGGSAEPCALCSLHSIGKIGGPQNKAYSKLVCELLTKTLQIPADRVYINYYDMNASNVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. TrEMBL
Match: A0A5C6MLV2 (Macrophage migration inhibitory factor OS=Takifugu flavidus OX=433684 GN=D4764_09G0006470 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 7.948e-28
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV+K+ VP  L    + E AK MGKP  Y+A +I+TD +M FGG  +PCAL +L  +G+ S  ++  YSK + + L +HLGIS NR Y++FV   A N+G+   TFA
Sbjct:    1 MPIFVVNTNVAKADVPAALLSEATNELAKAMGKPAQYIAVHINTDQMMMFGGKGDPCALCSLHSIGKISGAQNKQYSKLLCDQLSKHLGISPNRIYINFVDMDAANVGWNSDTFA 115          
BLAST of Macrophage migration inhibitory factor vs. TrEMBL
Match: A0A2I0TUC6 (Macrophage migration inhibitory factor-like OS=Limosa lapponica baueri OX=1758121 GN=llap_12310 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 8.387e-28
Identity = 51/115 (44.35%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP   + TN+SK KVPE LP   +Q+ +K MGKP  YVA  +S D +M+FGGS++PCA+  L  +G+   Q++  YSK + +LL++ L I  +R Y+ F   SA N+G+   TFA
Sbjct:    1 MPKFIVNTNISKDKVPESLPGELTQQLSKAMGKPAQYVAIQVSPDQLMSFGGSADPCAMCFLYSIGKIGEQENKVYSKLLCDLLNKQLKIPSDRIYVSFFEISAGNVGWNNTTFA 115          
BLAST of Macrophage migration inhibitory factor vs. TrEMBL
Match: H3AS62 (Macrophage migration inhibitory factor OS=Latimeria chalumnae OX=7897 GN=MIF PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.708e-27
Identity = 51/115 (44.35%), Postives = 75/115 (65.22%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNVSK  VP  +    +QE +K MGKP  Y+A +I  D +M+FGG ++PCAL +L  +G+    ++ TYSK M +LL +HL IS +R Y++F   +A N+G+ G TFA
Sbjct:    1 MPMFILNTNVSKGDVPAAMLGDITQELSKTMGKPAQYIAVHILPDQMMSFGGKTDPCALCSLYSIGKIGGAQNKTYSKLMCDLLSKHLAISADRIYINFHDMNAANVGWSGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. TrEMBL
Match: R0JLZ8 (Macrophage migration inhibitory factor (Fragment) OS=Anas platyrhynchos OX=8839 GN=Anapl_06109 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.984e-27
Identity = 48/115 (41.74%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP   + TN+SK KVPE      +Q+ +K MGKP  Y+A +I  D +M+FGGS++PCAL +L  +G+   Q++ TY+K + +L+ +HL +S +R Y+++   +A N+G+ G TFA
Sbjct:    1 MPKFIVNTNISKDKVPESFTGELTQQLSKAMGKPAQYIAVHIIPDQMMSFGGSTDPCALCSLYSIGKIGGQQNKTYTKLLCDLISKHLHVSADRVYINYFDMNAANVGWNGSTFA 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Cavefish
Match: mif (macrophage migration inhibitory factor [Source:NCBI gene;Acc:103031017])

HSP 1 Score: 102.449 bits (254), Expect = 1.939e-27
Identity = 47/115 (40.87%), Postives = 70/115 (60.87%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV K  VP  L    ++E AK MGKP +Y+A +I  D +M FGG S+PCAL +L  +G+    ++  YSK +  +L++HLGIS +R Y++F    A N+ +   TF 
Sbjct:    1 MPMFVVNTNVGKDVVPADLMSQLTEELAKAMGKPANYIAVHIIPDQMMMFGGKSDPCALCSLHSIGKIGGSQNKQYSKLLMGILNKHLGISPDRIYINFFDMDAANVAWNNSTFG 115          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Cavefish
Match: ddt (D-dopachrome tautomerase [Source:NCBI gene;Acc:103025217])

HSP 1 Score: 55.0694 bits (131), Expect = 1.688e-9
Identity = 30/112 (26.79%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLG-QASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQG 353
            MP + + TN+  S+  E      +   A  +GKP D +   ++ D  +   GSS PC ++++  +G   +A+K+   S ++   L + LG+S++R  + F    A  +G +G
Sbjct:    1 MPFVELNTNLPASRFSEEFLKKLTSTTASALGKPEDRMIVQVNPDLPLFVFGSSAPCVILSVAGIGVTDTAEKNRDNSAKIFPFLTQELGLSEDRVVIRFSPLEAWQVGKKG 112          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Sea Lamprey
Match: mif (macrophage migration inhibitory factor [Source:ZFIN;Acc:ZDB-GENE-080708-1])

HSP 1 Score: 77.0258 bits (188), Expect = 1.044e-18
Identity = 38/94 (40.43%), Postives = 57/94 (60.64%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNR 302
            MP   I TNVS  +V   +    +   AK +GKP+ YVA ++    +M+FGG+ EPCAL  L+ +G+ S  ++  YS  +SE ++ HLGI K+R
Sbjct:    1 MPTFVIHTNVSADRVSASVHDEVTALVAKALGKPVQYVAVHVVPGQLMSFGGTKEPCALAHLSSIGKISPAENKKYSALLSEAMNTHLGIPKDR 94          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Nematostella
Match: EDO37697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF14])

HSP 1 Score: 70.8626 bits (172), Expect = 7.965e-16
Identity = 41/114 (35.96%), Postives = 58/114 (50.88%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTF 362
            MP+L I TNV  + VP+      +   A L+GKP  YV   I     + FGG++EP A+V LT +GQ         SK +S  + + LG+  +R Y+ F       +GY G TF
Sbjct:    1 MPILEIQTNVPAANVPDNFLKESTTLLAGLVGKPESYVLVCIEPGLRLMFGGTTEPAAIVNLTNIGQHDPATTKHRSKVISNHIQKTLGVPADRMYIIFHDKQRFEVGYNGATF 114          
BLAST of Macrophage migration inhibitory factor vs. Ensembl Medaka
Match: mif (macrophage migration inhibitory factor [Source:NCBI gene;Acc:101160246])

HSP 1 Score: 105.916 bits (263), Expect = 7.019e-29
Identity = 50/115 (43.48%), Postives = 72/115 (62.61%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFA 365
            MP+  + TNV+KS VP  L    ++E AK MGKP  Y+A  I+ D +M FGG  +PCAL +L  +G+ S   +  YSK +  LL++HLGI ++R Y++FV   A N+G+   TF 
Sbjct:    1 MPMFVVNTNVAKSDVPAALLSEATEELAKAMGKPAQYIAVLINPDQMMMFGGKGDPCALCSLHSIGKISGAHNKQYSKLLCGLLNKHLGICQDRIYVNFVDMDAANVGWNNTTFG 115          
BLAST of Macrophage migration inhibitory factor vs. Planmine SMEST
Match: SMESG000075635.1 (SMESG000075635.1)

HSP 1 Score: 242.276 bits (617), Expect = 1.501e-82
Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFAS 368
            MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFAS
Sbjct:    1 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFAS 116          
BLAST of Macrophage migration inhibitory factor vs. Planmine SMEST
Match: SMESG000075633.1 (SMESG000075633.1)

HSP 1 Score: 141.354 bits (355), Expect = 9.474e-43
Identity = 69/116 (59.48%), Postives = 85/116 (73.28%), Query Frame = 3
Query:   21 MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAFGGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFVAASAENIGYQGHTFAS 368
            MPLL+I TNV+KSK+P  LP I S+EF KLM KP   V C I+ D IM+ GGS + CA+V L ++G  +A+KHA YSKRMSE+L E+LGI  NRYY+HF+  SAENIG  G T AS
Sbjct:    1 MPLLSIITNVAKSKIPGNLPSIISEEFQKLMNKPT--VFCQITPDCIMSLGGSGDLCAMVNLVYIGDGNAEKHAIYSKRMSEMLKEYLGIPINRYYIHFLPTSAENIGCNGSTKAS 114          
The following BLAST results are available for this feature:
BLAST of Macrophage migration inhibitory factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIF2.419e-2740.87macrophage migration inhibitory factor [Source:HGN... [more]
MIF2.419e-2740.87macrophage migration inhibitory factor [Source:HGN... [more]
DDT7.174e-1330.36D-dopachrome tautomerase [Source:HGNC Symbol;Acc:H... [more]
DDT7.174e-1330.36D-dopachrome tautomerase [Source:HGNC Symbol;Acc:H... [more]
DDT7.174e-1330.36D-dopachrome tautomerase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mif-24.081e-1325.86MIF-like protein mif-2 [Source:UniProtKB/Swiss-Pr... [more]
mif-21.048e-1225.22MIF-like protein mif-2 [Source:UniProtKB/Swiss-Pr... [more]
mif-14.547e-1232.50MIF (Macrophage migration Inhibitory Factor) relat... [more]
mif-21.820e-623.53MIF-like protein mif-2 [Source:UniProtKB/Swiss-Pr... [more]
mif-31.865e-623.21MIF-like protein mif-3 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mif1.824e-2841.74macrophage migration inhibitory factor [Source:ZFI... [more]
mif1.824e-2841.74macrophage migration inhibitory factor [Source:ZFI... [more]
ddt2.166e-1433.04D-dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE... [more]
ddt2.166e-1433.04D-dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cd2ap2.731e-2334.78CD2-associated protein [Source:Xenbase;Acc:XB-GENE... [more]
ddt3.393e-1025.89D-dopachrome tautomerase [Source:NCBI gene;Acc:550... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mif2.089e-2537.39macrophage migration inhibitory factor (glycosylat... [more]
Ddt5.104e-1128.57D-dopachrome tautomerase [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1ZZU7|MIF_SHEEP1.218e-2842.61Macrophage migration inhibitory factor OS=Ovis ari... [more]
sp|P80177|MIF_BOVIN1.218e-2842.61Macrophage migration inhibitory factor OS=Bos taur... [more]
sp|Q02960|MIF_CHICK1.542e-2840.87Macrophage migration inhibitory factor OS=Gallus g... [more]
sp|P80928|MIF_PIG3.000e-2841.74Macrophage migration inhibitory factor OS=Sus scro... [more]
sp|O55052|MIF_MERUN2.592e-2741.74Macrophage migration inhibitory factor OS=Meriones... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A402EDW55.881e-2846.09Uncharacterized protein OS=Paroedura picta OX=1436... [more]
A0A5C6MLV27.948e-2845.22Macrophage migration inhibitory factor OS=Takifugu... [more]
A0A2I0TUC68.387e-2844.35Macrophage migration inhibitory factor-like OS=Lim... [more]
H3AS622.708e-2744.35Macrophage migration inhibitory factor OS=Latimeri... [more]
R0JLZ82.984e-2741.74Macrophage migration inhibitory factor (Fragment) ... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mif1.939e-2740.87macrophage migration inhibitory factor [Source:NCB... [more]
ddt1.688e-926.79D-dopachrome tautomerase [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mif1.044e-1840.43macrophage migration inhibitory factor [Source:ZFI... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO376977.965e-1635.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mif7.019e-2943.48macrophage migration inhibitory factor [Source:NCB... [more]
back to top
BLAST of Macrophage migration inhibitory factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075635.11.501e-82100.00SMESG000075635.1[more]
SMESG000075633.19.474e-4359.48SMESG000075633.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002076 ID=SMED30002076|Name=Macrophage migration inhibitory factor|organism=Schmidtea mediterranea sexual|type=transcript|length=727bp
ATATAAATCTTATATGAAAAATGCCATTATTAAATATAACAACAAACGTT
TCTAAATCTAAAGTTCCAGAAGGATTACCAATTATTTTTTCTCAAGAATT
TGCTAAGTTAATGGGTAAACCAATCGATTATGTTGCGTGTAATATTTCCA
CTGATAACATAATGGCTTTTGGTGGCTCTAGTGAACCATGTGCTCTCGTA
ACTCTTACATTTTTAGGACAAGCAAGCGCACAGAAACATGCGACTTATTC
TAAACGAATGAGTGAATTATTGCATGAGCATCTTGGAATTTCAAAAAATA
GGTATTATTTACATTTTGTAGCGGCAAGTGCTGAAAATATTGGTTATCAA
GGGCATACTTTTGCATCTTAACCATTTACTTGAATTTTATAAACTTTAAT
ATATTCCAAATTTTGGTCCATCAAATTAAAATAGCACAATTCGAGTAGAT
GGTGATTGCGAAATAATAGTCTTAGTGTTGTGCTATTTTTTGTATCGTGT
TATTTTTGATAATATGATACAATTTAGAAATATTTACATTTTTTGGCTAA
ATTTCTAATCATTGGAGTTTTGTTTAATCCTGTTTGATTTGTTATTTATT
ATCAATGTGTATTTCACTTTTATCGTGTTCTACATTTATAGTGCATTATT
ATTAAATCGTGATTGTATTTAAATTTGATAATTGTGACGTAGATTAAAAT
GTAATTCTATTAAAAATAATTTCAAGG
back to top

protein sequence of SMED30002076-orf-1

>SMED30002076-orf-1 ID=SMED30002076-orf-1|Name=SMED30002076-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MPLLNITTNVSKSKVPEGLPIIFSQEFAKLMGKPIDYVACNISTDNIMAF
GGSSEPCALVTLTFLGQASAQKHATYSKRMSELLHEHLGISKNRYYLHFV
AASAENIGYQGHTFAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0002376immune system process
GO:0006954inflammatory response
GO:0045087innate immune response
Vocabulary: INTERPRO
TermDefinition
IPR001398Macrophage_inhib_fac
IPR014347Tautomerase/MIF_sf
Vocabulary: molecular function
TermDefinition
GO:0004167dopachrome isomerase activity
GO:0005125cytokine activity
GO:0016853isomerase activity
GO:0042289MHC class II protein binding
GO:0050178phenylpyruvate tautomerase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005737cytoplasm