Intermediate filament protein

Overview
NameIntermediate filament protein
Smed IDSMED30002072
Length (bp)2324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intermediate filament protein (SMED30002072) t-SNE clustered cells

Violin plots show distribution of expression levels for Intermediate filament protein (SMED30002072) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intermediate filament protein (SMED30002072) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intermediate filament protein (SMED30002072) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002072

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30002072SMESG000030599.1 dd_Smed_v4_950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002072SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002072SMESG000030598.1 dd_Smed_v6_503_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30002072SMESG000030599.1 OX_Smed_1.0.22725ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002072SMESG000030598.1 dd_Smed_v6_503_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002072SMESG000030599.1 dd_Smed_v4_950_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002072SMESG000030599.1 dd_Smed_v4_950_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30002072SMESG000030599.1 dd_Smed_v4_950_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30002072SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002072SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002072SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intermediate filament protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 135.961 bits (341), Expect = 9.076e-33
Identity = 151/580 (26.03%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  598 RGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEI-----------GDL---QKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELA------TVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2256
            R  + A  T L+  +  R QEK+DLQELN+R A YI++ R LE +N  L   I E +    ++ S +K  YE E+   R  L+   K RA L+++++ +  E            GDL   Q RL  LE +     A +     E  T EGE+ +L              + + + L   + + ++  + E L  +  E+ LQ+++E ++F+K I++ E++E         V   N  +     ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDL--------------RGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE---FESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 136.732 bits (343), Expect = 9.381e-33
Identity = 151/580 (26.03%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  598 RGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEI-----------GDL---QKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELA------TVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2256
            R  + A  T L+  +  R QEK+DLQELN+R A YI++ R LE +N  L   I E +    ++ S +K  YE E+   R  L+   K RA L+++++ +  E            GDL   Q RL  LE +     A +     E  T EGE+ +L              + + + L   + + ++  + E L  +  E+ LQ+++E ++F+K I++ E++E         V   N  +     ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDL--------------RGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE---FESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 135.961 bits (341), Expect = 1.247e-32
Identity = 151/580 (26.03%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  598 RGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEI-----------GDL---QKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELA------TVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2256
            R  + A  T L+  +  R QEK+DLQELN+R A YI++ R LE +N  L   I E +    ++ S +K  YE E+   R  L+   K RA L+++++ +  E            GDL   Q RL  LE +     A +     E  T EGE+ +L              + + + L   + + ++  + E L  +  E+ LQ+++E ++F+K I++ E++E         V   N  +     ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDL--------------RGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE---FESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 135.191 bits (339), Expect = 2.658e-32
Identity = 149/576 (25.87%), Postives = 263/576 (45.66%), Query Frame = 1
Query:  598 RGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEI-----------GDL---QKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELA------TVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEG 2244
            R  + A  T L+  +  R QEK+DLQELN+R A YI++ R LE +N  L   I E +    ++ S +K  YE E+   R  L+   K RA L+++++ +  E            GDL   Q RL  LE +     A +     E  T EGE+ +L              + + + L   + + ++  + E L  +  E+ LQ+++E ++F+K I++ E++E         V   N  +     ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDL--------------RGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE---FESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTG 535          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 131.724 bits (330), Expect = 3.605e-32
Identity = 121/412 (29.37%), Postives = 213/412 (51.70%), Query Frame = 1
Query:  547 YSMQSGNQQSGSVMPLIR--GDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1731
            Y+ +S   +  S +P +R   DSV  +L   +N+  K  R  EK +LQELN+RFA+YI+K RFLE+QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +++    +A +E++ ++L  +I  L+++L                        + EM++ +  ++T                  ++  RQ+ +  +LA + LE  ++SL+E + F K++H  E++EL     +   + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   61 YATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQREEAENT------------------LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 229.95 bits (585), Expect = 4.471e-66
Identity = 171/556 (30.76%), Postives = 288/556 (51.80%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ +LN+R ASYIEK RFLE QN++L  +++ L+    +DT  ++ +YE E+   + L++E+ K R  +E Q+  ++ E+ +++++L        Q RA ID     L   E E+  LKR       +  + K E   L  E+++ R + ++E L  I  ++ +Q+L E ++F +++H  E+KEL T+A ++ T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 229.95 bits (585), Expect = 4.471e-66
Identity = 171/556 (30.76%), Postives = 288/556 (51.80%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ +LN+R ASYIEK RFLE QN++L  +++ L+    +DT  ++ +YE E+   + L++E+ K R  +E Q+  ++ E+ +++++L        Q RA ID     L   E E+  LKR       +  + K E   L  E+++ R + ++E L  I  ++ +Q+L E ++F +++H  E+KEL T+A ++ T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 229.95 bits (585), Expect = 4.471e-66
Identity = 171/556 (30.76%), Postives = 288/556 (51.80%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ +LN+R ASYIEK RFLE QN++L  +++ L+    +DT  ++ +YE E+   + L++E+ K R  +E Q+  ++ E+ +++++L        Q RA ID     L   E E+  LKR       +  + K E   L  E+++ R + ++E L  I  ++ +Q+L E ++F +++H  E+KEL T+A ++ T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 229.95 bits (585), Expect = 4.897e-66
Identity = 171/556 (30.76%), Postives = 288/556 (51.80%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ +LN+R ASYIEK RFLE QN++L  +++ L+    +DT  ++ +YE E+   + L++E+ K R  +E Q+  ++ E+ +++++L        Q RA ID     L   E E+  LKR       +  + K E   L  E+++ R + ++E L  I  ++ +Q+L E ++F +++H  E+KEL T+A ++ T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 230.335 bits (586), Expect = 6.657e-66
Identity = 171/556 (30.76%), Postives = 288/556 (51.80%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ +LN+R ASYIEK RFLE QN++L  +++ L+    +DT  ++ +YE E+   + L++E+ K R  +E Q+  ++ E+ +++++L        Q RA ID     L   E E+  LKR       +  + K E   L  E+++ R + ++E L  I  ++ +Q+L E ++F +++H  E+KEL T+A ++ T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   73 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 590          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0087512)

HSP 1 Score: 134.806 bits (338), Expect = 1.296e-32
Identity = 154/578 (26.64%), Postives = 259/578 (44.81%), Query Frame = 1
Query:  595 IRGDSVALQTGLNS----IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELET--------FEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELAT---VAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVA-LTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2280
            + G S + + G  S     +  R QEK++LQ LN+R A YI++ R LE +N +L  E+   +    ++TS +K +YE E+   R LL+E+ K +A LEI +  L  E  DL+ RL    D  T+     +   R  E         +   + + K+F+D     A +   E   LR ++  LR+  E E LA + LE+  QSLRE + F+ Q+H  E+ E  +   +            +++++ ++L++++ +YE ++   ++E+E  Y  ++Q ++ +  R    +    EE   ++++I  + +++ +LE  NA     +  +  N  +T+R    Q +   E      ++     L E Q L+D K+ L+LEIAAY KLL  EE R+N    G  T    +S   S     A    G     G    + G    S +         +E  T    S         KG++ I E D+ G  I L N GT+  +L G  + R+    E    F+   KV   A   I     G        + +    W V N++ + L +++  E  A Y  V A
Sbjct:   21 VGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRL----DKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFED----QAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELE-NLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYS----VNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNL-VMKKKWPVANSMRSVLANAD-KEDVASYDRVRA 583          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 131.724 bits (330), Expect = 1.581e-31
Identity = 140/571 (24.52%), Postives = 264/571 (46.23%), Query Frame = 1
Query:  622 TGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRS---------IDATKEK---------DETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKE---LATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2244
            + L+  +  R  EK +LQ LN+R A+YI++ R LE +N +L  E++  +    ++T+ +K I+E E+ + R LL+++ + RA  EI +  L  E  +L+ +L              DK+ +E  T EG +    R  ++R+          +A ++K          E   LR + ++ R+N E+E L+ + LE+ +QSLRE + F+ QIH+ E+ E   +    Y          + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKL--------------DKKTKECTTAEGNV----RMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 131.724 bits (330), Expect = 1.581e-31
Identity = 140/571 (24.52%), Postives = 264/571 (46.23%), Query Frame = 1
Query:  622 TGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRS---------IDATKEK---------DETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKE---LATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2244
            + L+  +  R  EK +LQ LN+R A+YI++ R LE +N +L  E++  +    ++T+ +K I+E E+ + R LL+++ + RA  EI +  L  E  +L+ +L              DK+ +E  T EG +    R  ++R+          +A ++K          E   LR + ++ R+N E+E L+ + LE+ +QSLRE + F+ QIH+ E+ E   +    Y          + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKL--------------DKKTKECTTAEGNV----RMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 131.724 bits (330), Expect = 1.581e-31
Identity = 140/571 (24.52%), Postives = 264/571 (46.23%), Query Frame = 1
Query:  622 TGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRS---------IDATKEK---------DETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKE---LATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2244
            + L+  +  R  EK +LQ LN+R A+YI++ R LE +N +L  E++  +    ++T+ +K I+E E+ + R LL+++ + RA  EI +  L  E  +L+ +L              DK+ +E  T EG +    R  ++R+          +A ++K          E   LR + ++ R+N E+E L+ + LE+ +QSLRE + F+ QIH+ E+ E   +    Y          + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKL--------------DKKTKECTTAEGNV----RMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0079100)

HSP 1 Score: 131.724 bits (330), Expect = 1.581e-31
Identity = 140/571 (24.52%), Postives = 264/571 (46.23%), Query Frame = 1
Query:  622 TGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRS---------IDATKEK---------DETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKE---LATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2244
            + L+  +  R  EK +LQ LN+R A+YI++ R LE +N +L  E++  +    ++T+ +K I+E E+ + R LL+++ + RA  EI +  L  E  +L+ +L              DK+ +E  T EG +    R  ++R+          +A ++K          E   LR + ++ R+N E+E L+ + LE+ +QSLRE + F+ QIH+ E+ E   +    Y          + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKL--------------DKKTKECTTAEGNV----RMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: viml (vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-1743])

HSP 1 Score: 132.88 bits (333), Expect = 1.140e-32
Identity = 121/412 (29.37%), Postives = 203/412 (49.27%), Query Frame = 1
Query:  547 YSMQSGNQQSGSVMPLIRGDSVA--LQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLN--ESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSF 1767
            Y+ +S   +S + MP +  +++   L   LN+  K  R  EK  +Q LN+RFASYIEK RFLE+QNK L  E+E+L+G   Q +S++ ++YE E+  LR  ++   +EK+RA  E+  ++L  ++  L+++L                        + EM++             +E  E S     +K  RQ+ +  ALA + LE  ++SL++ + F K +H  E+ EL T       +  M   + ++  ALRD++ +YEN  +   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L   N   E  +  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       A L  F SF
Sbjct:   44 YASKSAKVRSSAAMPRLTSETLDFNLSDALNTEFKANRLNEKAQMQSLNDRFASYIEKVRFLEQQNKILSAELEQLRG---QRSSRIADLYEEEMRDLRRQVDLLTTEKTRA--EVMRDNLAEDVERLKEKL------------------------QDEMLQ-------------REDAENS-----MKSFRQDVDNAALARVDLERKVESLQDELAFLKNLHDEELAELQTQIQGQQVQVEMDMAKPDLTAALRDVRLQYENLASKNIQESEDWYKSKFADLTEAANRNNEALRLAKQETNEYRRQVQAITCELDALRGTNESLERQMREMEENFSMESSGFQNTIGRLEEDIGNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI------AAPLPNFSSF 402          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: vim (vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3])

HSP 1 Score: 124.79 bits (312), Expect = 6.681e-30
Identity = 110/409 (26.89%), Postives = 206/409 (50.37%), Query Frame = 1
Query:  529 NAASLSYSMQSGNQQSGSVMPLIRGDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1731
            +A    Y+ +S   +SG+ +P +  D++   L   +N+  K  R  EK ++Q LN+RFASYI+K RFLE+QNK L+ E+E+L+G   +  S+V ++YE E+ +LR  +++    ++ +E+  ++L  +I  L++RL                        + EM++             +E  E S     ++  RQ+ +  +LA + LE  ++SL+E + F K++H  E+ E+     +   + +M   + ++  AL+D++ +YE   +   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  +  +  ++       +  +  L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   48 SAPPSVYASKSLRVRSGAPLPRLATDTLDFGLAEAINTEFKANRTNEKAEMQHLNDRFASYIDKVRFLEQQNKILIAELEQLRG---KGASRVGDLYEDEMRELRRQVDQLTGEKSKVEVDRDNLGEDIERLKERL------------------------QEEMLQ-------------REDAENS-----LRSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEELAEMQIQMQEQHLQIDMEVAKPDLTAALKDVRQQYETLASRNLQESEDWYKSKFADLSEAAARNNETIRLAKQEANDYRRQLQALTCDLEALKGTNESLERQMRELEDSFSMEASGYQDTIGRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITSPFPNFSS 411          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 118.242 bits (295), Expect = 1.333e-27
Identity = 114/381 (29.92%), Postives = 183/381 (48.03%), Query Frame = 1
Query:  649 RAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQK-RLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGR-----ALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQN-------AEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1752
            R  EK +LQ LN+RFASYIEK RFLE+QN  L  EIE L+G   ++ +++ E+YE E+ +LR  +      R+ +EI+ ++L   + DLQK +L L E+I                                      +K+E  N    +   R + +   LA + LE  ++ L E + F ++IH  E++EL     QN  +E+ V  Q +M +     ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E  + + Q+QS    I  L+  N       +E E  L      Y++T       +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++      ++LS
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEI-------------------------------------HQKEEAEN---NLSAFRADVDAATLARLDLERRIEGLHEEIAFLRKIHEEEIREL-----QNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDT-------IARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISLPVQSFSSLS 421          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 118.242 bits (295), Expect = 1.378e-27
Identity = 114/381 (29.92%), Postives = 183/381 (48.03%), Query Frame = 1
Query:  649 RAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQK-RLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGR-----ALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQN-------AEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1752
            R  EK +LQ LN+RFASYIEK RFLE+QN  L  EIE L+G   ++ +++ E+YE E+ +LR  +      R+ +EI+ ++L   + DLQK +L L E+I                                      +K+E  N    +   R + +   LA + LE  ++ L E + F ++IH  E++EL     QN  +E+ V  Q +M +     ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E  + + Q+QS    I  L+  N       +E E  L      Y++T       +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++      ++LS
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEI-------------------------------------HQKEEAEN---NLSAFRADVDAATLARLDLERRIEGLHEEIAFLRKIHEEEIREL-----QNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDT-------IARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISLPVQSFSSLS 421          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:30646])

HSP 1 Score: 114.39 bits (285), Expect = 1.967e-26
Identity = 99/364 (27.20%), Postives = 179/364 (49.18%), Query Frame = 1
Query:  640 KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDE----IKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1719
            ++ R  EK ++  LN+RFASYIEK RFLE+QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  ++     +A LEI+ ++L  ++G L++RL                                             +DET+ LR E    +   RQ+ ++ AL  + LE  +++L++ + F K++H  E++EL           ++   + ++  AL++I+ ++E       QE E  Y  +  ++  +  R+       K+E +  + QIQ +   +  L   N   E  L  +   +     + +  +  L++++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+
Sbjct:   75 RETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLRG---KEPSRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLASDLGTLKQRL---------------------------------------------QDETA-LRQEAENNLNTFRQDVDEAALNRVQLERKIEALQDEINFLKKVHEEEMRELHEQLMAQQVHVDLDVSKPDLTAALKEIRAQFEAMANSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANDYRRQIQGLTCDLESLRGSNESLERQLREMEERFAIETAAYQDTVARLEDEIQMLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRI 389          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 134.806 bits (338), Expect = 1.882e-32
Identity = 152/589 (25.81%), Postives = 279/589 (47.37%), Query Frame = 1
Query:  574 SGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLE-DIGT------QYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKK-------LRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPT---KENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQ-NA------EYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISL-CAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAA 2259
            + S+    RG S    T L+  +  R QEK++L+ LN+R A YI++ R LE +N +L+ +I E +  T ++ S +K +YE E+   R +L+E+ + RA L+I++     ++ +L K     + D+ T         A   +   EL T  GE          RS++A     E ++LR ++ K        ++  EKE L  +  E+ +QSL+E M+F K I+  E +E      +      + +   + S++ +AL +++ +++ ++   K+ELE +Y  ++  I+ S   ++      +EE +  + +I+++  +++ L+ Q NA      E E  L++ R  Y +   S E ++  +++Q+          LTE Q LLD KL L++EI AY KLLE EE R+  S    + ++                                    +    S+  +  ++R+ T +    +  + +  G+ISI E DL G  + L+N   K +SL    +KR + G E +I +  + K  L AG+ + +  A   +      I +  + ++WG G+N+ T L ++E  E A 
Sbjct:   11 TSSMQSPARGTS----TPLSPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGE---------KRSLEA-----EVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQ-------LTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVT--------------------------------VSRATSSSSSATRTSRSKRKRTGFTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKI-GEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAV 541          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 131.339 bits (329), Expect = 6.927e-32
Identity = 108/371 (29.11%), Postives = 193/371 (52.02%), Query Frame = 1
Query:  640 KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1752
            K  R  EK ++QELN+RFA++I+K RFLE+QNK LV E+E+LKG   + TS++ ++YE E+ +LR  L++   ++  +E+  ++L     DLQ                     R  E  + EM++             KE+ E +     ++  RQ+ +  +LA I LE  ++SL+E + F K++H  E++EL     ++  + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:   99 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKG---KGTSRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNL---ADDLQ---------------------RLREKLQDEMIQ-------------KEEAEGN-----LQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 424          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 130.954 bits (328), Expect = 7.491e-32
Identity = 108/371 (29.11%), Postives = 193/371 (52.02%), Query Frame = 1
Query:  640 KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1752
            K  R  EK ++QELN+RFA++I+K RFLE+QNK LV E+E+LKG   + TS++ ++YE E+ +LR  L++   ++  +E+  ++L     DLQ                     R  E  + EM++             KE+ E +     ++  RQ+ +  +LA I LE  ++SL+E + F K++H  E++EL     ++  + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:   93 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKG---KGTSRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNL---ADDLQ---------------------RLREKLQDEMIQ-------------KEEAEGN-----LQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 418          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 130.954 bits (328), Expect = 8.659e-32
Identity = 108/371 (29.11%), Postives = 193/371 (52.02%), Query Frame = 1
Query:  640 KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1752
            K  R  EK ++QELN+RFA++I+K RFLE+QNK LV E+E+LKG   + TS++ ++YE E+ +LR  L++   ++  +E+  ++L     DLQ                     R  E  + EM++             KE+ E +     ++  RQ+ +  +LA I LE  ++SL+E + F K++H  E++EL     ++  + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:   97 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKG---KGTSRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNL---ADDLQ---------------------RLREKLQDEMIQ-------------KEEAEGN-----LQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 422          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 132.494 bits (332), Expect = 1.338e-31
Identity = 157/599 (26.21%), Postives = 281/599 (46.91%), Query Frame = 1
Query:  562 GNQQSG--SVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLE-DIGT------QYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKK-------LRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPT---KENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQ-NA------EYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGN----ISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISL-CAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAA 2259
            G  +SG  S+    RG S    T L+  +  R QEK++L+ LN+R A YI++ R LE +N +L+ +I E +  T ++ S +K +YE E+   R +L+E+ + RA L+I++     ++ +L K     + D+ T         A   +   EL T  GE          RS++A     E ++LR ++ K        ++  EKE L  +  E+ +QSL+E M+F K I+  E +E      +      + +   + S++ +AL +++ +++ ++   K+ELE +Y  ++  I+ S   ++      +EE +  + +I+++  +++ L+ Q NA      E E  L++ R  Y +   S E ++  +++Q+          LTE Q LLD KL L++EI AY KLLE EE R+  S    + ++                      +       +      R+       G + R  T  Q    +F  + + +    ISI E DL G  + L+N   K +SL    +KR + G E +I +  + K  L AG+ + +  A   +      I +  + ++WG G+N+ T L ++E  E A 
Sbjct:    3 GRSRSGTSSMQSPARGTS----TPLSPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGE---------KRSLEA-----EVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQ-------LTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVT-----------------VSRATSSSSSATRTSRSKRKRVEEEYEEGGGSSRTVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKI-GEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAV 558          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 130.568 bits (327), Expect = 5.922e-32
Identity = 119/407 (29.24%), Postives = 213/407 (52.33%), Query Frame = 1
Query:  544 SYSMQSGNQQSGSVMPLIR--GDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            +Y  +S   +  S +P +R   DSV  +L   +N+  K  R  EK +LQELN+RFA+YI+K RFLE+QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +++    +A +E++ ++L  +I  L+++L                        + EM++             +E+ E++     ++  RQ+ +  +LA + LE  ++SL+E + F K++H  E++EL     +   + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR++  
Sbjct:   60 AYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ-------------REEAEST-----LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 130.954 bits (328), Expect = 8.620e-32
Identity = 119/407 (29.24%), Postives = 213/407 (52.33%), Query Frame = 1
Query:  544 SYSMQSGNQQSGSVMPLIR--GDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            +Y  +S   +  S +P +R   DSV  +L   +N+  K  R  EK +LQELN+RFA+YI+K RFLE+QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +++    +A +E++ ++L  +I  L+++L                        + EM++             +E+ E++     ++  RQ+ +  +LA + LE  ++SL+E + F K++H  E++EL     +   + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR++  
Sbjct:   60 AYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ-------------REEAEST-----LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 120.553 bits (301), Expect = 1.452e-28
Identity = 110/385 (28.57%), Postives = 186/385 (48.31%), Query Frame = 1
Query:  589 PLIRGDSVALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDE----IKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            PL      +L   LN+  K+ RA E+ ++ ELN+RFASYIEK RFLE+QNK L  E+ +L+    ++ +K+ ++Y+ E+ +LR  L++   + A LE++ ++   ++G L+++L                                             +DET NLR E    +   RQ  ++  LA + LE  ++SL E ++F ++I+  EV+EL     Q      M   + ++  ALR+I+T+YE   T   QE E  Y  +  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++E+   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   42 PLPARVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKL---------------------------------------------QDET-NLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 120.168 bits (300), Expect = 1.638e-28
Identity = 110/385 (28.57%), Postives = 186/385 (48.31%), Query Frame = 1
Query:  589 PLIRGDSVALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDE----IKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            PL      +L   LN+  K+ RA E+ ++ ELN+RFASYIEK RFLE+QNK L  E+ +L+    ++ +K+ ++Y+ E+ +LR  L++   + A LE++ ++   ++G L+++L                                             +DET NLR E    +   RQ  ++  LA + LE  ++SL E ++F ++I+  EV+EL     Q      M   + ++  ALR+I+T+YE   T   QE E  Y  +  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++E+   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   42 PLPARVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKL---------------------------------------------QDET-NLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 119.783 bits (299), Expect = 1.538e-27
Identity = 113/399 (28.32%), Postives = 197/399 (49.37%), Query Frame = 1
Query:  598 RGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEI-----------GDL---QKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELA------TVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            R  + A  T L+  +  R QEK+DLQELN+R A YI++ R LE +N  L   I E +    ++ S +K  YE E+   R  L+   K RA L+++++ +  E            GDL   Q RL  LE +     A +     E  T EGE+ +L              + + + L   + + ++  + E L  +  E+ LQ+L+E ++F+K I++ E++E         V   N  +     ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDL--------------RGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE---FESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLS 390          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|Q01240|NF60_DORPE (60 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.835e-76
Identity = 153/369 (41.46%), Postives = 244/369 (66.12%), Query Frame = 1
Query:  622 TGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRAT---IDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1719
            TG+N +K  R +EK+D+++LNERFA+YIEK RFLE QNK+L GE+EELK    ++TS +KE+YE E+ + R L++ + K +  L+++V  L   I  L+++   LE+  T ++     I +Q ++L   EGE+  L+R  ++   +  ++ +  + + DE++K+R +   E + H+  E+  Q+L E +EF+K +HA E+KELA +AY++ T EN  +W++E+ +A+RDIQ EY+ K   ++ ++EA Y L++QE RT  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + E+   L ELQ L+D KL LELEIAAY KLLE EESRV
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRV 449          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|Q01241|NF70_DORPE (70 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.709e-75
Identity = 153/371 (41.24%), Postives = 244/371 (65.77%), Query Frame = 1
Query:  622 TGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRAT---IDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNF 1725
            TG+N +K  R +EK+D+++LNERFA+YIEK RFLE QNK+L GE+EELK    ++TS +KE+YE E+ + R L++ + K +  L+++V  L   I  L+++   LE+  T ++     I +Q ++L   EGE+  L+R  ++   +  ++ +  + + DE++K+R +   E + H+  E+  Q+L E +EF+K +HA E+KELA +AY++ T EN  +W++E+ +A+RDIQ EY+ K   ++ ++EA Y L++QE RT  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + E+   L ELQ L+D KL LELEIAAY KLLE EESRV  
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGM 451          

HSP 2 Score: 54.299 bits (129), Expect = 3.941e-6
Identity = 40/113 (35.40%), Postives = 65/113 (57.52%), Query Frame = 1
Query: 1939 FRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKI-SFTISGKVNLNAGEKISLCAKG-KITGKGRE-IEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2268
            ++RT+KG++SI E D  G  I LE    K E+L G  I R VD  +NK+ ++ I   V L  G  + + +K  +   +G + +  ++ +WG G+NVVT L + +G +KA + Q
Sbjct:  503 YQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVD--DNKVYTYEIPNLV-LKTGTVVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQ 610          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|P90901|IFA1_CAEEL (Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 9.921e-65
Identity = 171/556 (30.76%), Postives = 288/556 (51.80%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ +LN+R ASYIEK RFLE QN++L  +++ L+    +DT  ++ +YE E+   + L++E+ K R  +E Q+  ++ E+ +++++L        Q RA ID     L   E E+  LKR       +  + K E   L  E+++ R + ++E L  I  ++ +Q+L E ++F +++H  E+KEL T+A ++ T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|P90900|IFA4_CAEEL (Intermediate filament protein ifa-4 OS=Caenorhabditis elegans OX=6239 GN=ifa-4 PE=1 SV=3)

HSP 1 Score: 219.55 bits (558), Expect = 5.008e-61
Identity = 174/608 (28.62%), Postives = 300/608 (49.34%), Query Frame = 1
Query:  475 SMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMP-----LIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            S Y+     R  F    ++ A+   ++ SG  ++  +       L  G S       ++I++ R +EKK++ ELN+R ASYIEK RFLE QN+++  ++  L+G    D++ VK +YE E+   + L+ +S+K RA LE Q+  L  E+ + + +L   E      R  +D     L   E E+  LKR            K E   + D +   R   E+E L  I  ++ +Q+L E  +F ++IH +E+ +L  +A ++ T EN  Y+++E+  A+R+I++EY++     + ++E+ Y L++QEI T  +R+ +E  + +EE  R+++ +  MR ++ADLE +N   E  + ++    EE  RS E  L      +   + E  + + ELQ L+D K  L+ EI  Y K+L+ EE+R        A L Q +                               +            + + ETT + S    + R+ KGNI+I E +  G  I+LENI  + E++    ++R + G + +I FT   +  L A + + + A+G+      +  + D   S+G GN+VVTTL + EG ++A+H Q  S
Sbjct:    4 SEYRSSISVRPTFNRTMQSTATYGSTISSGTSRTLKITEIGGSNLTSGMSPFGGHAASAIRESRTREKKEMSELNDRLASYIEKVRFLEAQNRKMEKDLNLLRGKWGHDSTSVKVMYETELRSAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELLKRRISLMEESIGHLKRENHRMIDSLHHARNAVEQETLNRIDYQNQVQTLLEECDFIRRIHDSEIHDLLAMASRDTTVENREYFKNELSSAIREIRSEYDHVSNTTRTDIESWYKLKVQEIHTQNSRNCLEQNYAREEVKRLRTTLGDMRGKMADLEGRNLLLEKQIEDLNYQMEEDMRSYEQSLNDKDTSINKLRDESKILMVELQMLIDTKQTLDAEIVIYRKMLDGEENR--------AGLRQLV-------------------------EQVVKTTSIHQTKEIESLRVLKGETTSHSS----YSRSAKGNIAIQEAEPSGKYIVLENISRRDENIGDWKLRRKIAG-KREIVFTFPREFTLRAQKSVKIFARGQGVHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASHSQRAS 573          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|O02365|IFA2_CAEEL (Intermediate filament protein ifa-2 OS=Caenorhabditis elegans OX=6239 GN=mua-6 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.630e-56
Identity = 166/556 (29.86%), Postives = 281/556 (50.54%), Query Frame = 1
Query:  619 QTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAAHYQEVS 2277
            Q   ++I+  R +EKK++ ELN+R ASYIEK RFL+ QN++L  +++ L+G   + T  VK +YE+EI    +++ ++ K     E ++  L+ ++ +L+K+    +    + R  ID     L   E E+  LKR       +  + K E   L  E++++R   ++E L  I  ++ ++++ E ++F K+   TE+KEL   A ++ T EN  Y+++E+  A+RDI+ EY+  + G + ++E+ Y L++QEI T   R N E  + KEE  R+++Q   +R +++DLE +N   E  + ++    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ E+  Y ++LE      N  G+G   L + +  TS+                                        T R      S R  ++R+ KGN++I ET   G  +ILEN    K E L    +KR +DG + +I FT      L+  + + + A+G+      E+ I   D ++GVG NV T L +++G E+A H Q  S
Sbjct:   58 QNAASTIRDNREREKKEIMELNDRLASYIEKVRFLDAQNRKLDADLKMLQGRFGKSTGSVKVMYEMEITTATNVVKQTGKDHGETEKEIRKLQDQLDELRKKFEEAQRGRAEDRLKIDDLLVTLSNLEAEINLLKRRIALLEEEVARLKKENFRLTSELQRVRIELDQETLLRIDNQNKVKTILEEIDFMKRGFETELKELQAQAARDTTSENREYFKNELANAMRDIRAEYDQIMNGNRNDMESWYQLRVQEINTQSNRQNAENNYQKEEVKRLRNQTSELRQKLSDLESRNLLLEKQIEDLNYQLEDDQRSYEAALNDKDAQIRKLREECQALMVELQMLLDTKQTLDGELKVYRQMLEG-----NSEGNGLRQLVEKVVRTSAINEEADTE--------------------------------TMRVVKGEHSSRTSYQRSAKGNVAIKETSPEGKFVILENTHRAKEEPLGDWKLKRKIDG-KREIVFTFPSDYILHPFQSVKIFARGQGIANPPEVLIFEGDETFGVGANVQTILYNNKGEERATHIQRQS 575          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A267FSC2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010052g3 PE=3 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 1.569e-103
Identity = 226/554 (40.79%), Postives = 330/554 (59.57%), Query Frame = 1
Query:  628 LNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQY---RATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAG--EKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2274
            +N++  GR +EKKD+QELNERFA+YIEK RFLE QNK+L  E+++LK    ++T +VK+ YE E+ QLR LL++SEK +A  E++++SLE ++ +LQ   +LL++   Q+   R TIDK  ++L  ++GE+  L+R   T   + ++++ E   LRDE+ +LR + + E L HI  E++ QSLRE +EF KQIH +E+KELA +AY++ T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G          G  S                  T YQ       RT KGN+SI E    G  I+LEN G K E + G  + R +D     I FT+   V L  G  + I + A+G       ++E  ++SWGVG N+ T+L ++EG E+A H Q+ 
Sbjct:   72 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDRKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQNKQQMSLIKGEMSAK----------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKT 599          
BLAST of Intermediate filament protein vs. TrEMBL
Match: W0GAA8 (Intermediate filament b-like protein OS=Macrostomum lignano OX=282301 GN=if1 PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 3.253e-103
Identity = 226/554 (40.79%), Postives = 330/554 (59.57%), Query Frame = 1
Query:  628 LNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQY---RATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAG--EKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2274
            +N++  GR +EKKD+QELNERFA+YIEK RFLE QNK+L  E+++LK    ++T +VK+ YE E+ QLR LL++SEK +A  E++++SLE ++ +LQ   +LL++   Q+   R TIDK  ++L  ++GE+  L+R   T   + ++++ E   LRDE+ +LR + + E L HI  E++ QSLRE +EF KQIH +E+KELA +AY++ T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G          G  S                  T YQ       RT KGN+SI E    G  I+LEN G K E + G  + R +D     I FT+   V L  G  + I + A+G       ++E  ++SWGVG N+ T+L ++EG E+A H Q+ 
Sbjct:   72 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQNKQQMSLIKGEMSAK----------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKT 599          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A267EDW2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015143g2 PE=3 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 9.333e-94
Identity = 209/554 (37.73%), Postives = 320/554 (57.76%), Query Frame = 1
Query:  628 LNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQY---RATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK--ISLCAKG-KITGKGR-EIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2268
            ++S+  GR +EK+D+QELNER A YIEK RFLE QNK+L  E+++LK    ++T K+K  YE E+ QLR LL ++EK +A  E++++SLE ++ +LQ   +LL++    +   R TIDK  +++  ++GE+  L+R       +  +++ ET  LRD++ +LR + + E L HI  E+  QSLRE ++F KQ+H +E+KELA +AY++ T EN  +W++EM +AL DIQ EYE KL  ++ E+EA Y +++QE RT+ TRDN+E  H +EE+ RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E+    L+  L  +   L   + ELQ L+DAKL LELEI AY KLLE EE  V  +     T++Q  S    +          +  A        G                         S +  ++RT KGN+SI E    G  ++LEN G K E + G  + R +D +   + +T+     L+ G++  + + A+G +  G G  ++E  + SWGVG N+VT+L + EG E+A H Q
Sbjct:   92 VSSMLTGREKEKRDMQELNERLAGYIEKVRFLEAQNKKLSNELQQLKDRWGKETEKIKLTYETELQQLRKLLEDAEKHKAEAEVRISSLEDQLNELQ---VLLDEANRMHQVDRETIDKLNQQMADYDGEISLLRRRVAAFDEERARDQRETKRLRDDVSRLRTDLDTETLNHINAENAAQSLREELDFLKQVHESELKELAILAYRDTTNENREFWRNEMSQALHDIQREYEVKLDSMRSEIEAQYSVKVQEARTTNTRDNLELAHLREESKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMTKSQLRADLASSNATLEEYMRELQVLMDAKLSLELEIHAYRKLLEGEE--VRINQRAQETITQRSSTVEKTSVSVEQQQLPSPAAAQQMNLVKGEM-----------------------SAKTTYQRTAKGNVSIQECSPDGKFVLLENTGKKKEDIGGWKLSRNIDNNRQTVRYTVPMGTVLDDGQRKTVKIWARGHRPLGSGSGDLEAGETSWGVGANIVTSLYNMEGEERATHNQ 617          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A267GC02 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015143g3 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 7.601e-93
Identity = 208/554 (37.55%), Postives = 319/554 (57.58%), Query Frame = 1
Query:  628 LNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQY---RATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK--ISLCAKG-KITGKGR-EIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2268
            ++S+  GR +EK+D+QELNER A YIEK RFLE QNK+L  E+++LK    ++T K+K  YE E+ QLR LL ++EK +A  E++++SLE ++ +LQ   +LL++    +   R TIDK  +++  ++GE+  L+R       +  +++ E   LRD++ +LR + + E L HI  E+  QSLRE ++F KQ+H +E+KELA +AY++ T EN  +W++EM +AL DIQ EYE KL  ++ E+EA Y +++QE RT+ TRDN+E  H +EE+ RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E+    L+  L  +   L   + ELQ L+DAKL LELEI AY KLLE EE  V  +     T++Q  S    +          +  A        G                         S +  ++RT KGN+SI E    G  ++LEN G K E + G  + R +D +   + +T+     L+ G++  + + A+G +  G G  ++E  + SWGVG N+VT+L + EG E+A H Q
Sbjct:   92 VSSMLTGREKEKRDMQELNERLAGYIEKVRFLEAQNKKLSNELQQLKDRWGKETEKIKLTYETELQQLRKLLEDAEKHKAEAEVRISSLEDQLNELQ---VLLDEANRLHQVDRETIDKLNQQMADYDGEISLLRRRVAAFDEERARDQREIKRLRDDVSRLRTDLDTETLNHINAENAAQSLREELDFLKQVHESELKELAILAYRDTTNENREFWRNEMSQALHDIQREYEVKLDSMRSEIEAQYSVKVQEARTTNTRDNLELAHLREESKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMTKSQLRADLASSNATLEEYMRELQVLMDAKLSLELEIHAYRKLLEGEE--VRINQRAQETITQRSSTVEKTSVSVEQQQLPSPAAAQQMNLVKGEM-----------------------SAKTTYQRTAKGNVSIQECSPDGKFVLLENTGKKKEDIGGWKLSRNIDNNRQTVRYTVPMGTVLDDGQRKTVKIWARGHRPLGSGSGDLEAGEPSWGVGANIVTSLYNMEGEERATHNQ 617          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A1I8JG08 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.441e-89
Identity = 208/504 (41.27%), Postives = 299/504 (59.33%), Query Frame = 1
Query:  628 LNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQY---RATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKV--ESLEGMTIKRVVDGSENKISFTISGKVNLNAG 2124
            +N++  GR +EKKD+QELNERFA+YIEK RFLE QNK+L  E+++LK    ++T +VK+ YE E+ QLR LL++SEK +A  E++++SLE ++ +LQ   +LL++   Q+   R TIDK  ++L  ++GE+  L+R   T   + ++++ E   LRDE+ +LR + + E L HI  E++ QSLRE +EF KQIH +E+KELA +AY++ T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G      G  S                      T YQ       RT KGN+SI E    G  I+LEN G K   E + G  + R +D     I FT+   V L  G
Sbjct:   98 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQMSLIKGEMSAK--------------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKASKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDG 571          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: vim (vimentin [Source:NCBI gene;Acc:103044141])

HSP 1 Score: 125.561 bits (314), Expect = 3.028e-30
Identity = 112/381 (29.40%), Postives = 192/381 (50.39%), Query Frame = 1
Query:  589 PLIRGDSVALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            P  R D  AL   +N+  K  R  EK ++Q LN+RFASYIEK RFLE+QNK L  E+E L+G   + TS+V ++YE E+ +LR              +QV+ L   IGD               +A ++ +R  L    GE  +++R ++    +  + +D  +NL       RQ+ +  +LA + LE  L+SL+E + F K++H  E+ EL    +    + +M   + ++  ALRD++++YE   T   QE E  Y  +  ++  +  R +      K++ +  + Q+ ++   +  L+  N   E  +  +  ++       +  ++ L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+ F 
Sbjct:   65 PSPRLD-FALSDAINTEFKANRTNEKAEMQHLNDRFASYIEKVRFLEQQNKSLSAELELLRG---KGTSRVGDLYEEEMRELR--------------LQVDQL---IGD---------------KARVEVERDNL----GE--DIQRLREKLQEEIIQREDAENNLH----GFRQDVDNASLARLDLERKLESLQEEIIFLKKLHDEEIAELQAQIHDQHVQIDMDVAKPDLTAALRDVRSQYETLATKNIQEAEDWYKSKFTDLSDAAARSSEAIRLAKQDANEYRRQVHALTCEVDALKGTNESLERQMRELEDSFGMESSGYQDTIVRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRLCFP 399          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: vim (vimentin [Source:NCBI gene;Acc:103044141])

HSP 1 Score: 124.02 bits (310), Expect = 1.060e-29
Identity = 111/378 (29.37%), Postives = 191/378 (50.53%), Query Frame = 1
Query:  589 PLIRGDSVALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1719
            P  R D  AL   +N+  K  R  EK ++Q LN+RFASYIEK RFLE+QNK L  E+E L+G   + TS+V ++YE E+ +LR              +QV+ L   IGD               +A ++ +R  L    GE  +++R ++    +  + +D  +NL       RQ+ +  +LA + LE  L+SL+E + F K++H  E+ EL    +    + +M   + ++  ALRD++++YE   T   QE E  Y  +  ++  +  R +      K++ +  + Q+ ++   +  L+  N   E  +  +  ++       +  ++ L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+
Sbjct:   65 PSPRLD-FALSDAINTEFKANRTNEKAEMQHLNDRFASYIEKVRFLEQQNKSLSAELELLRG---KGTSRVGDLYEEEMRELR--------------LQVDQL---IGD---------------KARVEVERDNL----GE--DIQRLREKLQEEIIQREDAENNLH----GFRQDVDNASLARLDLERKLESLQEEIIFLKKLHDEEIAELQAQIHDQHVQIDMDVAKPDLTAALRDVRSQYETLATKNIQEAEDWYKSKFTDLSDAAARSSEAIRLAKQDANEYRRQVHALTCEVDALKGTNESLERQMRELEDSFGMESSGYQDTIVRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI 396          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: lmnb2 (lamin B2 [Source:NCBI gene;Acc:103025469])

HSP 1 Score: 123.635 bits (309), Expect = 5.513e-29
Identity = 145/579 (25.04%), Postives = 259/579 (44.73%), Query Frame = 1
Query:  610 VALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQV-----------NSLEYEIGDL---QKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELAT------VAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNA-------EYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEI---DDASWGVGNNVVTTLCDSEGAEKA 2256
             A  T L+  +  R QEK++L+ LN+R A YI++ R LE +N +L+ ++ E +  T ++ S +K +YE E+   R +++E  K RA L+I +            S + + GDL   Q R+  LE    Q  A ++    E      E+ ++K               + +   D     ++  E E L  + LE+  QSL E ++F K +   EV+E         V   +  K++   ++ ++ +AL+D++ ++E ++   K+ELE ++  ++   + S   ++   +  +EE      +I+S+  +++ L+ Q A       E E  LN+ R  Y          +   + +++  ++ + + L E Q LLD KL L++EI AY KLLE EE R+  S   ++ ++   S                              S S     S      E E     S R+  +    G +++ E DL G ++ L+N   K +SL    +KR + G  ++I +  S K  L AG+ +++ A           ++     +SWG G+  VT L +S G E A
Sbjct:   13 AASSTPLSPTRISRLQEKEELRHLNDRLAVYIDRVRALELENDRLMVKVSEKEEVTTREVSGIKSLYEAELADARRVVDEIAKERARLQIDLGKSNSELEEITKSFKKKDGDLVLAQARIKELESQYNQSEAALNTALSENAALSAELADVKT--------------QLAKAEDAHAVAKKQLEAETLMRVDLENRCQSLTEELQFRKSMFEEEVRETRRRREKRMVEVDSGAKQD---YEFKLSQALQDLRKQHEEQVGFYKEELEQTFQAKLDNAKVSSDLNDKAVSTAREELQEAHVRIESLSYQLSALQKQAAAAEDRVRELEDILNSERDKY-------RRMMDGKEREMSEMRERMQMQLNEYQELLDVKLALDMEINAYRKLLEGEEDRLKLSPSPSSRVTVSRSTA---------------------------SSSSSRTTRSTKRKRVEEEPVTAPSVRISQQAEATGGVTVEEIDLEGKSVTLKNNADKDQSLGSWRLKRQI-GEADEIVYKFSPKFVLKAGQTVTVWAADAGVAHSPPSDLLWKSQSSWGSGDETVTVLVNSNGEEVA 539          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:103035120])

HSP 1 Score: 117.087 bits (292), Expect = 1.484e-27
Identity = 105/380 (27.63%), Postives = 186/380 (48.95%), Query Frame = 1
Query:  640 KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDE----IKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSF 1767
            ++ R  EK ++  LN+RFASYIEK RFLE+QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  ++     +A LEI+ ++L  ++  L++RL                                             +DET+ LR E    +   RQ+ ++ A+  + LE  +++L++ + F K++H  E+KEL           ++   + ++  ALRDI+ +YE   +   QE E  Y  +  ++  +  R+       K+E +  + QIQ++   +  L   N   E  L  +   +     + +  ++ L++++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+       A L QF  +
Sbjct:   76 RETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLRG---KEPSRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLAADLVTLKQRL---------------------------------------------QDETA-LRQEADNNLNGFRQDVDEAAMNRVQLERKIEALQDEINFLKKVHEEEMKELQEQLMAQQVHVDLDVSKPDLTAALRDIRVQYEAMASSNMQETEEWYRSKFADLTDAANRNAESLRQAKQEANDYRRQIQALTCDLESLRGTNESLERQLREMEERFSIETAAYQDTVVRLEDEIQTLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITVPVQSFANL-QFRDY 405          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:103035120])

HSP 1 Score: 117.472 bits (293), Expect = 1.589e-27
Identity = 105/377 (27.85%), Postives = 185/377 (49.07%), Query Frame = 1
Query:  640 KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDE----IKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQF 1758
            ++ R  EK ++  LN+RFASYIEK RFLE+QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  ++     +A LEI+ ++L  ++  L++RL                                             +DET+ LR E    +   RQ+ ++ A+  + LE  +++L++ + F K++H  E+KEL           ++   + ++  ALRDI+ +YE   +   QE E  Y  +  ++  +  R+       K+E +  + QIQ++   +  L   N   E  L  +   +     + +  ++ L++++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+       A L QF
Sbjct:   76 RETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLRG---KEPSRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLAADLVTLKQRL---------------------------------------------QDETA-LRQEADNNLNGFRQDVDEAAMNRVQLERKIEALQDEINFLKKVHEEEMKELQEQLMAQQVHVDLDVSKPDLTAALRDIRVQYEAMASSNMQETEEWYRSKFADLTDAANRNAESLRQAKQEANDYRRQIQALTCDLESLRGTNESLERQLREMEERFSIETAAYQDTVVRLEDEIQTLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITVPVQSFANL-QF 402          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 108.612 bits (270), Expect = 7.283e-25
Identity = 138/585 (23.59%), Postives = 266/585 (45.47%), Query Frame = 1
Query:  610 VALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTI----------QDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKL-------RQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVY---------WQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXV-------ALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEI---DDASWGVGNNVVTTLCDSEGAEKA 2256
            + +++ L+  +  R QEK+ L ELN+R A+YIE+ R LE    +L+  +   +              + T  ++  Y+ E+ ++R  L+++  ++A LEIQ+   + E  + + R        ++Y    +     +   E ++   +    T S D    + E  +LR+++ +L       +Q  E+E LA + LE+ + +L+E +EF K+IH  E+ E          +E  V          ++ ++  AL +++ ++E ++   +QEL+       Q +R +K   ++ T   +  +  I+  ++   SR+  L  Q +  +H+L  ++    E + +L  +    + +L  + +EL          L E + LLD KL L++EIAAY KLLE EESR+N S +     S   + TS+S +              G   S                  ++R  + + S          G+I I E D+ G ++ + N   K + L G  +KR ++  + +I++  S +  L AG+ +++ A           ++     +SWG G+++ T+L +S+G E A
Sbjct:    3 IEMKSLLSPTRVTRLQEKESLVELNDRLAAYIERVRSLEVDKARLLARVSMWEEEEEEQRQKSERQREATGGLRAAYDAELAEVRRALDDALGAKAALEIQLRLAQVERDEGRSRC-------SKYEQEWNVALGRIRDMEVQLCAKEASLSTASGDKEYLETEVDDLRNQVNQLEGVLVSSKQQLEEETLARVDLENRMLTLQEELEFTKRIHEQEIHE------SRSKRETHVLEIDGGQQQAFEYKLSEALTELRQQHEEQVQLYRQELD-------QTMR-AKLEKSILTPEKQSLDISIREDLREATSRVGTLSSQLSAAQHDLALLQGRVRELEETLSHERDQSKRRLDESDRELAELREVMDEQLIEYEQLLDIKLALDMEIAAYRKLLEGEESRLNLSPEKGVQSSVVQTSTSASHSIRTMPGKRKRVQLEGFVDSMAQ---------------SQRSVSQHAS--------ASGSIGIKEVDMEGKSVTMVNNSEKDQPLGGWVLKRQIE-DQAEIAYKFSSRYVLKAGQTVTIWAANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVA 542          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 91.2781 bits (225), Expect = 7.120e-20
Identity = 115/399 (28.82%), Postives = 185/399 (46.37%), Query Frame = 1
Query:  583 VMPLIRGDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNE--SEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELAT--------VAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIR-------ANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1719
             MP   G SV  +L   LN+  +  R  EK +LQELN+RFA+YI+K R+LE+QNK L+ E+  LKG   ++ ++V  +YE E+ +LR+ +     EK+R              GD+++  LL                           EL+R +     +    ++   NL    +  RQ+ +   LA + LE  ++SL+E + F K+IH  E++E+          V Y   TK ++         ALRDI+ EYE        E E  Y  +  ++  +  R+N      K+E    + Q+Q+ +  I  L+  N   E  +  +        ANY++T       +  L++ +   + E+   L + Q LL  K+ L++EIA Y KLLE EE+RV
Sbjct:   63 AMP---GQSVDFSLAEALNADYRTTRTNEKVELQELNDRFANYIDKVRYLEQQNKALLAELALLKG---REPTRVGPLYEQELRELRAQVERLTGEKAR--------------GDVERANLL--------------------------DELQRLQQRLQEETAAREEAEKNL----QAFRQDVDDATLARVDLERKVESLQEEIAFLKKIHDEELREVQVQVQEQTVHVEYDVGTKPDLTA-------ALRDIRAEYEGIAAKNVAEAEEWYKSKFLDLSEAAVRNNEALRAAKQELMDYRRQVQAQQCDIDSLKGANESLERQIREMEERFSVESANYQDT-------ITRLEDDIGNLKDEMARHLRDYQELLHVKMALDIEIATYRKLLEGEETRV 397          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010102.1 (pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 gene:ENSPMAG00000009106.1 transcript:ENSPMAT00000010102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 3.022e-19
Identity = 95/362 (26.24%), Postives = 166/362 (45.86%), Query Frame = 1
Query:  634 SIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKEL-ATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESR 1716
            S+   R QEK+ ++ LN+RFA++I+K RFLE+QNK L  +   L+  T   +S + E++E  IN LR               Q++ L ++ G L   L  ++ +   +RA  + +       EGE V +K+                            + +   L+ + LE  LQ L + + F + I   E+ EL A + + N   E       ++   + D++ +YE      + E +A Y  + Q + +   R++ E    + E + +  Q+Q  R+ +  L+ Q A+ E  +       E   R  +  +  L+E++   +QE+   + E Q L++ KL L++EI  Y KLLE EESR
Sbjct:  132 SVLPTRTQEKEAIKHLNDRFANFIDKVRFLEQQNKVLEAQWYALQEKTTTGSS-IDEMFEAYINGLRR--------------QLDGLGHDKGQLNGNLGQMQAVVEDFRAKYEAEINNRNAAEGEFVVVKK----------------------------DVDGAYLSKVELETRLQGLVDEINFLRSIFTQELSELEAQIKHTNVLVEIDNSRNLDVDGIIADVRQQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRMTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESR 450          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010061.1 (pep scaffold:Pmarinus_7.0:GL478364:48285:55057:1 gene:ENSPMAG00000009104.1 transcript:ENSPMAT00000010061.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 3.571e-19
Identity = 101/364 (27.75%), Postives = 168/364 (46.15%), Query Frame = 1
Query:  634 SIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLN--ESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKEL-ATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESR 1716
            S+   R QEK+ ++ LN+RFA++I+K RFLE+QNK L  +   L+  T   +S V E++E  IN LR  L+    E  RA             GDL +   ++ED   +Y A I                        S+   +E        DE    +++ +   L+ + LE  L  L+E + F + I A E+ EL A + + N   E       ++   + D++ +YE      + E +A Y  + Q + +   R++ E    + E + +  Q+Q  R+ +  L+ Q A+ E  +       E   R  +  +  L+E++   +QE+   + E Q L++ KL L++EI  Y KLLE EESR
Sbjct:  130 SVLPTRTQEKEAIKHLNDRFANFIDKVRFLEQQNKVLEAQWYALQEKTTTGSS-VDEMFEAYINGLRRQLDGLGHENGRAN------------GDLGQMQAVVEDFRAKYEAEI------------------------SLRTERE--------DEFVFAKKDVDGAYLSKVELEAKLDGLQEDINFMRSIFAQELSELEAQIKHTNVLVEIDNSRNLDVDGIIADVRHQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRVTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESR 448          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: zgc:136930 (zgc:136930 [Source:ZFIN;Acc:ZDB-GENE-060312-16])

HSP 1 Score: 75.0998 bits (183), Expect = 2.588e-14
Identity = 97/376 (25.80%), Postives = 169/376 (44.95%), Query Frame = 1
Query:  625 GLNSIKK--GRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGT-IQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIR--TSKTRDNV-----ETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 1722
            G+ +I     R  EK  LQ LN+RF  Y+EK R L+ +N  L  ++  + GG  +     V   YEV+I +LR+ +      +  LEI+++++     +L+ +      +  Q  + I   ++++E F           DTR    T+     + L DE+  L++ YE+                E   F+ ++  TEV   + +        +++         L  I++EYE   T  + E EA Y  +++EI+  TSKT + +     E     ++     S++Q++ S+   +E   A YE   ++  A+Y+ +  SLE+ +   +  L          L   QSLLD KL L+ EI+ Y  LLE E +R +
Sbjct:  173 GVGTIPPMASREAEKSTLQFLNDRFGGYVEKVRLLQRENAALEAQLASITGGAPLSPDGGVTVNYEVQITELRTTIETLILDKVNLEIELDNIRATAEELKAKFEFEAGVRYQLESDISLMKKDIE-FA---------TDTRVNLTTR----YTALTDELTFLKKTYEE----------------EFATFQTRLGTTEVSSGSIIEVDTIKSFDLM-------STLSQIRSEYEVVATRNRAEAEAYYHSRIEEIQAVTSKTTEAINFAKTEIVSVTKDIQMHYSELQTLLSQSYSMEQAVASYEARASSEVASYQSSVASLEVAIETARMDLQRQ-------LLAYQSLLDVKLQLDAEISTYRNLLEGEAARCS 504          
BLAST of Intermediate filament protein vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 108.227 bits (269), Expect = 1.676e-24
Identity = 95/392 (24.23%), Postives = 191/392 (48.72%), Query Frame = 1
Query:  634 SIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSN--------------LRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMV------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATL 1749
            S K  RAQEK +LQ LN+R A+YI++ + LE++N +L  E+   +    ++   +K +YE E+   R LL+E+ K +A  +I+ +       D Q           +++   DK+    +  E E+ ++++    +    T+   E  N              L+D +K  +   E+E L  + LE+  QSL+E   F+KQ++  E+ ++ +      TK  +V       ++  M   L++++ +Y++     K+E E  Y  + +E+R  + RD+      +EEN  +   +  + S++  LE +N      +++++    + +   + ++L  + ++   +  +  AL + + L+  K+ L++EI AY KLLE EE+R+  +   +  L
Sbjct:   32 SAKFTRAQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKAKQQIESSK---NSNDAQ-----------EFKNKFDKEAAARKKAEKELNDVRKLLHDKENQLTRRNQEALNLESVLRELQGECEELKDALKAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYKDKYEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELRTSIDDALRDYEDLMGVKVALDMEITAYRKLLESEETRLEITPPASPVL 409          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: viml (vimentin [Source:NCBI gene;Acc:101163931])

HSP 1 Score: 129.798 bits (325), Expect = 1.383e-31
Identity = 117/397 (29.47%), Postives = 201/397 (50.63%), Query Frame = 1
Query:  547 YSMQSGNQQSGSVMPLIRGDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKEL--ATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 1722
            Y++++   +S + MP +  +S+  +L   +NS     R  EK  +Q LN+RFASYIEK RFLE+QNK L+ E+E+L+G   + TS++ ++YE E+ +LR  +++    +A +E+  ++L  +I  L+++L          R  I  QR E E                   AT            ++  RQ+ +  ALA + LE  ++SL+E + F K++H  E+ E        Q   + +M   + ++  ALRD++ +YEN  T   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  L  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++
Sbjct:   50 YAVKTQRLRSSAAMPRLASESLDFSLHDAVNSEFLTNRTNEKAQMQSLNDRFASYIEKVRFLEQQNKILLAELEQLRG---KGTSRIGDLYEDEMRELRRQVDQLTNEKARVEVHRDNLADDIERLREKL----------RDEI-SQREEAE-------------------AT------------MQSFRQDVDSAALARLDLERKIESLQEEINFLKKLHDEEMLEFQSQVQQQQQHVQVDMDVAKPDLTAALRDVRLQYENLATKNIQESEEWYKSKFADLTEAAARNNEALRMAKQEANDYRRQVQALTCEVDALKGTNESLERQLREMEENFSLESNGYQDTIGRLEEDMHNIKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 401          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: viml (vimentin [Source:NCBI gene;Acc:101163931])

HSP 1 Score: 127.872 bits (320), Expect = 4.120e-31
Identity = 117/395 (29.62%), Postives = 199/395 (50.38%), Query Frame = 1
Query:  547 YSMQSGNQQSGSVMPLIRGDSV--ALQTGLNS-IKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKEL--ATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESR 1716
            Y++++   +S + MP +  +S+  +L   +NS     R  EK  +Q LN+RFASYIEK RFLE+QNK L+ E+E+L+G   + TS++ ++YE E+ +LR  +++    +A +E+  ++L  +I  L+++L          R  I  QR E E                   AT            ++  RQ+ +  ALA + LE  ++SL+E + F K++H  E+ E        Q   + +M   + ++  ALRD++ +YEN  T   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  L  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR
Sbjct:   50 YAVKTQRLRSSAAMPRLASESLDFSLHDAVNSEFLTNRTNEKAQMQSLNDRFASYIEKVRFLEQQNKILLAELEQLRG---KGTSRIGDLYEDEMRELRRQVDQLTNEKARVEVHRDNLADDIERLREKL----------RDEI-SQREEAE-------------------AT------------MQSFRQDVDSAALARLDLERKIESLQEEINFLKKLHDEEMLEFQSQVQQQQQHVQVDMDVAKPDLTAALRDVRLQYENLATKNIQESEEWYKSKFADLTEAAARNNEALRMAKQEANDYRRQVQALTCEVDALKGTNESLERQLREMEENFSLESNGYQDTIGRLEEDMHNIKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR 399          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: ENSORLT00000011270.2 (lamin-A [Source:NCBI gene;Acc:101160250])

HSP 1 Score: 129.028 bits (323), Expect = 1.382e-30
Identity = 142/561 (25.31%), Postives = 248/561 (44.21%), Query Frame = 1
Query:  649 RAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKD----ETSNLRDEIKKL-------RQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELA------TVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTK-----GNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAK---GKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKA 2256
            R QEK+DL  LN+R A YI+K R LE +N  L   I E +    ++ + +K  YE E+   R  L+   K RA L++++  L  +  +L+ R        T+  + +    + L+  E     L   KD     A  EK     E  +L+ ++ KL       R+  + E L  +  E+ +Q+L+E +EF+K +H+ E++E         V   N  +++   ++S++  AL ++++++E ++   K+E+E +Y  +++  R S  R +       EE  +I+++++S  ++++ L+ Q A  E  + ++       + S    L   + ++   +Q +   L E Q LLD KL L++EI AY KLLE EE R+  S     T                              G S   S              + E + Y    +   R T+     G +++ E DL G  + L N   + ++L    ++R V GS   I F    K  L AG+++++ A    G        +     SWG G+   TTL  + G E A
Sbjct:   23 RLQEKEDLSNLNDRLAVYIDKVRSLEAENACLRVRITESETEVTRELTGLKNAYEAELADARKTLDSVAKERARLQLELGKLREDHKELKAR-------NTKKESDLAAALQRLKDLEA----LMNSKDASLTTALGEKRNLEVENRDLKAQVSKLDTGLGDARKQLQDEMLRRVDGENRIQTLKEELEFQKNLHSEELQETKRRHESRMVEMNNGQQQD---FESKLAEALVEMRSQHELQIQLYKEEIEKTYNAKLESARQSADRSSHLVGAAHEELQQIRTRLESTSAQLSQLQKQLAAREAKIRDLEDALTRERDSTRRLLADKEREMADMRQRMQQQLDEYQELLDVKLALDMEICAYRKLLEGEEERLRLSPSPPPT---------------------RVTGSRSSVGRSVHSSAQSSPAKRRRPNEADSEASSYGGGALARTRITQQASASGRVTVDEVDLDGKYVRLSNKADEDQNLGSWQVRRQV-GSGTPILFKFPAKFTLKAGQRVTIWASNAGGSHNPPSDLVWKSQPSWGTGDQFQTTLISASGEEMA 547          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 117.087 bits (292), Expect = 2.003e-27
Identity = 121/448 (27.01%), Postives = 210/448 (46.88%), Query Frame = 1
Query:  448 SGRIVSTTRSMYKP---------ISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSI-----KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIR-------ANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            S R+ S+ R  + P         +S SR ++    RN  S+S  +   +  S +   L+      L    +S+     K+ R  EK ++  LN+RFASYIEK R LE+QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  ++     +A LEI+ ++L  ++  L++RL                        + E+V               ++ E  N    +   RQ+ ++ +L+ + LE  ++SL++ + F K+IH  E++E            ++   + ++  ALRDI+ +YEN  T   QE E  Y  +  ++  +  R+       K+E +  + QIQ +   +  L   N   E  L  +        A Y++T       +  L+E++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+   
Sbjct:    3 SQRVQSSYRKRFGPQGPGSAGGRLSSSRLSWHGTPRNI-SISSPISRTSLGSSTAALLMGSPGDRLDFSADSLLKAQYKETRTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLRG---KEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNLAADLATLKQRL------------------------QDEIV---------------QRQEAEN---NLNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDLDVSKPDLTAALRDIRLQYENLATSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANEYRRQIQVLTCDLDALRGTNESLERQLREMEDRCAMETAGYQDT-------VSRLEEEIQALKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITIP 397          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 117.087 bits (292), Expect = 2.261e-27
Identity = 121/448 (27.01%), Postives = 210/448 (46.88%), Query Frame = 1
Query:  448 SGRIVSTTRSMYKP---------ISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSI-----KKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIR-------ANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1728
            S R+ S+ R  + P         +S SR ++    RN  S+S  +   +  S +   L+      L    +S+     K+ R  EK ++  LN+RFASYIEK R LE+QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  ++     +A LEI+ ++L  ++  L++RL                        + E+V               ++ E  N    +   RQ+ ++ +L+ + LE  ++SL++ + F K+IH  E++E            ++   + ++  ALRDI+ +YEN  T   QE E  Y  +  ++  +  R+       K+E +  + QIQ +   +  L   N   E  L  +        A Y++T       +  L+E++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+   
Sbjct:    3 SQRVQSSYRKRFGPQGPGSAGGRLSSSRLSWHGTPRNI-SISSPISRTSLGSSTAALLMGSPGDRLDFSADSLLKAQYKETRTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLRG---KEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNLAADLATLKQRL------------------------QDEIV---------------QRQEAEN---NLNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDLDVSKPDLTAALRDIRLQYENLATSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANEYRRQIQVLTCDLDALRGTNESLERQLREMEDRCAMETAGYQDT-------VSRLEEEIQALKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITIP 397          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 513/608 (84.38%), Postives = 557/608 (91.61%), Query Frame = 1
Query:  457 IVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2280
            +++T+RS YKPISQ RNN KDLQ+ +  +SYS QS +QQ  S +PLIRGDSVALQ+G+ S+KKGRAQEK+DLQ+LNERFASYIEKARFLE QNKQL  EIE+LKGGT+QD SK+KEIYEVEINQLR+L+NESEKS+APLE QV+SLEYEI DL+KRL++LEDI +QY++TIDKQR+++  FEGE+VEL+RFK T+  D  KEK+E   LRD++KKLRQ+YEKEALAH+TLEH+LQSL+E +EFEKQIH TEVKELATVAY++PTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS DGNATLSQFMSFT                +G GG G SGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA
Sbjct:   89 VITTSRSYYKPISQPRNNLKDLQKTSG-MSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMSFT--------------SSSGAGGAGGSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 681          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 513/608 (84.38%), Postives = 557/608 (91.61%), Query Frame = 1
Query:  457 IVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2280
            +++T+RS YKPISQ RNN KDLQ+ +  +SYS QS +QQ  S +PLIRGDSVALQ+G+ S+KKGRAQEK+DLQ+LNERFASYIEKARFLE QNKQL  EIE+LKGGT+QD SK+KEIYEVEINQLR+L+NESEKS+APLE QV+SLEYEI DL+KRL++LEDI +QY++TIDKQR+++  FEGE+VEL+RFK T+  D  KEK+E   LRD++KKLRQ+YEKEALAH+TLEH+LQSL+E +EFEKQIH TEVKELATVAY++PTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS DGNATLSQFMS               +    GGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA
Sbjct:   89 VITTSRSYYKPISQPRNNLKDLQKTSG-MSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMS-------------FTSSSGAGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 682          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 516/608 (84.87%), Postives = 560/608 (92.11%), Query Frame = 1
Query:  457 IVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2280
            +++T+RS YKPISQ RNN KDLQ+ +  +SYS QS +QQ  S +PLIRGDSVALQ+G+ S+KKGRAQEK+DLQ+LNERFASYIEKARFLE QNKQL  EIE+LKGGT+QD SK+KEIYEVEINQLR+L+NESEKS+APLE QV+SLEYEI DL+KRL++LEDI +QY++TIDKQR+++  FEGE+VEL+RFK T+  D  KEK+E   LRD++KKLRQ+YEKEALAH+TLEH+LQSL+E +EFEKQIH TEVKELATVAY++PTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS DGNATLSQFMS               + GAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA
Sbjct:   84 VITTSRSYYKPISQPRNNLKDLQKTSG-MSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMS------------FTSSSGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 678          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030599.1 (SMESG000030599.1)

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 521/536 (97.20%), Postives = 527/536 (98.32%), Query Frame = 1
Query:  154 MESSKRTVITTSKQEGPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYPQSGNEREDYNESGSQQFNEDGSEISGRIVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFM 1761
            MESSKRTVITTSKQEGPISGSSSVTRSGVSMTSGSGSTYGSGSGGELGSGSGSGSGSRYQSSSRVTTTTRSDYPQSGNEREDYNESGSQQFNEDGSEISGRIVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKL+GIKQELEASY LQMQEIRTSKTRDNVETT YKEENSRIKSQIQSMRSRI DLEMQNAEYEHNLNNIRANYEETQRSLELQLL LQEQLTGTQQ+LT+ LTELQSLLDAKLGLELEIAAY+KLLEFEE+RVNFS DGN   SQF+
Sbjct:    1 MESSKRTVITTSKQEGPISGSSSVTRSGVSMTSGSGSTYGSGSGGELGSGSGSGSGSRYQSSSRVTTTTRSDYPQSGNEREDYNESGSQQFNEDGSEISGRIVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLSGIKQELEASYSLQMQEIRTSKTRDNVETTQYKEENSRIKSQIQSMRSRITDLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT--SQFI 534          

HSP 2 Score: 146.362 bits (368), Expect = 4.478e-36
Identity = 75/127 (59.06%), Postives = 102/127 (80.31%), Query Frame = 1
Query: 1894 MTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2274
            ++  E  +YQ KRMKFRRTTKGNISIAE D+ G  I+LEN GTK ESL GMTIKR +DG+E+ +SFTI  + +L++GEK+++ AKGK TGKG+E+EI++  WG+G+ +VT+L ++EG EKA HYQE+
Sbjct:  626 LSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAKGKKTGKGKELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEI 752          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030596.1 (SMESG000030596.1)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 316/435 (72.64%), Postives = 371/435 (85.29%), Query Frame = 1
Query:  457 IVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFM 1761
            +V+T  S  KPISQ RN+ +DLQ+   + S +M            LIRGDSVALQ+G+ S+KKGRAQEK++LQELNERFASYIEKARFLE QNKQL  EIE+LKGGT+QD SK+KEIYEVEINQLR+L+NESEKS+APLE QV+SLEYEI DL+KRL++LEDI +QY++TIDKQR ++  FEGE+VELKRFK T+  D T EK+E  +L+D +KKLRQ+YE+EALAH+TLEH+LQSL+E +EFEKQIH TEVKELATVAY++PTKENMV+WQSEMGRALRDIQ EYENKLTGIKQEL++SYG QMQEI+TSKTRDNVETTHYKEENSR+KSQIQSMR RIA+LE QNAEYE NL NIR NYEETQR+L+ QL  +Q+QL+GTQQELT A TELQSLLDAKLGLELEIAAYA+LLE EE RV  S D  + +SQFM
Sbjct:   48 VVTTNHSYIKPISQPRNSLRDLQKTTEN-SQNM------------LIRGDSVALQSGVTSMKKGRAQEKRNLQELNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRNDIAAFEGELVELKRFKGTQGADVTLEKEEVKSLKDSLKKLRQDYEREALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVFWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQMQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRMRIAELERQNAEYEINLKNIRDNYEETQRNLQSQLFSMQDQLSGTQQELTAASTELQSLLDAKLGLELEIAAYARLLEIEEERVLSSADQRSVMSQFM 469          

HSP 2 Score: 134.806 bits (338), Expect = 1.339e-32
Identity = 67/120 (55.83%), Postives = 92/120 (76.67%), Query Frame = 1
Query: 1921 QSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2280
             SK+M  RRTT GNISIAE+D  G  I+LEN+G++ +SL GM IKR +DG  N ++++I  K++L+AGE+I++C  GK TGKG+E+EI++ SWG G NV+T LCD+ G EKAA YQE+ A
Sbjct:  533 HSKKMSSRRTTTGNISIAESDESGLFIVLENMGSQTQSLSGMMIKRNIDGVANFVTYSIPKKIDLSAGERITICGHGKKTGKGKELEIEEDSWGFGENVITALCDANGEEKAALYQEIVA 652          
The following BLAST results are available for this feature:
BLAST of Intermediate filament protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMNA9.076e-3326.03lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA9.381e-3326.03lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA1.247e-3226.03lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA2.658e-3225.87lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
VIM3.605e-3229.37vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifa-14.471e-6630.76Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-14.471e-6630.76Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-14.471e-6630.76Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-14.897e-6630.76Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-16.657e-6630.76Intermediate filament protein ifa-1 [Source:UniPr... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LamC1.296e-3226.64gene:FBgn0010397 transcript:FBtr0087512[more]
Lam1.581e-3124.52gene:FBgn0002525 transcript:FBtr0346460[more]
Lam1.581e-3124.52gene:FBgn0002525 transcript:FBtr0307059[more]
Lam1.581e-3124.52gene:FBgn0002525 transcript:FBtr0307058[more]
Lam1.581e-3124.52gene:FBgn0002525 transcript:FBtr0079100[more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
viml1.140e-3229.37vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-174... [more]
vim6.681e-3026.89vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3][more]
desma1.333e-2729.92desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
desma1.378e-2729.92desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
gfap1.967e-2627.20glial fibrillary acidic protein [Source:NCBI gene;... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
timm131.882e-3225.81translocase of inner mitochondrial membrane 13 hom... [more]
vim6.927e-3229.11vimentin [Source:NCBI gene;Acc:496727][more]
vim7.491e-3229.11vimentin [Source:NCBI gene;Acc:496727][more]
vim8.659e-3229.11vimentin [Source:NCBI gene;Acc:496727][more]
timm131.338e-3126.21translocase of inner mitochondrial membrane 13 hom... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vim5.922e-3229.24vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Vim8.620e-3229.24vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Gfap1.452e-2828.57glial fibrillary acidic protein [Source:MGI Symbol... [more]
Gfap1.638e-2828.57glial fibrillary acidic protein [Source:MGI Symbol... [more]
Lmna1.538e-2728.32lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
back to top
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01240|NF60_DORPE1.835e-7641.4660 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|Q01241|NF70_DORPE1.709e-7541.2470 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|P90901|IFA1_CAEEL9.921e-6530.76Intermediate filament protein ifa-1 OS=Caenorhabdi... [more]
sp|P90900|IFA4_CAEEL5.008e-6128.62Intermediate filament protein ifa-4 OS=Caenorhabdi... [more]
sp|O02365|IFA2_CAEEL1.630e-5629.86Intermediate filament protein ifa-2 OS=Caenorhabdi... [more]
back to top
BLAST of Intermediate filament protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FSC21.569e-10340.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
W0GAA83.253e-10340.79Intermediate filament b-like protein OS=Macrostomu... [more]
A0A267EDW29.333e-9437.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GC027.601e-9337.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JG081.441e-8941.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vim3.028e-3029.40vimentin [Source:NCBI gene;Acc:103044141][more]
vim1.060e-2929.37vimentin [Source:NCBI gene;Acc:103044141][more]
lmnb25.513e-2925.04lamin B2 [Source:NCBI gene;Acc:103025469][more]
gfap1.484e-2727.63glial fibrillary acidic protein [Source:NCBI gene;... [more]
gfap1.589e-2727.85glial fibrillary acidic protein [Source:NCBI gene;... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb27.283e-2523.59lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
desmb7.120e-2028.82desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
ENSPMAT00000010102.13.022e-1926.24pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 g... [more]
ENSPMAT00000010061.13.571e-1927.75pep scaffold:Pmarinus_7.0:GL478364:48285:55057:1 g... [more]
zgc:1369302.588e-1425.80zgc:136930 [Source:ZFIN;Acc:ZDB-GENE-060312-16][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intermediate filament protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372251.676e-2424.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
viml1.383e-3129.47vimentin [Source:NCBI gene;Acc:101163931][more]
viml4.120e-3129.62vimentin [Source:NCBI gene;Acc:101163931][more]
ENSORLT00000011270.21.382e-3025.31lamin-A [Source:NCBI gene;Acc:101160250][more]
gfap2.003e-2727.01glial fibrillary acidic protein [Source:NCBI gene;... [more]
gfap2.261e-2727.01glial fibrillary acidic protein [Source:NCBI gene;... [more]
back to top
BLAST of Intermediate filament protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030598.10.000e+084.38SMESG000030598.1[more]
SMESG000030598.10.000e+084.38SMESG000030598.1[more]
SMESG000030598.10.000e+084.87SMESG000030598.1[more]
SMESG000030599.14.478e-3697.20SMESG000030599.1[more]
SMESG000030596.11.339e-3272.64SMESG000030596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002072 ID=SMED30002072|Name=Intermediate filament protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2324bp
CATAAATGGTGCACTTTTGAGAAATTTGCGTTGGAGTAAATAGAAAGCAG
TCTTAACAAAAGGATAACTAGGTCAGAACAATAGCTGCGTTGAAAAATCT
ATTATAAATATATCCAACTTTCAACTTGTTTCTCTAAAGTTATTTTTGTA
ATAATGGAATCGTCTAAAAGAACTGTCATTACGACTTCTAAACAAGAAGG
GCCGATTAGTGGCTCAAGTTCGGTTACTAGATCTGGAGTCTCAATGACAT
CAGGTTCTGGTTCTACTTACGGATCGGGATCTGGAGGAGAATTGGGCTCA
GGTTCAGGATCCGGCTCTGGAAGTCGATATCAAAGTTCGTCTCGTGTTAC
TACAACAACTAGATCTGACTATCCACAATCTGGAAATGAAAGAGAAGACT
ATAATGAATCAGGAAGTCAACAATTCAATGAAGATGGATCAGAGATTTCT
GGTCGAATCGTTTCAACTACCAGATCCATGTATAAGCCAATAAGTCAATC
AAGGAATAATTTCAAAGACTTGCAAAGAAATGCTGCATCTTTAAGTTATA
GTATGCAGTCTGGAAACCAACAAAGTGGTTCAGTTATGCCACTCATCAGA
GGTGATAGTGTAGCCTTACAGACTGGACTGAATTCGATAAAGAAAGGAAG
AGCTCAAGAAAAAAAAGACTTACAAGAGCTGAATGAAAGATTTGCGAGTT
ATATAGAAAAAGCACGATTTTTGGAAGAGCAAAATAAGCAATTAGTCGGT
GAAATTGAAGAACTCAAAGGGGGAACTATTCAAGATACATCAAAAGTTAA
AGAGATCTATGAAGTTGAAATCAATCAACTCCGATCTTTACTAAACGAAT
CAGAGAAAAGTAGAGCACCACTGGAAATTCAAGTGAATTCCTTGGAATAC
GAAATAGGCGATTTGCAAAAAAGACTGCTGCTATTAGAGGATATAGGTAC
ACAGTATAGAGCAACGATTGATAAACAGCGTCGAGAACTCGAGACCTTCG
AAGGGGAAATGGTTGAATTGAAAAGGTTTAAAGACACTCGAAGTATCGAT
GCTACAAAAGAAAAGGATGAAACAAGCAACTTAAGAGATGAAATAAAAAA
ATTAAGACAAAACTATGAAAAAGAAGCATTAGCGCATATCACCCTTGAAC
ATGACTTGCAGAGTTTGAGAGAAACTATGGAGTTCGAGAAACAAATCCAT
GCTACAGAAGTAAAAGAGCTGGCAACCGTTGCATATCAAAACCCAACGAA
AGAAAACATGGTTTACTGGCAAAGTGAAATGGGACGTGCTTTACGGGACA
TTCAAACTGAATATGAAAACAAGCTTACAGGAATCAAACAAGAATTGGAG
GCTTCTTATGGTTTACAAATGCAGGAAATACGAACAAGTAAAACCAGAGA
CAATGTGGAAACGACCCATTACAAAGAAGAGAACAGCCGAATAAAATCTC
AAATCCAAAGCATGAGATCGAGAATCGCTGATCTTGAGATGCAGAATGCT
GAATACGAACACAACTTGAATAATATTCGTGCTAATTACGAAGAAACTCA
AAGAAGTCTTGAATTGCAGTTGTTGTATTTGCAAGAGCAATTGACAGGAA
CTCAACAAGAATTGACAGTCGCTTTGACCGAACTCCAAAGCTTATTGGAC
GCGAAGTTGGGACTGGAATTAGAAATCGCAGCCTATGCAAAACTATTAGA
ATTCGAAGAGAGTCGTGTCAATTTCTCTGGTGATGGCAACGCTACTTTAT
CTCAATTTATGAGTTTCACATCAAGTAGCGGAGCTGGAGGTGCTGGAGGG
GCTGGAGGTGCTGGTGGTGCTGGAGGAGGAGGAGGAGGAAGCAGTGGGTT
CGGATCAGGAAGTAGAATTGGAGGGTCAAGTGGTTTCAGCGGAATGACAG
AAAGAGAAACAACTGACTATCAGTCAAAACGAATGAAATTTAGACGAACG
ACAAAGGGAAACATTTCCATTGCAGAGACTGACCTTATAGGTTCAACAAT
TATTCTGGAAAATATTGGGACCAAAGTGGAATCACTCGAAGGTATGACTA
TTAAAAGAGTAGTCGACGGCAGCGAAAATAAAATCTCATTTACCATTTCC
GGAAAAGTTAACTTAAATGCTGGTGAAAAGATTTCTCTTTGTGCCAAAGG
GAAAATAACCGGCAAAGGACGAGAAATCGAAATTGATGATGCTTCATGGG
GGGTTGGTAACAATGTCGTAACAACACTTTGTGATTCAGAAGGAGCGGAA
AAGGCAGCTCACTATCAAGAGGTTTCGGCCTAGAAACCTTGCTAAATATT
AAACTGAATTTGTATGAACATAAC
back to top

protein sequence of SMED30002072-orf-1

>SMED30002072-orf-1 ID=SMED30002072-orf-1|Name=SMED30002072-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=710bp
MESSKRTVITTSKQEGPISGSSSVTRSGVSMTSGSGSTYGSGSGGELGSG
SGSGSGSRYQSSSRVTTTTRSDYPQSGNEREDYNESGSQQFNEDGSEISG
RIVSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRG
DSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGE
IEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYE
IGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDA
TKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHA
TEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEA
SYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAE
YEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDA
KLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTSSSGAGGAGGA
GGAGGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTT
KGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISG
KVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEK
AAHYQEVSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR001664IF
IPR001322Lamin_tail_dom
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity