SMED30002068

Overview
NameSMED30002068
Smed IDSMED30002068
Length (bp)461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002068 (SMED30002068) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002068 (SMED30002068) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002068 (SMED30002068) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002068 (SMED30002068) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002068

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002068h1SMcG0001544 SmedASXL_012311SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002068h1SMcG0001544 dd_Smed_v4_13194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30002068h1SMcG0001544 dd_Smed_v4_13194_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002068 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008842:25519..25980 -2275
v31.025204:9701..10162 +2266
Homology
BLAST of SMED30002068 vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 145.206 bits (365), Expect = 3.308e-42
Identity = 70/139 (50.36%), Postives = 96/139 (69.06%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP++    +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 145.206 bits (365), Expect = 3.308e-42
Identity = 70/139 (50.36%), Postives = 96/139 (69.06%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP++    +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 145.206 bits (365), Expect = 3.308e-42
Identity = 70/139 (50.36%), Postives = 96/139 (69.06%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP++    +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 125.176 bits (313), Expect = 3.508e-34
Identity = 60/115 (52.17%), Postives = 82/115 (71.30%), Query Frame = -2
Query:  116 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSK 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP++    +  GNIFAYA  YDWSK
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPISACCFNHNGNIFAYASSYDWSK 340          
BLAST of SMED30002068 vs. Ensembl Human
Match: BUB3 (BUB3 mitotic checkpoint protein [Source:HGNC Symbol;Acc:HGNC:1151])

HSP 1 Score: 65.0846 bits (157), Expect = 1.624e-12
Identity = 44/132 (33.33%), Postives = 68/132 (51.52%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDV-NKKPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN IS H IH T  T GSDG +  WD  ++ RL       + P ++  +   + G   A A  Y     +E +D  + +  +FIR+
Sbjct:  193 GYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKE--NNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGTTLAIASSY----MYEMDDTEHPEDGIFIRQ 315          
BLAST of SMED30002068 vs. Ensembl Celegans
Match: rae-1 (mRNA export factor rae-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93454])

HSP 1 Score: 147.517 bits (371), Expect = 1.387e-43
Identity = 69/138 (50.00%), Postives = 93/138 (67.39%), Query Frame = -2
Query:   44 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 457
            + PAGF +GSIEGRV +Q +   N KD+FTFKCHR+    +  QEI+AVNDI  HP H T+VT+GSDG+ + WDK++RT+LK+ +P    P+T  D+ S G    YA+GYDWS+GHE N      K+ I +C  D+ P
Sbjct:  233 QNPAGFALGSIEGRVAVQYVDVANPKDNFTFKCHRSAELVNGFQEIYAVNDICFHPQHGTLVTIGSDGRYSMWDKDARTKLKTSEPHP-MPLTCCDVHSSGAFLVYALGYDWSRGHEGN-TQPGSKIVIHKCIEDMKP 368          
BLAST of SMED30002068 vs. Ensembl Celegans
Match: rae-1 (mRNA export factor rae-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93454])

HSP 1 Score: 147.517 bits (371), Expect = 1.387e-43
Identity = 69/138 (50.00%), Postives = 93/138 (67.39%), Query Frame = -2
Query:   44 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 457
            + PAGF +GSIEGRV +Q +   N KD+FTFKCHR+    +  QEI+AVNDI  HP H T+VT+GSDG+ + WDK++RT+LK+ +P    P+T  D+ S G    YA+GYDWS+GHE N      K+ I +C  D+ P
Sbjct:  233 QNPAGFALGSIEGRVAVQYVDVANPKDNFTFKCHRSAELVNGFQEIYAVNDICFHPQHGTLVTIGSDGRYSMWDKDARTKLKTSEPHP-MPLTCCDVHSSGAFLVYALGYDWSRGHEGN-TQPGSKIVIHKCIEDMKP 368          
BLAST of SMED30002068 vs. Ensembl Celegans
Match: bub-3 (Mitotic checkpoint protein bub-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XWH0])

HSP 1 Score: 55.0694 bits (131), Expect = 1.791e-9
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = -2
Query:  116 GFVVGSIEGRVGIQSM---VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSK 445
             FVV SIEGRV ++ +     E  K  + FKCHR    T   + I  V+ ++ HP + T  T G+DG +  WD  +R R+  +   E   ++    +  G+  A A  Y + K
Sbjct:  208 AFVVSSIEGRVAVEYVDQSGEEMMKRKYAFKCHREKD-TDGTELIHPVHTVAFHPKYGTFATGGADGIVNIWDPFNRKRIIQLHKFETS-ISSLSFNEDGSQLAIATSYQYEK 318          
BLAST of SMED30002068 vs. Ensembl Fly
Match: Rae1 (gene:FBgn0034646 transcript:FBtr0071683)

HSP 1 Score: 164.081 bits (414), Expect = 4.381e-50
Identity = 78/141 (55.32%), Postives = 104/141 (73.76%), Query Frame = -2
Query:   35 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAKN 457
            KEP G  +GSIEGRV IQ +   N KD+FTFKCHRTT  TS  Q+I+AVNDI+ HP+H T+VT+GSDG  ++WDK++RT+LKS +  +Q  +T    ++ G IFAYA+GYDWSKGHE+ +  KKP++F+R C  +L P  N
Sbjct:  208 KEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKCHRTTG-TSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQS-ITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN 346          
BLAST of SMED30002068 vs. Ensembl Fly
Match: CG12782 (gene:FBgn0034838 transcript:FBtr0072048)

HSP 1 Score: 97.8265 bits (242), Expect = 7.869e-25
Identity = 49/132 (37.12%), Postives = 78/132 (59.09%), Query Frame = -2
Query:   68 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRL--KSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIR 457
            ++   +++    G V  QSM +     SF  +CHR     S I +++AVN++ ++ +   + T+GSDG   +WD + R++L    V PQ   P+T   I   G +FAYA+GYDWSKGHE++D + KP +F+R
Sbjct:  204 RDLTSWLIAKTNGMVFDQSMAHRTV--SFPIRCHRRE--NSGILDVYAVNEVKVNMVTQHIATVGSDGVFCFWDSQMRSKLLESKVHPQ---PITKCAISGDGKLFAYALGYDWSKGHEYSDSSIKPHIFLR 328          
BLAST of SMED30002068 vs. Ensembl Fly
Match: Bub3 (gene:FBgn0025457 transcript:FBtr0339148)

HSP 1 Score: 61.2326 bits (147), Expect = 1.735e-11
Identity = 31/79 (39.24%), Postives = 47/79 (59.49%), Query Frame = -2
Query:  215 GFVVGSIEGRVGIQSMVN--ENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRL 445
            G+V+ SIEGRV ++ + +  E  +  F FKCHR       I++I+ VN +S H ++ T  T GSDG +  WD  ++ RL
Sbjct:  193 GYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNRE--QNIEQIYPVNALSFHNVYQTFATGGSDGIVNIWDGFNKKRL 269          
BLAST of SMED30002068 vs. Ensembl Fly
Match: Bub3 (gene:FBgn0025457 transcript:FBtr0085465)

HSP 1 Score: 61.2326 bits (147), Expect = 1.735e-11
Identity = 31/79 (39.24%), Postives = 47/79 (59.49%), Query Frame = -2
Query:  215 GFVVGSIEGRVGIQSMVN--ENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRL 445
            G+V+ SIEGRV ++ + +  E  +  F FKCHR       I++I+ VN +S H ++ T  T GSDG +  WD  ++ RL
Sbjct:  193 GYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNRE--QNIEQIYPVNALSFHNVYQTFATGGSDGIVNIWDGFNKKRL 269          
BLAST of SMED30002068 vs. Ensembl Zebrafish
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:393973])

HSP 1 Score: 146.362 bits (368), Expect = 6.877e-43
Identity = 71/139 (51.08%), Postives = 97/139 (69.78%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    T+T Q+I+AVN IS HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T    +  GNIFAYA  YDWSKGHE+ +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTATPQDIYAVNAISFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACCFNHNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Zebrafish
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:393973])

HSP 1 Score: 146.362 bits (368), Expect = 7.172e-43
Identity = 71/139 (51.08%), Postives = 97/139 (69.78%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    T+T Q+I+AVN IS HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T    +  GNIFAYA  YDWSKGHE+ +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTATPQDIYAVNAISFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACCFNHNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Zebrafish
Match: bub3 (BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:ZDB-GENE-041010-210])

HSP 1 Score: 65.4698 bits (158), Expect = 5.898e-13
Identity = 43/132 (32.58%), Postives = 68/132 (51.52%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNKKP-KLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++++ VN IS H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G++ A A  Y      E  DV+     +FIR+
Sbjct:  193 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKE--NGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPSSIASLSFSTDGSLLAIASSY----MQELGDVSHPADAVFIRQ 315          
BLAST of SMED30002068 vs. Ensembl Zebrafish
Match: bub3 (BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:ZDB-GENE-041010-210])

HSP 1 Score: 65.4698 bits (158), Expect = 6.320e-13
Identity = 43/132 (32.58%), Postives = 68/132 (51.52%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNKKP-KLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++++ VN IS H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G++ A A  Y      E  DV+     +FIR+
Sbjct:  205 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLK--ENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPSSIASLSFSTDGSLLAIASSY----MQELGDVSHPADAVFIRQ 327          
BLAST of SMED30002068 vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 64.6994 bits (156), Expect = 1.671e-12
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNK-KPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN +S H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G+  A A  Y     +E +D++  +  ++IR+
Sbjct:  199 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKE--NNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGSTLAIAASY----MYEMDDIDHPEDAIYIRQ 321          
BLAST of SMED30002068 vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 64.6994 bits (156), Expect = 1.902e-12
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNK-KPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN +S H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G+  A A  Y     +E +D++  +  ++IR+
Sbjct:  197 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKE--NNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGSTLAIAASY----MYEMDDIDHPEDAIYIRQ 319          
BLAST of SMED30002068 vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 63.929 bits (154), Expect = 3.677e-12
Identity = 41/131 (31.30%), Postives = 69/131 (52.67%), Query Frame = -2
Query:   68 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNK-KPKLFIR 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN +S H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G+  A A  Y     +E +D++  +  ++IR
Sbjct:  199 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKE--NNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGSTLAIAASY----MYEMDDIDHPEDAIYIR 320          
BLAST of SMED30002068 vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 63.929 bits (154), Expect = 4.015e-12
Identity = 41/131 (31.30%), Postives = 69/131 (52.67%), Query Frame = -2
Query:   68 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVN-KKPKLFIR 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN +S H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G+  A A  Y     +E +D++  +  ++IR
Sbjct:  193 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKE--NNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGSTLAIAASY----MYEMDDIDHPEDAIYIR 314          
BLAST of SMED30002068 vs. Ensembl Mouse
Match: Rae1 (ribonucleic acid export 1 [Source:MGI Symbol;Acc:MGI:1913929])

HSP 1 Score: 144.821 bits (364), Expect = 3.296e-42
Identity = 70/139 (50.36%), Postives = 95/139 (68.35%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+     +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPIAACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Mouse
Match: Bub3 (BUB3 mitotic checkpoint protein [Source:MGI Symbol;Acc:MGI:1343463])

HSP 1 Score: 65.0846 bits (157), Expect = 1.054e-12
Identity = 44/132 (33.33%), Postives = 68/132 (51.52%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDV-NKKPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN IS H IH T  T GSDG +  WD  ++ RL       + P ++  +   + G   A A  Y     +E +D  + +  +FIR+
Sbjct:  193 GYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKE--NNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGTTLAIASSY----MYEMDDTEHPEDGIFIRQ 315          
BLAST of SMED30002068 vs. Ensembl Mouse
Match: Bub3 (BUB3 mitotic checkpoint protein [Source:MGI Symbol;Acc:MGI:1343463])

HSP 1 Score: 64.6994 bits (156), Expect = 1.197e-12
Identity = 44/132 (33.33%), Postives = 68/132 (51.52%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDV-NKKPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN IS H IH T  T GSDG +  WD  ++ RL       + P ++  +   + G   A A  Y     +E +D  + +  +FIR+
Sbjct:  193 GYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKE--NNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGTTLAIASSY----MYEMDDTEHPEDGIFIRQ 315          
BLAST of SMED30002068 vs. Ensembl Mouse
Match: Bub3 (BUB3 mitotic checkpoint protein [Source:MGI Symbol;Acc:MGI:1343463])

HSP 1 Score: 50.8322 bits (120), Expect = 5.124e-8
Identity = 26/68 (38.24%), Postives = 41/68 (60.29%), Query Frame = -2
Query:  248 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKI 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++I+ VN IS H IH T  T+ ++ ++
Sbjct:  118 GYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKE--NNIEQIYPVNAISFHNIHNTFATVMTELRL 183          
BLAST of SMED30002068 vs. UniProt/SwissProt
Match: sp|Q93454|RAE1_CAEEL (mRNA export factor rae-1 OS=Caenorhabditis elegans OX=6239 GN=rae-1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.764e-42
Identity = 69/138 (50.00%), Postives = 93/138 (67.39%), Query Frame = -2
Query:   44 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 457
            + PAGF +GSIEGRV +Q +   N KD+FTFKCHR+    +  QEI+AVNDI  HP H T+VT+GSDG+ + WDK++RT+LK+ +P    P+T  D+ S G    YA+GYDWS+GHE N      K+ I +C  D+ P
Sbjct:  233 QNPAGFALGSIEGRVAVQYVDVANPKDNFTFKCHRSAELVNGFQEIYAVNDICFHPQHGTLVTIGSDGRYSMWDKDARTKLKTSEPHP-MPLTCCDVHSSGAFLVYALGYDWSRGHEGN-TQPGSKIVIHKCIEDMKP 368          
BLAST of SMED30002068 vs. UniProt/SwissProt
Match: sp|Q7ZWF0|RAE1L_DANRE (mRNA export factor OS=Danio rerio OX=7955 GN=rae1 PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 5.191e-42
Identity = 71/139 (51.08%), Postives = 97/139 (69.78%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    T+T Q+I+AVN IS HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T    +  GNIFAYA  YDWSKGHE+ +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTATPQDIYAVNAISFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACCFNHNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. UniProt/SwissProt
Match: sp|Q3SWS8|RAE1L_RAT (mRNA export factor OS=Rattus norvegicus OX=10116 GN=Rae1 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 9.837e-42
Identity = 71/139 (51.08%), Postives = 95/139 (68.35%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QPV     +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPVAACGFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. UniProt/SwissProt
Match: sp|Q4R6D2|RAE1L_MACFA (mRNA export factor OS=Macaca fascicularis OX=9541 GN=RAE1 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.572e-41
Identity = 70/139 (50.36%), Postives = 96/139 (69.06%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP++    +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. UniProt/SwissProt
Match: sp|Q5RF99|RAEL1_PONAB (mRNA export factor OS=Pongo abelii OX=9601 GN=RAE1 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.588e-41
Identity = 70/139 (50.36%), Postives = 96/139 (69.06%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    TS  Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP++    +  GNIFAYA  YDWSKGHEF +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. TrEMBL
Match: B4G9Y3 (GL11275 OS=Drosophila persimilis OX=7234 GN=Dper\GL11275 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 9.347e-49
Identity = 79/141 (56.03%), Postives = 106/141 (75.18%), Query Frame = -2
Query:   35 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAKN 457
            KEP G+ +GSIEGRV IQ +   N KD+FTFKCHR+T+ TS  Q+I+AVNDI+ HP+H T+VT+GSDG  ++WDK++RT+LKS D  +Q  +T    +S G IFAYA+GYDWSKGHE+ +  KKP++F+R C  +L P  N
Sbjct:  209 KEPTGYALGSIEGRVAIQYVNPANPKDNFTFKCHRSTS-TSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSDAMDQS-ITKCGFNSNGQIFAYAVGYDWSKGHEYFNPGKKPQIFLRSCYEELKPRIN 347          
BLAST of SMED30002068 vs. TrEMBL
Match: A0A3B0JQZ5 (Blast:mRNA export factor OS=Drosophila guanche OX=7266 GN=DGUA_6G001061 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.287e-48
Identity = 79/141 (56.03%), Postives = 105/141 (74.47%), Query Frame = -2
Query:   35 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAKN 457
            KEP G+ +GSIEGRV IQ +   N KD+FTFKCHR+T  TS  Q+I+AVNDI+ HP+H T+VT+GSDG  ++WDK++RT+LKS D  +Q  +T    +S G IFAYA+GYDWSKGHE+ +  KKP++F+R C  +L P  N
Sbjct:  208 KEPTGYALGSIEGRVAIQYVNPANPKDNFTFKCHRSTG-TSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSDAMDQS-ITKCGFNSNGQIFAYAVGYDWSKGHEYFNPGKKPQIFLRSCYEELKPRIN 346          
BLAST of SMED30002068 vs. TrEMBL
Match: A0A1W4VRB5 (mRNA export factor OS=Drosophila ficusphila OX=30025 GN=LOC108096940 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.939e-47
Identity = 77/141 (54.61%), Postives = 105/141 (74.47%), Query Frame = -2
Query:   35 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAKN 457
            KEP G+ +GSIEGRV IQ +   N KD+FTFKCHR+T  TS  Q+I+AVNDI+ HP+H T+VT+GSDG  ++WDK++RT+LKS +  +Q  +T    ++ G IFAYA+GYDWSKGHE+ +  KKP++F+R C  +L P  N
Sbjct:  208 KEPTGYALGSIEGRVAIQYVNPANPKDNFTFKCHRSTG-TSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQS-ITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN 346          
BLAST of SMED30002068 vs. TrEMBL
Match: A0A2H1BWE1 (Nucleoporin GLE2 domain protein OS=Fasciola hepatica OX=6192 GN=D915_13696 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 2.120e-47
Identity = 70/140 (50.00%), Postives = 100/140 (71.43%), Query Frame = -2
Query:   38 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAK 457
            ++P GF +GSIEGRV IQ       K++FTFKCHR++A  +   EI+AVND++ HP+H T+ T+GSDG  ++WDK++RT+L+S D  E QP+T    D KG +F YA GYDWSKGH+F D +K  K+ +R C  ++TP++
Sbjct:   10 QQPNGFALGSIEGRVAIQYFNPTTPKENFTFKCHRSSAAVNGYHEIYAVNDMAFHPVHGTLATVGSDGYYSFWDKDARTKLRSSDTSE-QPLTCCTFDPKGQVFCYASGYDWSKGHQFADPSKPVKILMRLCMDEMTPSR 148          
BLAST of SMED30002068 vs. TrEMBL
Match: B3MIX8 (WD_REPEATS_REGION domain-containing protein OS=Drosophila ananassae OX=7217 GN=Dana\GF11632 PE=4 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 2.621e-47
Identity = 76/141 (53.90%), Postives = 105/141 (74.47%), Query Frame = -2
Query:   35 KEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAKN 457
            KEP G+ +GSIEGRV IQ +   N KD+FTFKCHR+T  T+  Q+I+AVNDI+ HP+H T+VT+GSDG  ++WDK++RT+LKS +  +Q  +T    ++ G IFAYA+GYDWSKGHE+ +  KKP++F+R C  +L P  N
Sbjct:  208 KEPTGYALGSIEGRVAIQYVSPANPKDNFTFKCHRSTG-TAGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQS-ITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN 346          
BLAST of SMED30002068 vs. Ensembl Cavefish
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:103040569])

HSP 1 Score: 145.206 bits (365), Expect = 1.861e-42
Identity = 70/139 (50.36%), Postives = 97/139 (69.78%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +   N  KD+FTFKCHR+    T+T Q+I+AVN IS HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T    +  GNIFAY+  YDWSKGHE+ +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTTTPQDIYAVNAISFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACCFNHNGNIFAYSSSYDWSKGHEYYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Cavefish
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:103028940])

HSP 1 Score: 62.3882 bits (150), Expect = 7.775e-12
Identity = 32/79 (40.51%), Postives = 47/79 (59.49%), Query Frame = -2
Query:  215 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRL 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR     + I++++ VN IS H +H T  T GSDG +  WD  ++ RL
Sbjct:  193 GYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKE--NGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL 269          
BLAST of SMED30002068 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007594.1 (pep scaffold:Pmarinus_7.0:GL477618:2658:11743:-1 gene:ENSPMAG00000006850.1 transcript:ENSPMAT00000007594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 2.662e-44
Identity = 70/138 (50.72%), Postives = 97/138 (70.29%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV IQ +   N  KD+FTFKCHR+   T   Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T   I++ GNIFAY+  YDWSKGHE+    KK  +F+R    +L P
Sbjct:  225 KPTGFALGSIEGRVAIQYIQPANPAKDNFTFKCHRSNGQTGP-QDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACSINNNGNIFAYSSSYDWSKGHEYYSPQKKNYIFLRSATEELKP 360          
BLAST of SMED30002068 vs. Ensembl Sea Lamprey
Match: bub3 (BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:ZDB-GENE-041010-210])

HSP 1 Score: 56.9954 bits (136), Expect = 1.033e-10
Identity = 35/110 (31.82%), Postives = 56/110 (50.91%), Query Frame = -2
Query:  128 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGY 445
             +V+ SIEGRV ++ +    E  K  + FKCHR     + ++ I+ VN I+ H +H T  T GSDG +  WD  ++ RL       + P ++  +     G++ A A  Y
Sbjct:  196 AYVLSSIEGRVAVEYLDPNPEVQKKKYAFKCHRLK--DNGVELIYPVNAIAFHNVHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSMDGSMIAIASSY 300          
BLAST of SMED30002068 vs. Ensembl Yeast
Match: GLE2 (RNA export factor associated with the nuclear pore complex (NPC); associates with NUP116p; required for polyadenylated RNA export but not for protein import; homologous to S. pombe Rae1p and human RAE1 [Source:SGD;Acc:S000000909])

HSP 1 Score: 99.3673 bits (246), Expect = 4.764e-26
Identity = 53/124 (42.74%), Postives = 72/124 (58.06%), Query Frame = -2
Query:  101 EPAGFVVGSIEGRVGIQSMVNENTKDS-FTFKCHRTT----APTSTIQE-IFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFN 454
            E  G+ +GS+EGR  I+ + +   K S F+FKCHR T    AP S  Q  ++ VN I+ HP++ T VT G DG   +WDK  R RLK   P  Q  + V   +  G++FAYA+ YDW +GH  N
Sbjct:  219 EADGYAIGSVEGRCSIRYIDDGMQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGY-PTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGN 341          
BLAST of SMED30002068 vs. Ensembl Yeast
Match: BUB3 (Kinetochore checkpoint WD40 repeat protein; localizes to kinetochores during prophase and metaphase, delays anaphase in the presence of unattached kinetochores; forms complexes with Mad1p-Bub1p and with Cdc20p, binds Mad2p and Mad3p; functions at kinetochore to activate APC/C-Cdc20p for normal mitotic progression [Source:SGD;Acc:S000005552])

HSP 1 Score: 57.3806 bits (137), Expect = 5.160e-11
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = -2
Query:  125 KEPAGFVVGSIEGRVGIQSMVNE----NTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYD 457
            KE  G+   SI+GRV ++   ++    N+   F F+CHR     + +   + VN I   P H  + T GSDG I+ W+ ++R ++K+     +  V    I    NI   A   D
Sbjct:  204 KEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLA--YPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVV--KIACSDNILCLATSDD 314          
BLAST of SMED30002068 vs. Ensembl Nematostella
Match: EDO47476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMB7])

HSP 1 Score: 158.688 bits (400), Expect = 1.502e-48
Identity = 71/140 (50.71%), Postives = 102/140 (72.86%), Query Frame = -2
Query:   38 EPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVV-TMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAK 454
            +P GF +GS+EGRV IQ +  E  KD+FTFKCHR+    + +Q+I+AVNDI+ HP+H+ ++ T+GSDGK ++WDK++RT+LK+ + Q   P+T    +S+G IFAYA GYDWSKGHE+ +   KPK+ +R C  +L P K
Sbjct:  198 QPVGFALGSVEGRVAIQYIQPETAKDNFTFKCHRSNG--TNVQDIYAVNDIAFHPVHHCLLSTVGSDGKFSFWDKDARTKLKTSE-QLNLPITACCFNSQGTIFAYAAGYDWSKGHEYFNPQTKPKILLRSCTDELKPRK 334          
BLAST of SMED30002068 vs. Ensembl Nematostella
Match: EDO43356 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP7])

HSP 1 Score: 63.5438 bits (153), Expect = 1.117e-12
Identity = 34/79 (43.04%), Postives = 46/79 (58.23%), Query Frame = -2
Query:  215 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRL 445
            G+V+ SIEGRV ++      E  K  F FKCHRT      I++I+ VN I+ H +H T  T GSDG +  WD  ++ RL
Sbjct:  195 GYVLSSIEGRVAVEYFDPSPEVQKKKFAFKCHRTK--DKEIEQIYPVNAIAFHNMHNTFATGGSDGFVNIWDGFNKKRL 271          
BLAST of SMED30002068 vs. Ensembl Medaka
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:101160646])

HSP 1 Score: 147.132 bits (370), Expect = 2.346e-43
Identity = 70/139 (50.36%), Postives = 99/139 (71.22%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +  +N  KD+FTFKCHR+    T+T Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T    ++ GNIFAYA  YDWSKGHE+ +  KK  +F+R    +L P
Sbjct:  220 KPTGFALGSIEGRVAIHYINPQNPAKDNFTFKCHRSNGTNTTTPQDIYAVNAIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACCFNNNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAEELKP 357          
BLAST of SMED30002068 vs. Ensembl Medaka
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:101160646])

HSP 1 Score: 147.132 bits (370), Expect = 2.577e-43
Identity = 70/139 (50.36%), Postives = 99/139 (71.22%), Query Frame = -2
Query:   44 EPAGFVVGSIEGRVGIQSMVNEN-TKDSFTFKCHRTTAP-TSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 454
            +P GF +GSIEGRV I  +  +N  KD+FTFKCHR+    T+T Q+I+AVN I+ HP+H T+ T+GSDG+ ++WDK++RT+LK+ + Q  QP+T    ++ GNIFAYA  YDWSKGHE+ +  KK  +F+R    +L P
Sbjct:  227 KPTGFALGSIEGRVAIHYINPQNPAKDNFTFKCHRSNGTNTTTPQDIYAVNAIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSE-QLDQPITACCFNNNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAEELKP 364          
BLAST of SMED30002068 vs. Ensembl Medaka
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:101164351])

HSP 1 Score: 65.0846 bits (157), Expect = 7.667e-13
Identity = 42/131 (32.06%), Postives = 66/131 (50.38%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR       I+ ++ VN IS H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G + A A  Y   KG   +  + +  +FIR+
Sbjct:  193 GYVLSSIEGRVAVEYLDPSQEVQKKKYAFKCHRLKE--DGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGTMLAIASSYMQEKG---DISHPEDAIFIRQ 315          
BLAST of SMED30002068 vs. Ensembl Medaka
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:101164351])

HSP 1 Score: 65.0846 bits (157), Expect = 7.667e-13
Identity = 42/131 (32.06%), Postives = 66/131 (50.38%), Query Frame = -2
Query:   65 GFVVGSIEGRVGIQSM--VNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDI--DSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRE 445
            G+V+ SIEGRV ++ +    E  K  + FKCHR       I+ ++ VN IS H +H T  T GSDG +  WD  ++ RL       + P ++  +   + G + A A  Y   KG   +  + +  +FIR+
Sbjct:  193 GYVLSSIEGRVAVEYLDPSQEVQKKKYAFKCHRLKE--DGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRLCQF---HRYPTSIASLAFSNDGTMLAIASSYMQEKG---DISHPEDAIFIRQ 315          
BLAST of SMED30002068 vs. Planmine SMEST
Match: SMESG000032008.1 (SMESG000032008.1)

HSP 1 Score: 296.204 bits (757), Expect = 1.042e-101
Identity = 140/141 (99.29%), Postives = 140/141 (99.29%), Query Frame = -2
Query:   38 TKEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAK 460
            TKEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHR TAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAK
Sbjct:  220 TKEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRITAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAK 360          
BLAST of SMED30002068 vs. Planmine SMEST
Match: SMESG000032005.1 (SMESG000032005.1)

HSP 1 Score: 196.823 bits (499), Expect = 4.272e-64
Identity = 85/136 (62.50%), Postives = 109/136 (80.15%), Query Frame = -2
Query:   44 PAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTP 451
            PAG+ +GSIEGRVGIQ + ++N KDSFTFKCHR+    +  Q+I+AVND++ HPI+ T+VT+GSDGK  YWDK++RT+LK  +  EQQPVT   ID KGN+FAYA GYDWSKG+E+ND NKKPK+FIR CN ++ P
Sbjct:  118 PAGYALGSIEGRVGIQCLASQNPKDSFTFKCHRSQVTNNNTQDIYAVNDLAFHPIYQTLVTVGSDGKYTYWDKDARTKLKGSETTEQQPVTSCAIDCKGNVFAYAYGYDWSKGYEYNDPNKKPKIFIRPCNDEMRP 253          
BLAST of SMED30002068 vs. Planmine SMEST
Match: SMESG000016111.1 (SMESG000016111.1)

HSP 1 Score: 62.3882 bits (150), Expect = 6.076e-12
Identity = 39/128 (30.47%), Postives = 59/128 (46.09%), Query Frame = -2
Query:   68 GFVVGSIEGRVGIQ--SMVNENTKDSFTFKCHRTTAPTSTIQEIFAVNDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDSKGNIFAYAMGYDWSKGHEFNDVNKKPKLFIR 445
            G+ + SIEGRV ++      E  K  + FKCHR       I+ I+ VN I+ H +  T  T G D  +  WD  +R RL  + PQ    ++     + G+  A    Y + KG        +P +F+R
Sbjct:  198 GYALASIEGRVAVEFFEQTPEQQKRKYAFKCHRMK--LDDIEFIYPVNVIAFHKVFNTFATGGCDSLVNVWDGFNRKRLVQL-PQYPTSISSLGFSNDGSTLAIGSSYTYEKGELPECEIVEPNIFVR 322          
The following BLAST results are available for this feature:
BLAST of SMED30002068 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAE13.308e-4250.36ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE13.308e-4250.36ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE13.308e-4250.36ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE13.508e-3452.17ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
BUB31.624e-1233.33BUB3 mitotic checkpoint protein [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rae-11.387e-4350.00mRNA export factor rae-1 [Source:UniProtKB/Swiss-... [more]
rae-11.387e-4350.00mRNA export factor rae-1 [Source:UniProtKB/Swiss-... [more]
bub-31.791e-931.86Mitotic checkpoint protein bub-3 [Source:UniProtK... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rae14.381e-5055.32gene:FBgn0034646 transcript:FBtr0071683[more]
CG127827.869e-2537.12gene:FBgn0034838 transcript:FBtr0072048[more]
Bub31.735e-1139.24gene:FBgn0025457 transcript:FBtr0339148[more]
Bub31.735e-1139.24gene:FBgn0025457 transcript:FBtr0085465[more]
back to top
BLAST of SMED30002068 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rae16.877e-4351.08ribonucleic acid export 1 [Source:NCBI gene;Acc:39... [more]
rae17.172e-4351.08ribonucleic acid export 1 [Source:NCBI gene;Acc:39... [more]
bub35.898e-1332.58BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:Z... [more]
bub36.320e-1332.58BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bub31.671e-1231.06BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub31.902e-1231.06BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub33.677e-1231.30BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub34.015e-1231.30BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rae13.296e-4250.36ribonucleic acid export 1 [Source:MGI Symbol;Acc:M... [more]
Bub31.054e-1233.33BUB3 mitotic checkpoint protein [Source:MGI Symbol... [more]
Bub31.197e-1233.33BUB3 mitotic checkpoint protein [Source:MGI Symbol... [more]
Bub35.124e-838.24BUB3 mitotic checkpoint protein [Source:MGI Symbol... [more]
back to top
BLAST of SMED30002068 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93454|RAE1_CAEEL1.764e-4250.00mRNA export factor rae-1 OS=Caenorhabditis elegans... [more]
sp|Q7ZWF0|RAE1L_DANRE5.191e-4251.08mRNA export factor OS=Danio rerio OX=7955 GN=rae1 ... [more]
sp|Q3SWS8|RAE1L_RAT9.837e-4251.08mRNA export factor OS=Rattus norvegicus OX=10116 G... [more]
sp|Q4R6D2|RAE1L_MACFA1.572e-4150.36mRNA export factor OS=Macaca fascicularis OX=9541 ... [more]
sp|Q5RF99|RAEL1_PONAB1.588e-4150.36mRNA export factor OS=Pongo abelii OX=9601 GN=RAE1... [more]
back to top
BLAST of SMED30002068 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4G9Y39.347e-4956.03GL11275 OS=Drosophila persimilis OX=7234 GN=Dper\G... [more]
A0A3B0JQZ51.287e-4856.03Blast:mRNA export factor OS=Drosophila guanche OX=... [more]
A0A1W4VRB51.939e-4754.61mRNA export factor OS=Drosophila ficusphila OX=300... [more]
A0A2H1BWE12.120e-4750.00Nucleoporin GLE2 domain protein OS=Fasciola hepati... [more]
B3MIX82.621e-4753.90WD_REPEATS_REGION domain-containing protein OS=Dro... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rae11.861e-4250.36ribonucleic acid export 1 [Source:NCBI gene;Acc:10... [more]
bub37.775e-1240.51BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007594.12.662e-4450.72pep scaffold:Pmarinus_7.0:GL477618:2658:11743:-1 g... [more]
bub31.033e-1031.82BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GLE24.764e-2642.74RNA export factor associated with the nuclear pore... [more]
BUB35.160e-1129.57Kinetochore checkpoint WD40 repeat protein; locali... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO474761.502e-4850.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433561.117e-1243.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002068 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rae12.346e-4350.36ribonucleic acid export 1 [Source:NCBI gene;Acc:10... [more]
rae12.577e-4350.36ribonucleic acid export 1 [Source:NCBI gene;Acc:10... [more]
bub37.667e-1332.06BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub37.667e-1332.06BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
back to top
BLAST of SMED30002068 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032008.11.042e-10199.29SMESG000032008.1[more]
SMESG000032005.14.272e-6462.50SMESG000032005.1[more]
SMESG000016111.16.076e-1230.47SMESG000016111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002068 ID=SMED30002068|Name=SMED30002068|organism=Schmidtea mediterranea sexual|type=transcript|length=461bp
AAAACAAATAAAATTTATTATAAATCTAAATTTCATTTTTTGCAGGTGTC
AAATCGGAATTGCATTCTCTTATAAAAAGTTTAGGTTTCTTATTCACGTC
ATTAAATTCGTGTCCTTTACTCCAGTCGTATCCCATAGCATAAGCAAATA
TGTTTCCTTTGCTATCTATATCGCCAACTGTAACCGGTTGCTGTTCTTGT
GGATCCACTGATTTCAGTCTGGTTCTTGATTCTTTATCCCAATAAGCTAT
TTTTCCATCGCTTCCCATCGTGACAACCGTGTAATGAATTGGATGAATAG
AAATGTCATTCACGGCAAAAATTTCCTGTATAGTTGATGTTGGTGCAGTA
GTTCGGTGGCATTTGAATGTGAACGAATCTTTGGTATTTTCATTCACCAT
CGACTGGATTCCTACTCTGCCTTCAATGGACCCTACCACAAATCCAGCAG
GCTCTTTTGTG
back to top

protein sequence of SMED30002068-orf-1

>SMED30002068-orf-1 ID=SMED30002068-orf-1|Name=SMED30002068-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
TKEPAGFVVGSIEGRVGIQSMVNENTKDSFTFKCHRTTAPTSTIQEIFAV
NDISIHPIHYTVVTMGSDGKIAYWDKESRTRLKSVDPQEQQPVTVGDIDS
KGNIFAYAMGYDWSKGHEFNDVNKKPKLFIRECNSDLTPAKNEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding