ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30002065
Length (bp)747
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30002065h1SMcG0008237 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002065h1SMcG0008237 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002065h1SMcG0008236 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002065h1SMcG0008236 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_89532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_89532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002065h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002065h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002065h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002065h1SMcG0008237 dd_Smed_v6_55264_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002065h1SMcG0008237 dd_Smed_v6_55117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30002065h1SMcG0008237 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002065h1SMcG0008237 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002065h1SMcG0008236 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002065h1SMcG0008236 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 53.1434 bits (126), Expect = 5.641e-13
Identity = 56/212 (26.42%), Postives = 101/212 (47.64%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  ++  GH D
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLSAREGHED 529          

HSP 2 Score: 39.6614 bits (91), Expect = 5.641e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHV 587          

HSP 3 Score: 45.0542 bits (105), Expect = 2.232e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHM 323          

HSP 4 Score: 39.2762 bits (90), Expect = 2.232e-10
Identity = 46/167 (27.54%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   VK +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   72 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDNNADVESKS-GFTPLHIAAHYGNINV 233          

HSP 5 Score: 39.2762 bits (90), Expect = 3.561e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 257          

HSP 6 Score: 37.3502 bits (85), Expect = 3.561e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G ++N   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 7 Score: 50.447 bits (119), Expect = 1.824e-6
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 389          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 53.1434 bits (126), Expect = 6.021e-13
Identity = 56/212 (26.42%), Postives = 101/212 (47.64%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  ++  GH D
Sbjct:  342 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLSAREGHED 540          

HSP 2 Score: 39.6614 bits (91), Expect = 6.021e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  545 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHV 598          

HSP 3 Score: 45.0542 bits (105), Expect = 2.161e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  281 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHM 334          

HSP 4 Score: 39.2762 bits (90), Expect = 2.161e-10
Identity = 46/167 (27.54%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   VK +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   83 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDNNADVESKS-GFTPLHIAAHYGNINV 244          

HSP 5 Score: 39.2762 bits (90), Expect = 3.799e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  215 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 268          

HSP 6 Score: 37.3502 bits (85), Expect = 3.799e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G ++N   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   55 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 183          

HSP 7 Score: 50.447 bits (119), Expect = 1.807e-6
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  343 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 400          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 51.9878 bits (123), Expect = 8.509e-13
Identity = 56/211 (26.54%), Postives = 100/211 (47.39%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  ++  GH D
Sbjct:  349 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKD-DQTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLSAREGHED 546          

HSP 2 Score: 40.4318 bits (93), Expect = 8.509e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  551 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHV 604          

HSP 3 Score: 45.4394 bits (106), Expect = 6.305e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  287 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHM 340          

HSP 4 Score: 36.965 bits (84), Expect = 6.305e-10
Identity = 46/167 (27.54%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   VK +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   89 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDNNADVESKS-GFTPLHIAAHYGNINV 250          

HSP 5 Score: 40.0466 bits (92), Expect = 6.933e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  221 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 274          

HSP 6 Score: 35.8094 bits (81), Expect = 6.933e-8
Identity = 38/149 (25.50%), Postives = 74/149 (49.66%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G ++N   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA+   +         +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   61 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAAQENHL---------EVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 189          

HSP 7 Score: 51.2174 bits (121), Expect = 1.076e-6
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  349 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 406          

HSP 8 Score: 48.1358 bits (113), Expect = 9.020e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVL+   + V+A++K G TPLH+
Sbjct:  683 LLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHV 736          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 52.373 bits (124), Expect = 1.729e-11
Identity = 53/192 (27.60%), Postives = 95/192 (49.48%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            C++ LL+  A V+D      T LH+ +  G+  + KLLLD++A+P ++   G +ALH A +    A   E++  L RN +      L++ +  E +T +H A++L          + +I+++LL++       T + G TPLH  A  G  DV   ++   +     +   K G++PL  A+  G  D  ++
Sbjct:  318 CVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHMAAR----AGQVEVVRCLLRNGA------LVDARAREEQTPLHIASRL---------GKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQVDVASVLL---EAGAAHSLATKKGFTPLHVAAKYGSLDVAKL 486          

HSP 2 Score: 35.4242 bits (80), Expect = 1.729e-11
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL   +  +A +K G TPLH+
Sbjct:  487 LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHI 540          

HSP 3 Score: 37.7354 bits (86), Expect = 1.030e-7
Identity = 49/211 (23.22%), Postives = 94/211 (44.55%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE-------------FLTRNHSTTKAKNLI------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             ++ L+K GAN+N + + G T L++ ++  ++D++K LL+  A+  +   +G + L  A++  H   V  +LE                R   T  A  L+      ++++  G T +H AA               +  +LL  G  +   T   G TPLH  +  GN++++  ++       Q + + ++G +PL  A+  GH   V +
Sbjct:   91 VVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHY---------GNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLL---DRGGQIDAKTRDGLTPLHCAARSGHDQVVEL 288          

HSP 4 Score: 36.965 bits (84), Expect = 1.030e-7
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  572 CCPNILQNNARID-VFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  ++LQ+ A +D V  D+ +TALH+AA  GH  V ++LL  ++  NA++  G T LH+
Sbjct:  318 CVKHLLQHKAPVDDVTLDY-LTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHM 375          

HSP 5 Score: 40.4318 bits (93), Expect = 4.226e-7
Identity = 22/54 (40.74%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++ G+TPLH+
Sbjct:  190 LLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHV 243          

HSP 6 Score: 32.3426 bits (72), Expect = 4.226e-7
Identity = 35/129 (27.13%), Postives = 63/129 (48.84%), Query Frame = 3
Query:  270 INLKNNEGETAVHFAAKL--VQMKQEL---------------------SIS-EAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            IN  N  G  A+H AAK   V + QEL                     S++ +A+++K+L++ G ++   +++ G TPL+  A   + DV+  ++   +N    +   ++G++PL  A   GH+ AV I
Sbjct:   36 INTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQN-GFTPLYMAAQENHIDVVKYLL---ENGANQSTATEDGFTPLAVALQQGHNQAVAI 160          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 44.669 bits (104), Expect = 5.452e-10
Identity = 23/58 (39.66%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  ++LQ+ A +D      +TALH+AA  GH  V ++LL  ++  NA++  G TPLH+
Sbjct:  326 CVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHI 383          

HSP 2 Score: 38.1206 bits (87), Expect = 5.452e-10
Identity = 49/219 (22.37%), Postives = 95/219 (43.38%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE--------------------------FLTRNH-STTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             ++ L+K GAN+N + + G T L++ ++  ++D++K LL+  A+  +   +G + L  A++  H   V  +LE                           L  +H +  ++K ++N     G T +H AA               +  +LL  G  +   T   G TPLH  +  GN++++  ++       Q + + ++G +PL  A+  GH   V +
Sbjct:   91 VVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHY---------GNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLL---DRGGQIDAKTRDGLTPLHCAARSGHDQVVEL 296          

HSP 3 Score: 43.5134 bits (101), Expect = 4.105e-9
Identity = 45/154 (29.22%), Postives = 75/154 (48.70%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            C++ LL+  A V+D      T LH+ +  G+  + KLLLD++A+P ++   G + LH A K        +++E L +  ++ +A          G T +H AA +  +          I+ +LL+NG     VT   GET LH  A +G  +V+
Sbjct:  326 CVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRI----KVMELLVKYGASIQA------ITESGLTPIHVAAFMGHLN---------IVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVV 459          

HSP 4 Score: 36.5798 bits (83), Expect = 4.105e-9
Identity = 18/54 (33.33%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A +D       T LH+A+  G   + ++LL H +  +A +  G TPLH+
Sbjct:  462 LLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHI 515          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 87.0409 bits (214), Expect = 7.442e-33
Identity = 71/189 (37.57%), Postives = 107/189 (56.61%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGH 566
            C   LLKSG   +     GET LHI +R GN DI++LLLDE AD       G + L  A K  +F     IL+ L+   +  + K  +N + N+G TA+H+AA++ Q +      +A+++ +L++ GG +++ + +  ET +H  A SGN  VL+ +V        +I  NKQ+KNGWSPLL A + GH
Sbjct:  711 CAMMLLKSGGQPDVAQMDGETCLHIAARSGNKDIMRLLLDENADSKISSKIGETPLQVAAKSCNFEAASMILKHLSEVLTQEQLKEHVNHRTNDGFTALHYAAEIEQRQLHFPGEDAKLVNLLIDYGGMVEMPSLNANETAMHMAARSGNQAVLLAMVNKIGAGAVQIVQNKQSKNGWSPLLEACARGH 899          

HSP 2 Score: 72.0182 bits (175), Expect = 7.442e-33
Identity = 33/54 (61.11%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+++ARIDVFD+ G TALHLAA  GH  +  +LL HK+FVN+KSK G  PLHL
Sbjct:  906 LLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHL 959          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 45.8246 bits (107), Expect = 1.198e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A        G T LH+AA+K    +A  LL  K+  NAKS+ G TPLHL
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL 662          

HSP 2 Score: 41.2022 bits (95), Expect = 1.198e-11
Identity = 48/192 (25.00%), Postives = 89/192 (46.35%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +E LLK  A +    ++G T LH+ + +G ++I+  LL + A+P  +   G + LH A +    A   +++  L RN +       ++ +  E +T +H A++L             I+ +LL+ G +    T+    +PLH  A  G  +V   ++    +        K G++PL  AS  G+ + VR+
Sbjct:  407 VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAAR----ANQTDVVRVLIRNGAK------VDAQARELQTPLHIASRL---------GNTDIVILLLQAGANSNATTRDN-YSPLHIAAKEGQEEVAGILL---DHNADKTLLTKKGFTPLHLASKYGNLEVVRL 575          

HSP 3 Score: 43.8986 bits (102), Expect = 1.387e-11
Identity = 48/182 (26.37%), Postives = 85/182 (46.70%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            LL++GAN N   +   + LHI ++ G  ++  +LLD  AD      +G + LH A K+ +   V+ +LE  T           ++++     T +H AA           +  ++  +LLENG   K   K+ G TPLH  A     ++   ++   + K   N +++ G++PL  ++  GH
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP----------VDIEGKNQVTPLHVAAHY---------NNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLL---QFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 4 Score: 43.1282 bits (100), Expect = 1.387e-11
Identity = 18/54 (33.33%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +++N + +    + G+TA+HL A++ H  VA++L  + + +N+K+  G TPLH+
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 5 Score: 43.1282 bits (100), Expect = 2.115e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN    DV    G T LH+AA  GH  V ++LL   + VN +++  ++PLH+
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHV 266          

HSP 6 Score: 33.113 bits (74), Expect = 2.115e-8
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LL++G ++N     G   LH+ S+ G+ ++++ L+  +A   +   +GN+ALH A      A    I+  L  N +       +N+++  G T ++ AA      QE   +  +++K LL++G +  + T+  G TPL      G+  V+
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGAN------VNVQSVNGFTPLYMAA------QE---NHEEVVKYLLKHGANQALSTED-GFTPLAVALQQGHDRVV 181          

HSP 7 Score: 46.9802 bits (110), Expect = 9.137e-6
Identity = 52/183 (28.42%), Postives = 90/183 (49.18%), Query Frame = 3
Query:   18 TLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            TLL+  A+ N K + G T LH+ ++ G+ +I  LL++  +D  ++ N G +A+H   +  H      + + L  N +       IN K N G T +H A    Q+          ++K L+ENG D+   T+++  TPLH  A  G+++ +  ++   +N    N+Q   G +PL  A   G+
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVP----VAQILYNNGAE------INSKTNAGYTPLHVACHFGQLN---------MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGY 800          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 45.8246 bits (107), Expect = 1.198e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A        G T LH+AA+K    +A  LL  K+  NAKS+ G TPLHL
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL 662          

HSP 2 Score: 41.2022 bits (95), Expect = 1.198e-11
Identity = 48/192 (25.00%), Postives = 89/192 (46.35%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +E LLK  A +    ++G T LH+ + +G ++I+  LL + A+P  +   G + LH A +    A   +++  L RN +       ++ +  E +T +H A++L             I+ +LL+ G +    T+    +PLH  A  G  +V   ++    +        K G++PL  AS  G+ + VR+
Sbjct:  407 VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAAR----ANQTDVVRVLIRNGAK------VDAQARELQTPLHIASRL---------GNTDIVILLLQAGANSNATTRDN-YSPLHIAAKEGQEEVAGILL---DHNADKTLLTKKGFTPLHLASKYGNLEVVRL 575          

HSP 3 Score: 43.8986 bits (102), Expect = 1.387e-11
Identity = 48/182 (26.37%), Postives = 85/182 (46.70%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            LL++GAN N   +   + LHI ++ G  ++  +LLD  AD      +G + LH A K+ +   V+ +LE  T           ++++     T +H AA           +  ++  +LLENG   K   K+ G TPLH  A     ++   ++   + K   N +++ G++PL  ++  GH
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP----------VDIEGKNQVTPLHVAAHY---------NNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLL---QFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 4 Score: 43.1282 bits (100), Expect = 1.387e-11
Identity = 18/54 (33.33%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +++N + +    + G+TA+HL A++ H  VA++L  + + +N+K+  G TPLH+
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 5 Score: 43.1282 bits (100), Expect = 2.115e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN    DV    G T LH+AA  GH  V ++LL   + VN +++  ++PLH+
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHV 266          

HSP 6 Score: 33.113 bits (74), Expect = 2.115e-8
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LL++G ++N     G   LH+ S+ G+ ++++ L+  +A   +   +GN+ALH A      A    I+  L  N +       +N+++  G T ++ AA      QE   +  +++K LL++G +  + T+  G TPL      G+  V+
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGAN------VNVQSVNGFTPLYMAA------QE---NHEEVVKYLLKHGANQALSTED-GFTPLAVALQQGHDRVV 181          

HSP 7 Score: 46.9802 bits (110), Expect = 9.137e-6
Identity = 52/183 (28.42%), Postives = 90/183 (49.18%), Query Frame = 3
Query:   18 TLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            TLL+  A+ N K + G T LH+ ++ G+ +I  LL++  +D  ++ N G +A+H   +  H      + + L  N +       IN K N G T +H A    Q+          ++K L+ENG D+   T+++  TPLH  A  G+++ +  ++   +N    N+Q   G +PL  A   G+
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVP----VAQILYNNGAE------INSKTNAGYTPLHVACHFGQLN---------MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGY 800          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 45.8246 bits (107), Expect = 1.228e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A        G T LH+AA+K    +A  LL  K+  NAKS+ G TPLHL
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL 662          

HSP 2 Score: 41.5874 bits (96), Expect = 1.228e-11
Identity = 48/192 (25.00%), Postives = 89/192 (46.35%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +E LLK  A +    ++G T LH+ + +G ++I+  LL + A+P  +   G + LH A +    A   +++  L RN +       ++ +  E +T +H A++L             I+ +LL+ G +    T+    +PLH  A  G  +V   ++    +        K G++PL  AS  G+ + VR+
Sbjct:  407 VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAAR----ANQTDVVRVLIRNGAK------VDAQARELQTPLHIASRL---------GNTDIVILLLQAGANSNATTRDN-YSPLHIAAKEGQEEVAGILL---DHNADKTLLTKKGFTPLHLASKYGNLEVVRL 575          

HSP 3 Score: 43.8986 bits (102), Expect = 1.505e-11
Identity = 48/182 (26.37%), Postives = 85/182 (46.70%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            LL++GAN N   +   + LHI ++ G  ++  +LLD  AD      +G + LH A K+ +   V+ +LE  T           ++++     T +H AA           +  ++  +LLENG   K   K+ G TPLH  A     ++   ++   + K   N +++ G++PL  ++  GH
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP----------VDIEGKNQVTPLHVAAHY---------NNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLL---QFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 4 Score: 43.1282 bits (100), Expect = 1.505e-11
Identity = 18/54 (33.33%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +++N + +    + G+TA+HL A++ H  VA++L  + + +N+K+  G TPLH+
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 5 Score: 42.743 bits (99), Expect = 2.168e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN    DV    G T LH+AA  GH  V ++LL   + VN +++  ++PLH+
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHV 266          

HSP 6 Score: 33.113 bits (74), Expect = 2.168e-8
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LL++G ++N     G   LH+ S+ G+ ++++ L+  +A   +   +GN+ALH A      A    I+  L  N +       +N+++  G T ++ AA      QE   +  +++K LL++G +  + T+  G TPL      G+  V+
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGAN------VNVQSVNGFTPLYMAA------QE---NHEEVVKYLLKHGANQALSTED-GFTPLAVALQQGHDRVV 181          

HSP 7 Score: 46.9802 bits (110), Expect = 8.723e-6
Identity = 52/183 (28.42%), Postives = 90/183 (49.18%), Query Frame = 3
Query:   18 TLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            TLL+  A+ N K + G T LH+ ++ G+ +I  LL++  +D  ++ N G +A+H   +  H      + + L  N +       IN K N G T +H A    Q+          ++K L+ENG D+   T+++  TPLH  A  G+++ +  ++   +N    N+Q   G +PL  A   G+
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVP----VAQILYNNGAE------INSKTNAGYTPLHVACHFGQLN---------MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGY 800          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 45.8246 bits (107), Expect = 1.228e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A        G T LH+AA+K    +A  LL  K+  NAKS+ G TPLHL
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL 662          

HSP 2 Score: 41.5874 bits (96), Expect = 1.228e-11
Identity = 48/192 (25.00%), Postives = 89/192 (46.35%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +E LLK  A +    ++G T LH+ + +G ++I+  LL + A+P  +   G + LH A +    A   +++  L RN +       ++ +  E +T +H A++L             I+ +LL+ G +    T+    +PLH  A  G  +V   ++    +        K G++PL  AS  G+ + VR+
Sbjct:  407 VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAAR----ANQTDVVRVLIRNGAK------VDAQARELQTPLHIASRL---------GNTDIVILLLQAGANSNATTRDN-YSPLHIAAKEGQEEVAGILL---DHNADKTLLTKKGFTPLHLASKYGNLEVVRL 575          

HSP 3 Score: 43.8986 bits (102), Expect = 1.505e-11
Identity = 48/182 (26.37%), Postives = 85/182 (46.70%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            LL++GAN N   +   + LHI ++ G  ++  +LLD  AD      +G + LH A K+ +   V+ +LE  T           ++++     T +H AA           +  ++  +LLENG   K   K+ G TPLH  A     ++   ++   + K   N +++ G++PL  ++  GH
Sbjct:  510 LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP----------VDIEGKNQVTPLHVAAHY---------NNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLL---QFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 4 Score: 43.1282 bits (100), Expect = 1.505e-11
Identity = 18/54 (33.33%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +++N + +    + G+TA+HL A++ H  VA++L  + + +N+K+  G TPLH+
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 5 Score: 42.743 bits (99), Expect = 2.168e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN    DV    G T LH+AA  GH  V ++LL   + VN +++  ++PLH+
Sbjct:  213 LLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHV 266          

HSP 6 Score: 33.113 bits (74), Expect = 2.168e-8
Identity = 39/150 (26.00%), Postives = 74/150 (49.33%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LL++G ++N     G   LH+ S+ G+ ++++ L+  +A   +   +GN+ALH A      A    I+  L  N +       +N+++  G T ++ AA      QE   +  +++K LL++G +  + T+  G TPL      G+  V+
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGAN------VNVQSVNGFTPLYMAA------QE---NHEEVVKYLLKHGANQALSTED-GFTPLAVALQQGHDRVV 181          

HSP 7 Score: 46.9802 bits (110), Expect = 8.723e-6
Identity = 52/183 (28.42%), Postives = 90/183 (49.18%), Query Frame = 3
Query:   18 TLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            TLL+  A+ N K + G T LH+ ++ G+ +I  LL++  +D  ++ N G +A+H   +  H      + + L  N +       IN K N G T +H A    Q+          ++K L+ENG D+   T+++  TPLH  A  G+++ +  ++   +N    N+Q   G +PL  A   G+
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVP----VAQILYNNGAE------INSKTNAGYTPLHVACHFGQLN---------MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGY 800          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347408)

HSP 1 Score: 115.546 bits (288), Expect = 6.468e-30
Identity = 72/195 (36.92%), Postives = 112/195 (57.44%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C   LLKSGA+ N       T +H+ +R GNL  L  LL+++ DP  + N G + LH A +  H   V+ ++E +   H   KA   IN  N +G TA+H+  ++ + + ++  S+ QI+++LLENG D+ + TK+  ET  HYCA +GN+DVLME++        +   N+Q+  GW+PLL A   GH + V
Sbjct:  482 DRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELV 676          

HSP 2 Score: 33.4982 bits (75), Expect = 6.468e-30
Identity = 22/58 (37.93%), Postives = 30/58 (51.72%), Query Frame = 2
Query:  575 CPNILQNNARIDVFDDFGMTALHLAAEKGH-RLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  +L N A I+     G TALHLAA  G   LV  ++  H + ++  +    TPLHL
Sbjct:  709 CDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHL 766          

HSP 3 Score: 70.4774 bits (171), Expect = 1.664e-13
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  506 NKQTSKEWLVTFIICK*LWTS*CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            N+Q+S  W    I C          N+L N+AR+DVFD  G +ALHLAAE+G+  V + LL +K+F+N+KS+ G T LHL
Sbjct:  654 NRQSSVGWTPLLIACHRGHME-LVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHL 732          

HSP 4 Score: 40.817 bits (94), Expect = 1.407e-6
Identity = 19/42 (45.24%), Postives = 25/42 (59.52%), Query Frame = 2
Query:  617 DDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            D  G T LH+AA  GH  + E+LL   + +NA  + G TPLH
Sbjct: 1041 DRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          

HSP 5 Score: 29.6462 bits (65), Expect = 1.407e-6
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  147 SQCNE----GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNE-GETAVHFAAKLVQMK--QELSISEAQIMKILLENG----GDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C E    G +A+H A ++ H     ++L+ L       K+ N + + + + G T +H AA   Q    +EL  S    +K     G    GD+      +G TPLH  A SGN +V+  ++ N           +NG++PL  A   GH   V
Sbjct:  887 ASCTEENKAGFTAVHLAAQNGH----GQVLDVL-------KSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLG---TESGMTPLHLAAFSGNENVV-RLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVV 1026          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347409)

HSP 1 Score: 115.546 bits (288), Expect = 6.966e-30
Identity = 72/195 (36.92%), Postives = 112/195 (57.44%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C   LLKSGA+ N       T +H+ +R GNL  L  LL+++ DP  + N G + LH A +  H   V+ ++E +   H   KA   IN  N +G TA+H+  ++ + + ++  S+ QI+++LLENG D+ + TK+  ET  HYCA +GN+DVLME++        +   N+Q+  GW+PLL A   GH + V
Sbjct:  482 DRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELV 676          

HSP 2 Score: 33.4982 bits (75), Expect = 6.966e-30
Identity = 22/58 (37.93%), Postives = 30/58 (51.72%), Query Frame = 2
Query:  575 CPNILQNNARIDVFDDFGMTALHLAAEKGH-RLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  +L N A I+     G TALHLAA  G   LV  ++  H + ++  +    TPLHL
Sbjct:  709 CDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHL 766          

HSP 3 Score: 70.4774 bits (171), Expect = 1.665e-13
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  506 NKQTSKEWLVTFIICK*LWTS*CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            N+Q+S  W    I C          N+L N+AR+DVFD  G +ALHLAAE+G+  V + LL +K+F+N+KS+ G T LHL
Sbjct:  654 NRQSSVGWTPLLIACHRGHME-LVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHL 732          

HSP 4 Score: 40.817 bits (94), Expect = 1.453e-6
Identity = 19/42 (45.24%), Postives = 25/42 (59.52%), Query Frame = 2
Query:  617 DDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            D  G T LH+AA  GH  + E+LL   + +NA  + G TPLH
Sbjct: 1041 DRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          

HSP 5 Score: 29.6462 bits (65), Expect = 1.453e-6
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  147 SQCNE----GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNE-GETAVHFAAKLVQMK--QELSISEAQIMKILLENG----GDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C E    G +A+H A ++ H     ++L+ L       K+ N + + + + G T +H AA   Q    +EL  S    +K     G    GD+      +G TPLH  A SGN +V+  ++ N           +NG++PL  A   GH   V
Sbjct:  887 ASCTEENKAGFTAVHLAAQNGH----GQVLDVL-------KSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLG---TESGMTPLHLAAFSGNENVV-RLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVV 1026          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0343224)

HSP 1 Score: 115.546 bits (288), Expect = 7.442e-30
Identity = 72/195 (36.92%), Postives = 112/195 (57.44%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C   LLKSGA+ N       T +H+ +R GNL  L  LL+++ DP  + N G + LH A +  H   V+ ++E +   H   KA   IN  N +G TA+H+  ++ + + ++  S+ QI+++LLENG D+ + TK+  ET  HYCA +GN+DVLME++        +   N+Q+  GW+PLL A   GH + V
Sbjct:  482 DRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELV 676          

HSP 2 Score: 33.4982 bits (75), Expect = 7.442e-30
Identity = 22/58 (37.93%), Postives = 30/58 (51.72%), Query Frame = 2
Query:  575 CPNILQNNARIDVFDDFGMTALHLAAEKGH-RLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  +L N A I+     G TALHLAA  G   LV  ++  H + ++  +    TPLHL
Sbjct:  709 CDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHL 766          

HSP 3 Score: 70.4774 bits (171), Expect = 1.809e-13
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  506 NKQTSKEWLVTFIICK*LWTS*CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            N+Q+S  W    I C          N+L N+AR+DVFD  G +ALHLAAE+G+  V + LL +K+F+N+KS+ G T LHL
Sbjct:  654 NRQSSVGWTPLLIACHRGHME-LVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHL 732          

HSP 4 Score: 40.4318 bits (93), Expect = 1.550e-6
Identity = 19/42 (45.24%), Postives = 25/42 (59.52%), Query Frame = 2
Query:  617 DDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            D  G T LH+AA  GH  + E+LL   + +NA  + G TPLH
Sbjct: 1041 DRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          

HSP 5 Score: 29.6462 bits (65), Expect = 1.550e-6
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  147 SQCNE----GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNE-GETAVHFAAKLVQMK--QELSISEAQIMKILLENG----GDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C E    G +A+H A ++ H     ++L+ L       K+ N + + + + G T +H AA   Q    +EL  S    +K     G    GD+      +G TPLH  A SGN +V+  ++ N           +NG++PL  A   GH   V
Sbjct:  887 ASCTEENKAGFTAVHLAAQNGH----GQVLDVL-------KSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLG---TESGMTPLHLAAFSGNENVV-RLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVV 1026          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0304843)

HSP 1 Score: 115.546 bits (288), Expect = 4.306e-29
Identity = 72/195 (36.92%), Postives = 112/195 (57.44%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C   LLKSGA+ N       T +H+ +R GNL  L  LL+++ DP  + N G + LH A +  H   V+ ++E +   H   KA   IN  N +G TA+H+  ++ + + ++  S+ QI+++LLENG D+ + TK+  ET  HYCA +GN+DVLME++        +   N+Q+  GW+PLL A   GH + V
Sbjct:  482 DRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELV 676          

HSP 2 Score: 31.187 bits (69), Expect = 4.306e-29
Identity = 22/59 (37.29%), Postives = 30/59 (50.85%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGH-RLVAEVLLAHKSFVNAKSKCGLTPLHL 745
             C  +L N A I+     G TALHLAA  G   LV  ++  H + ++  +    TPLHL
Sbjct:  708 VCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHL 766          

HSP 3 Score: 69.707 bits (169), Expect = 3.230e-13
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  506 NKQTSKEWLVTFIICK*LWTS*CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            N+Q+S  W    I C          N+L N+AR+DVFD  G +ALHLAAE+G+  V + LL +K+F+N+KS+ G T LHL
Sbjct:  654 NRQSSVGWTPLLIACHRGHME-LVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHL 732          

HSP 4 Score: 40.4318 bits (93), Expect = 1.942e-6
Identity = 19/42 (45.24%), Postives = 25/42 (59.52%), Query Frame = 2
Query:  617 DDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            D  G T LH+AA  GH  + E+LL   + +NA  + G TPLH
Sbjct: 1041 DRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          

HSP 5 Score: 29.6462 bits (65), Expect = 1.942e-6
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  147 SQCNE----GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNE-GETAVHFAAKLVQMK--QELSISEAQIMKILLENG----GDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C E    G +A+H A ++ H     ++L+ L       K+ N + + + + G T +H AA   Q    +EL  S    +K     G    GD+      +G TPLH  A SGN +V+  ++ N           +NG++PL  A   GH   V
Sbjct:  887 ASCTEENKAGFTAVHLAAQNGH----GQVLDVL-------KSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLG---TESGMTPLHLAAFSGNENVV-RLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVV 1026          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0300012)

HSP 1 Score: 115.546 bits (288), Expect = 4.873e-29
Identity = 72/195 (36.92%), Postives = 112/195 (57.44%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C   LLKSGA+ N       T +H+ +R GNL  L  LL+++ DP  + N G + LH A +  H   V+ ++E +   H   KA   IN  N +G TA+H+  ++ + + ++  S+ QI+++LLENG D+ + TK+  ET  HYCA +GN+DVLME++        +   N+Q+  GW+PLL A   GH + V
Sbjct:  482 DRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELV 676          

HSP 2 Score: 30.8018 bits (68), Expect = 4.873e-29
Identity = 22/59 (37.29%), Postives = 30/59 (50.85%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGH-RLVAEVLLAHKSFVNAKSKCGLTPLHL 745
             C  +L N A I+     G TALHLAA  G   LV  ++  H + ++  +    TPLHL
Sbjct:  708 VCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHL 766          

HSP 3 Score: 69.3218 bits (168), Expect = 3.680e-13
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  506 NKQTSKEWLVTFIICK*LWTS*CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            N+Q+S  W    I C          N+L N+AR+DVFD  G +ALHLAAE+G+  V + LL +K+F+N+KS+ G T LHL
Sbjct:  654 NRQSSVGWTPLLIACHRGHME-LVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHL 732          

HSP 4 Score: 40.0466 bits (92), Expect = 2.021e-6
Identity = 19/42 (45.24%), Postives = 25/42 (59.52%), Query Frame = 2
Query:  617 DDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            D  G T LH+AA  GH  + E+LL   + +NA  + G TPLH
Sbjct: 1041 DRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          

HSP 5 Score: 29.6462 bits (65), Expect = 2.021e-6
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  147 SQCNE----GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNE-GETAVHFAAKLVQMK--QELSISEAQIMKILLENG----GDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            + C E    G +A+H A ++ H     ++L+ L       K+ N + + + + G T +H AA   Q    +EL  S    +K     G    GD+      +G TPLH  A SGN +V+  ++ N           +NG++PL  A   GH   V
Sbjct:  887 ASCTEENKAGFTAVHLAAQNGH----GQVLDVL-------KSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLG---TESGMTPLHLAAFSGNENVV-RLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVV 1026          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 48.521 bits (114), Expect = 6.751e-12
Identity = 50/216 (23.15%), Postives = 101/216 (46.76%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+  A V+D      T LH+ +  G+  + K+++D+KA+P ++   G + LH A K        +++E L ++ ++ +A                 +N++          N  N  GETA+H AA+  Q+          +++ LL+NG  + I  K   +T LH  +  G  +++ +++   +     N    +G++PL  ++  GH +
Sbjct:  349 NCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRV----KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQI---------DVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKLEIVQQLL---QKGALPNAATTSGYTPLHLSAREGHQE 547          

HSP 2 Score: 40.4318 bits (93), Expect = 6.751e-12
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  + +      G T LH+AA+ G   VA +LL  K+  +A  K GLTPLH+
Sbjct:  552 LLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHV 605          

HSP 3 Score: 42.743 bits (99), Expect = 1.134e-10
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LLK GANV+   K G T LHI S  G  ++++ L+   A+  +Q   G + L+ A +  H   V+ +LE        T +  T  A  L          L  N+ +  V   A  +  +++ + S A    +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   90 VVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAA----LLLQNDHNADVESKS-GFTPLHIAAHYGNINV 251          

HSP 4 Score: 41.9726 bits (97), Expect = 1.134e-10
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   ++I+     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  288 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHM 341          

HSP 5 Score: 39.6614 bits (91), Expect = 6.395e-8
Identity = 45/155 (29.03%), Postives = 70/155 (45.16%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            E+ ++ L   GA+ N     GET LH+ +R G +D+++ LL   A    +  +  +ALH A +      V+++L+             L N     G T +H +A+  +  QE       I  +LLE G  +   TK  G TPLH  A  G  +V
Sbjct:  447 ENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ----------KGALPNAATTSGYTPLHLSAR--EGHQE-------IAALLLEQGSSLSAATKK-GFTPLHVAAKYGQLEV 581          

HSP 6 Score: 35.4242 bits (80), Expect = 6.395e-8
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL   +  ++ +K G TPLH+
Sbjct:  585 LLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHI 638          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 48.1358 bits (113), Expect = 7.032e-12
Identity = 50/216 (23.15%), Postives = 101/216 (46.76%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+  A V+D      T LH+ +  G+  + K+++D+KA+P ++   G + LH A K        +++E L ++ ++ +A                 +N++          N  N  GETA+H AA+  Q+          +++ LL+NG  + I  K   +T LH  +  G  +++ +++   +     N    +G++PL  ++  GH +
Sbjct:  349 NCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRV----KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQI---------DVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKLEIVQQLL---QKGALPNAATTSGYTPLHLSAREGHQE 547          

HSP 2 Score: 40.4318 bits (93), Expect = 7.032e-12
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  + +      G T LH+AA+ G   VA +LL  K+  +A  K GLTPLH+
Sbjct:  552 LLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHV 605          

HSP 3 Score: 42.3578 bits (98), Expect = 1.125e-10
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LLK GANV+   K G T LHI S  G  ++++ L+   A+  +Q   G + L+ A +  H   V+ +LE        T +  T  A  L          L  N+ +  V   A  +  +++ + S A    +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   90 VVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAA----LLLQNDHNADVESKS-GFTPLHIAAHYGNINV 251          

HSP 4 Score: 41.9726 bits (97), Expect = 1.125e-10
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   ++I+     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  288 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHM 341          

HSP 5 Score: 39.6614 bits (91), Expect = 5.995e-8
Identity = 45/155 (29.03%), Postives = 70/155 (45.16%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            E+ ++ L   GA+ N     GET LH+ +R G +D+++ LL   A    +  +  +ALH A +      V+++L+             L N     G T +H +A+  +  QE       I  +LLE G  +   TK  G TPLH  A  G  +V
Sbjct:  447 ENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ----------KGALPNAATTSGYTPLHLSAR--EGHQE-------IAALLLEQGSSLSAATKK-GFTPLHVAAKYGQLEV 581          

HSP 6 Score: 35.8094 bits (81), Expect = 5.995e-8
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL   +  ++ +K G TPLH+
Sbjct:  585 LLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHI 638          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 48.1358 bits (113), Expect = 7.032e-12
Identity = 50/216 (23.15%), Postives = 101/216 (46.76%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+  A V+D      T LH+ +  G+  + K+++D+KA+P ++   G + LH A K        +++E L ++ ++ +A                 +N++          N  N  GETA+H AA+  Q+          +++ LL+NG  + I  K   +T LH  +  G  +++ +++   +     N    +G++PL  ++  GH +
Sbjct:  349 NCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRV----KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQI---------DVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKLEIVQQLL---QKGALPNAATTSGYTPLHLSAREGHQE 547          

HSP 2 Score: 40.4318 bits (93), Expect = 7.032e-12
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  + +      G T LH+AA+ G   VA +LL  K+  +A  K GLTPLH+
Sbjct:  552 LLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHV 605          

HSP 3 Score: 42.3578 bits (98), Expect = 1.125e-10
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LLK GANV+   K G T LHI S  G  ++++ L+   A+  +Q   G + L+ A +  H   V+ +LE        T +  T  A  L          L  N+ +  V   A  +  +++ + S A    +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   90 VVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAA----LLLQNDHNADVESKS-GFTPLHIAAHYGNINV 251          

HSP 4 Score: 41.9726 bits (97), Expect = 1.125e-10
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   ++I+     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  288 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHM 341          

HSP 5 Score: 39.6614 bits (91), Expect = 5.995e-8
Identity = 45/155 (29.03%), Postives = 70/155 (45.16%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            E+ ++ L   GA+ N     GET LH+ +R G +D+++ LL   A    +  +  +ALH A +      V+++L+             L N     G T +H +A+  +  QE       I  +LLE G  +   TK  G TPLH  A  G  +V
Sbjct:  447 ENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ----------KGALPNAATTSGYTPLHLSAR--EGHQE-------IAALLLEQGSSLSAATKK-GFTPLHVAAKYGQLEV 581          

HSP 6 Score: 35.8094 bits (81), Expect = 5.995e-8
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL   +  ++ +K G TPLH+
Sbjct:  585 LLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHI 638          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 46.595 bits (109), Expect = 1.276e-11
Identity = 50/215 (23.26%), Postives = 100/215 (46.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            C++ LL+  A V+D      T LH+ +  G+  + K+++D+KA+P ++   G + LH A K        +++E L ++ ++ +A                 +N++          N  N  GETA+H AA+  Q+          +++ LL+NG  + I  K   +T LH  +  G  +++ +++   +     N    +G++PL  ++  GH +
Sbjct:  336 CVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRV----KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQI---------DVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKLEIVQQLL---QKGALPNAATTSGYTPLHLSAREGHQE 533          

HSP 2 Score: 41.2022 bits (95), Expect = 1.276e-11
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  + +      G T LH+AA+ G   VA +LL  K+  +A  K GLTPLH+
Sbjct:  538 LLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHV 591          

HSP 3 Score: 42.743 bits (99), Expect = 2.953e-9
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   ++I+     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  274 LLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHM 327          

HSP 4 Score: 36.965 bits (84), Expect = 2.953e-9
Identity = 48/174 (27.59%), Postives = 77/174 (44.25%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTK-------STGETPLHYCASSGNSDV 467
             +  LLK GANV+   K G T LHI S  G  ++++ L+   A+  +Q   G + L+ A +  H   V+ +LE        T +  T  A  L          L  N+ +  V   A  +  +++ + S A    +LL+N  +  + +K        +G TPLH  A  GN +V
Sbjct:   68 VVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAA----LLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINV 237          

HSP 5 Score: 38.1206 bits (87), Expect = 8.791e-8
Identity = 45/155 (29.03%), Postives = 70/155 (45.16%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            E+ ++ L   GA+ N     GET LH+ +R G +D+++ LL   A    +  +  +ALH A +      V+++L+             L N     G T +H +A+  +  QE       I  +LLE G  +   TK  G TPLH  A  G  +V
Sbjct:  433 ENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ----------KGALPNAATTSGYTPLHLSAR--EGHQE-------IAALLLEQGSSLSAATKK-GFTPLHVAAKYGQLEV 567          

HSP 6 Score: 36.5798 bits (83), Expect = 8.791e-8
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL   +  ++ +K G TPLH+
Sbjct:  571 LLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHI 624          

HSP 7 Score: 50.447 bits (119), Expect = 1.010e-6
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+NA +D   +  +TALH+AA  GH  VA+V++  K+  NAK+  G TPLH+
Sbjct:  336 CVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHI 393          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 44.2838 bits (103), Expect = 1.471e-11
Identity = 51/190 (26.84%), Postives = 90/190 (47.37%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            ++ L+ +GANVN K     T LH  +   N   + LLL + AD  ++     + LH A  +R   CV+ +L  ++           +N+ +  G   +H AA+     QE+       +K+LL  G ++    K     P+H+ A  G+ +V+  +V    +K   +K+   G++PL  A++ GH D V+
Sbjct:   57 MDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSS----------LNMADRTGRAPLHHAAQ--SGYQEM-------VKLLLNKGANLSASDKKD-RQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKR---GYTPLHAAAASGHVDVVK 223          

HSP 2 Score: 43.5134 bits (101), Expect = 1.471e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A ID  + FG TALH+A   G   VA  L+   + VN  +  G TPLHL
Sbjct:  225 LLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHL 278          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 80.4925 bits (197), Expect = 1.370e-30
Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN AR+DVFD+ G  ALHLAAE GH  +A++LL HK+FVNAK+K GLTPLHL
Sbjct:  386 LLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHL 439          

HSP 2 Score: 72.0182 bits (175), Expect = 1.370e-30
Identity = 65/194 (33.51%), Postives = 102/194 (52.58%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEF---LTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEI---VXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             LK G  ++   K G   LH  +  G++ +++ LL + A   ++  +  +ALH A +      V+ +L F   +       +   L  L  N GET +H AA + +        + +I++IL+E+ GD+   T +T ETPLHYCA  GN DVL+E+   + + + +   NKQAKNG SPLL A+  GH   V+I
Sbjct:  192 FLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQI 385          

HSP 3 Score: 40.817 bits (94), Expect = 5.667e-9
Identity = 50/203 (24.63%), Postives = 85/203 (41.87%), Query Frame = 3
Query:   15 ETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEI-------LEFLTRNHSTTKAKNLINLKNN------EGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            + LLK  A VN K K G T LH+ ++                       G + L   +   H AC+  +       L     N       +L+N+K +      EG+T +H AA+            ++++K+ L++  ++       G T  H  AS G++ V+ E++K  K    T +   N  +PL  A++ GH DAV++
Sbjct:  417 DILLKHKAFVNAKTKLGLTPLHLCAQ----------------------NGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAE---------NDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKV 588          

HSP 4 Score: 38.5058 bits (88), Expect = 5.667e-9
Identity = 23/54 (42.59%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  A     +  GMTA+HLAA+ GH  V E L    SF    +K GLT LH+
Sbjct:  589 LLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHV 642          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 80.4925 bits (197), Expect = 2.971e-30
Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN AR+DVFD+ G  ALHLAAE GH  +A++LL HK+FVNAK+K GLTPLHL
Sbjct:  474 LLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHL 527          

HSP 2 Score: 70.8626 bits (172), Expect = 2.971e-30
Identity = 65/201 (32.34%), Postives = 99/201 (49.25%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGN-----SALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEI---VXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            + +  LL+ GA+V+ + K   T LHI +      +++ LL   A    Q   G      S +H  V H +   V ++ + L                   GET +H AA + +        + +I++IL+E+ GD+   T +T ETPLHYCA  GN DVL+E+   + + + +   NKQAKNG SPLL A+  GH   V+I
Sbjct:  293 AVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQ--VQLKGGKVRYIPSPIHIPVSHSNHCLVAKVKKALA------------------GETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQI 473          

HSP 3 Score: 40.817 bits (94), Expect = 5.383e-9
Identity = 50/203 (24.63%), Postives = 85/203 (41.87%), Query Frame = 3
Query:   15 ETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEI-------LEFLTRNHSTTKAKNLINLKNN------EGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            + LLK  A VN K K G T LH+ ++                       G + L   +   H AC+  +       L     N       +L+N+K +      EG+T +H AA+            ++++K+ L++  ++       G T  H  AS G++ V+ E++K  K    T +   N  +PL  A++ GH DAV++
Sbjct:  505 DILLKHKAFVNAKTKLGLTPLHLCAQ----------------------NGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAE---------NDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKV 676          

HSP 4 Score: 38.5058 bits (88), Expect = 5.383e-9
Identity = 23/54 (42.59%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  A     +  GMTA+HLAA+ GH  V E L    SF    +K GLT LH+
Sbjct:  677 LLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHV 730          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 56.9954 bits (136), Expect = 9.111e-14
Identity = 55/220 (25.00%), Postives = 103/220 (46.82%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K        +++E L ++ ++ +A                  N++          N  N  GETA+H AA+  Q         +++++ LL+NG  ++   K   +TPLH  A  G +D++ +++   K     +    +G++PL  +S  GH D   +
Sbjct:  333 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRL----KVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQ---------SEVVRFLLQNGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---KQGAYPDAATTSGYTPLHLSSREGHDDVASV 535          

HSP 2 Score: 38.891 bits (89), Expect = 9.111e-14
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L++ A   +    G T LH+AA+ G   V ++LL   +  +A  K GLTPLH+
Sbjct:  536 LLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHV 589          

HSP 3 Score: 46.2098 bits (108), Expect = 1.843e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKL-----VQ--MKQ---------------ELSISEA--QIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
             +E LLK GA++    ++G T +H+ + +G+++I+  L    A P +    G +ALH A +    A   E++ FL +N +  +AK        + +T +H +A+L     VQ  +KQ                LS  E    +  +LLE+G    IVTK  G TPLH  A  G  +V+
Sbjct:  400 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAAR----AGQSEVVRFLLQNGAQVEAKA------KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVV 566          

HSP 4 Score: 38.1206 bits (87), Expect = 1.843e-10
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ NA  D     G+T LH+AA   ++ VA +LL   +  +  +K G TPLH+
Sbjct:  569 LLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHI 622          

HSP 5 Score: 50.8322 bits (120), Expect = 5.471e-10
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  334 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 391          

HSP 6 Score: 31.9574 bits (71), Expect = 5.471e-10
Identity = 49/209 (23.44%), Postives = 90/209 (43.06%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTR------------NHSTTKAKNLI-------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
             +  L+ +GANVN + + G T L++ ++  +L+++K LLD  A       +G + L  A++  H   V  +LE  T+                TKA  L+       ++++  G T +H AA    +           +  LL N G     T     TPLH  +  GN++++  ++       + + + ++G +PL   +  GH   V
Sbjct:  107 VVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNIN----------VATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLL---DRGSKIDAKTRDGLTPLHCGARSGHEQVV 302          

HSP 7 Score: 39.6614 bits (91), Expect = 8.607e-9
Identity = 42/149 (28.19%), Postives = 73/149 (48.99%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LK+G ++N   + G   LH+ S+ G+++I+  L+   AD  +   +GN+ALH A      A   E++  L  N +       +N ++  G T ++ AA      QE   +  +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   46 LKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA----SLAGQTEVVRVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 174          

HSP 8 Score: 39.2762 bits (90), Expect = 8.607e-9
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  206 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHV 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 56.9954 bits (136), Expect = 9.263e-14
Identity = 55/220 (25.00%), Postives = 103/220 (46.82%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K        +++E L ++ ++ +A                  N++          N  N  GETA+H AA+  Q         +++++ LL+NG  ++   K   +TPLH  A  G +D++ +++   K     +    +G++PL  +S  GH D   +
Sbjct:  322 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRL----KVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQ---------SEVVRFLLQNGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---KQGAYPDAATTSGYTPLHLSSREGHDDVASV 524          

HSP 2 Score: 38.891 bits (89), Expect = 9.263e-14
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L++ A   +    G T LH+AA+ G   V ++LL   +  +A  K GLTPLH+
Sbjct:  525 LLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHV 578          

HSP 3 Score: 46.2098 bits (108), Expect = 2.033e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKL-----VQ--MKQ---------------ELSISEA--QIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
             +E LLK GA++    ++G T +H+ + +G+++I+  L    A P +    G +ALH A +    A   E++ FL +N +  +AK        + +T +H +A+L     VQ  +KQ                LS  E    +  +LLE+G    IVTK  G TPLH  A  G  +V+
Sbjct:  389 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAAR----AGQSEVVRFLLQNGAQVEAKA------KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVV 555          

HSP 4 Score: 38.1206 bits (87), Expect = 2.033e-10
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ NA  D     G+T LH+AA   ++ VA +LL   +  +  +K G TPLH+
Sbjct:  558 LLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHI 611          

HSP 5 Score: 50.8322 bits (120), Expect = 6.081e-10
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  323 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 380          

HSP 6 Score: 31.9574 bits (71), Expect = 6.081e-10
Identity = 49/209 (23.44%), Postives = 90/209 (43.06%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTR------------NHSTTKAKNLI-------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
             +  L+ +GANVN + + G T L++ ++  +L+++K LLD  A       +G + L  A++  H   V  +LE  T+                TKA  L+       ++++  G T +H AA    +           +  LL N G     T     TPLH  +  GN++++  ++       + + + ++G +PL   +  GH   V
Sbjct:   96 VVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNIN----------VATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLL---DRGSKIDAKTRDGLTPLHCGARSGHEQVV 291          

HSP 7 Score: 39.6614 bits (91), Expect = 8.965e-9
Identity = 42/149 (28.19%), Postives = 73/149 (48.99%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LK+G ++N   + G   LH+ S+ G+++I+  L+   AD  +   +GN+ALH A      A   E++  L  N +       +N ++  G T ++ AA      QE   +  +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   35 LKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA----SLAGQTEVVRVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 163          

HSP 8 Score: 39.2762 bits (90), Expect = 8.965e-9
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  195 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHV 248          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 56.9954 bits (136), Expect = 9.344e-14
Identity = 55/220 (25.00%), Postives = 103/220 (46.82%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K        +++E L ++ ++ +A                  N++          N  N  GETA+H AA+  Q         +++++ LL+NG  ++   K   +TPLH  A  G +D++ +++   K     +    +G++PL  +S  GH D   +
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRL----KVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQ---------SEVVRFLLQNGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---KQGAYPDAATTSGYTPLHLSSREGHDDVASV 533          

HSP 2 Score: 38.891 bits (89), Expect = 9.344e-14
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L++ A   +    G T LH+AA+ G   V ++LL   +  +A  K GLTPLH+
Sbjct:  534 LLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHV 587          

HSP 3 Score: 46.2098 bits (108), Expect = 1.757e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKL-----VQ--MKQ---------------ELSISEA--QIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
             +E LLK GA++    ++G T +H+ + +G+++I+  L    A P +    G +ALH A +    A   E++ FL +N +  +AK        + +T +H +A+L     VQ  +KQ                LS  E    +  +LLE+G    IVTK  G TPLH  A  G  +V+
Sbjct:  398 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAAR----AGQSEVVRFLLQNGAQVEAKA------KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVV 564          

HSP 4 Score: 38.1206 bits (87), Expect = 1.757e-10
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ NA  D     G+T LH+AA   ++ VA +LL   +  +  +K G TPLH+
Sbjct:  567 LLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHI 620          

HSP 5 Score: 50.8322 bits (120), Expect = 6.441e-10
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 389          

HSP 6 Score: 31.9574 bits (71), Expect = 6.441e-10
Identity = 49/209 (23.44%), Postives = 90/209 (43.06%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTR------------NHSTTKAKNLI-------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
             +  L+ +GANVN + + G T L++ ++  +L+++K LLD  A       +G + L  A++  H   V  +LE  T+                TKA  L+       ++++  G T +H AA    +           +  LL N G     T     TPLH  +  GN++++  ++       + + + ++G +PL   +  GH   V
Sbjct:  105 VVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNIN----------VATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLL---DRGSKIDAKTRDGLTPLHCGARSGHEQVV 300          

HSP 7 Score: 39.6614 bits (91), Expect = 9.118e-9
Identity = 42/149 (28.19%), Postives = 73/149 (48.99%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LK+G ++N   + G   LH+ S+ G+++I+  L+   AD  +   +GN+ALH A      A   E++  L  N +       +N ++  G T ++ AA      QE   +  +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 LKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA----SLAGQTEVVRVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 8 Score: 39.2762 bits (90), Expect = 9.118e-9
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHV 257          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 53.5286 bits (127), Expect = 2.108e-13
Identity = 57/211 (27.01%), Postives = 99/211 (46.92%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  A+  GH D
Sbjct:  357 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKD-DQTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLAAREGHED 554          

HSP 2 Score: 40.4318 bits (93), Expect = 2.108e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  559 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 612          

HSP 3 Score: 45.8246 bits (107), Expect = 3.837e-9
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  295 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM 348          

HSP 4 Score: 33.4982 bits (75), Expect = 3.837e-9
Identity = 44/174 (25.29%), Postives = 76/174 (43.68%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTK-------STGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +K        +G TPLH  A  GN +V
Sbjct:   89 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINV 258          

HSP 5 Score: 51.2174 bits (121), Expect = 6.531e-7
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  357 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHI 414          

HSP 6 Score: 36.1946 bits (82), Expect = 1.567e-6
Identity = 38/149 (25.50%), Postives = 74/149 (49.66%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G +VN   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA+   +         ++++ LL+NG    + T+  G TPL      G+  V+
Sbjct:   61 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAAQENHL---------EVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 189          

HSP 7 Score: 33.8834 bits (76), Expect = 1.567e-6
Identity = 21/62 (33.87%), Postives = 33/62 (53.23%), Query Frame = 2
Query:  584 ILQNNARIDV--------FDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV          + G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  221 LLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 282          

HSP 8 Score: 48.9062 bits (115), Expect = 3.992e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVL+   + V+A++K G TPLH+
Sbjct:  691 LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHV 744          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 53.5286 bits (127), Expect = 2.539e-13
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  A+  GH D
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLAAREGHED 529          

HSP 2 Score: 40.0466 bits (92), Expect = 2.539e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 587          

HSP 3 Score: 45.4394 bits (106), Expect = 3.513e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM 323          

HSP 4 Score: 37.3502 bits (85), Expect = 3.513e-10
Identity = 45/167 (26.95%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   72 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADVESKS-GFTPLHIAAHYGNINV 233          

HSP 5 Score: 40.0466 bits (92), Expect = 2.240e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 257          

HSP 6 Score: 36.5798 bits (83), Expect = 2.240e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G +VN   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  ++++ LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 7 Score: 50.8322 bits (120), Expect = 8.982e-7
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHI 389          

HSP 8 Score: 48.521 bits (114), Expect = 5.289e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVL+   + V+A++K G TPLH+
Sbjct:  666 LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHV 719          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 53.9138 bits (128), Expect = 2.561e-13
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  A+  GH D
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLAAREGHED 529          

HSP 2 Score: 40.0466 bits (92), Expect = 2.561e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 587          

HSP 3 Score: 45.0542 bits (105), Expect = 3.348e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM 323          

HSP 4 Score: 37.7354 bits (86), Expect = 3.348e-10
Identity = 45/167 (26.95%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   72 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADVESKS-GFTPLHIAAHYGNINV 233          

HSP 5 Score: 40.0466 bits (92), Expect = 2.242e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 257          

HSP 6 Score: 36.965 bits (84), Expect = 2.242e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G +VN   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  ++++ LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 7 Score: 50.447 bits (119), Expect = 9.912e-7
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHI 389          

HSP 8 Score: 48.1358 bits (113), Expect = 5.834e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVL+   + V+A++K G TPLH+
Sbjct:  666 LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHV 719          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 53.5286 bits (127), Expect = 2.689e-13
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  A+  GH D
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLAAREGHED 529          

HSP 2 Score: 39.6614 bits (91), Expect = 2.689e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 587          

HSP 3 Score: 45.4394 bits (106), Expect = 3.542e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM 323          

HSP 4 Score: 37.7354 bits (86), Expect = 3.542e-10
Identity = 45/167 (26.95%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   72 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADVESKS-GFTPLHIAAHYGNINV 233          

HSP 5 Score: 40.0466 bits (92), Expect = 2.187e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 257          

HSP 6 Score: 36.965 bits (84), Expect = 2.187e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G +VN   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  ++++ LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 7 Score: 50.447 bits (119), Expect = 9.829e-7
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHI 389          

HSP 8 Score: 48.1358 bits (113), Expect = 5.786e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVL+   + V+A++K G TPLH+
Sbjct:  666 LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHV 719          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 53.5286 bits (127), Expect = 2.689e-13
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  A+  GH D
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLAAREGHED 529          

HSP 2 Score: 39.6614 bits (91), Expect = 2.689e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 587          

HSP 3 Score: 45.4394 bits (106), Expect = 3.542e-10
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM 323          

HSP 4 Score: 37.7354 bits (86), Expect = 3.542e-10
Identity = 45/167 (26.95%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   72 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADVESKS-GFTPLHIAAHYGNINV 233          

HSP 5 Score: 40.0466 bits (92), Expect = 2.187e-8
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 257          

HSP 6 Score: 36.965 bits (84), Expect = 2.187e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G +VN   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  ++++ LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 7 Score: 50.447 bits (119), Expect = 9.829e-7
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHI 389          

HSP 8 Score: 48.1358 bits (113), Expect = 5.786e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVL+   + V+A++K G TPLH+
Sbjct:  666 LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHV 719          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.568e-13
Identity = 48/155 (30.97%), Postives = 81/155 (52.26%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            + +  L+K+ A+++ K  +GET+LH  ++ GNL+++  L+  KAD  ++ N G + LH A K  +   V  ++          K K  I+ K N GET +HFAA+   +          ++ +L+ NG D+   T   G T LHY   SGN +++
Sbjct:  879 NLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLI----------KNKADIHAKTNSGETILHFAAESGNL---------NLVSLLIHNGTDINTKTDD-GLTALHYAVESGNLNLV 1013          

HSP 2 Score: 37.3502 bits (85), Expect = 2.568e-13
Identity = 19/53 (35.85%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            ++   A ++   D G+TALH A E  +  +  +L+ + + VNAK+  G TPLH
Sbjct: 1049 LMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLH 1101          

HSP 3 Score: 59.3066 bits (142), Expect = 8.051e-13
Identity = 50/155 (32.26%), Postives = 82/155 (52.90%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            + +  L+K+ A+++ K  +GET+LH  +  GNL+++  L+  KAD  ++ N G + LH A K  +   V  ++          K K  I+ K N GET +HFAAK   +          ++  L++N  D+   T S GET LH+ A SGN +++
Sbjct:  846 NLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLI----------KNKADIHAKTNSGETILHFAAKSGNL---------NLVNWLIKNKADIHAKTNS-GETILHFAAESGNLNLV 980          

HSP 4 Score: 35.039 bits (79), Expect = 8.051e-13
Identity = 20/54 (37.04%), Postives = 29/54 (53.70%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            ++ N   I+   D G+TALH A E G+  +  +L+     VNAK+  G T LH 
Sbjct:  983 LIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHF 1036          

HSP 5 Score: 54.299 bits (129), Expect = 2.352e-11
Identity = 49/157 (31.21%), Postives = 82/157 (52.23%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            +  L+ +GANVN+     +T+LH  ++ GNL+++  L+  KAD  ++ N G + LH A +  +   V  ++          K K  I+ K N GET +HFAAK   +          ++  L++N  D+   T S GET LH+ A SGN +++  ++
Sbjct:  819 VSLLIHNGANVNN----AKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLI----------KNKADIHAKTNSGETILHFAAKSGNL---------NLVNWLIKNKADIHAKTNS-GETILHFAAKSGNLNLVNWLI 951          

HSP 6 Score: 35.4242 bits (80), Expect = 2.352e-11
Identity = 19/53 (35.85%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            +++N A I    + G T LH AAE G+  +  +L+ + + +N K+  GLT LH
Sbjct:  950 LIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALH 1002          

HSP 7 Score: 50.447 bits (119), Expect = 8.094e-10
Identity = 51/173 (29.48%), Postives = 80/173 (46.24%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEF-----------LTRNHSTTKAKNL------------INLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            L K+GA+VN K   GETVLH   + GNL ++K L++ +A+  ++ + G + LH AV   +   V  ++ +           LT  H      NL            +N K N GET ++ A         +      ++ +L+  G D+   T + GET LHY   SGN D++
Sbjct:  657 LAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSA---------VDYGSPDLVYLLIAYGADVNAKTDN-GETVLHYAVESGNLDLV 819          

HSP 8 Score: 33.8834 bits (76), Expect = 8.094e-10
Identity = 19/54 (35.19%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +++N A I    + G T LH AAE G+  +   L+ +K+ ++AK+  G T LH 
Sbjct:  851 LIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHF 904          

HSP 9 Score: 49.6766 bits (117), Expect = 3.911e-9
Identity = 52/176 (29.55%), Postives = 86/176 (48.86%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACV-------------KEILEFLTRNHSTT------KAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            +  L+  GA+VN K  +GET+L+     G+ D++ LL+   AD  ++ + G + LH AV+  +   V             K IL F  ++ +        K K  I+ K N GET +HFAA+   +          ++  L++N  D+   T S GET LH+ A SGN +++  ++
Sbjct:  753 VSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNL---------NLVNWLIKNKADIHAKTNS-GETILHFAAKSGNLNLVNWLI 918          

HSP 10 Score: 32.3426 bits (72), Expect = 3.911e-9
Identity = 18/54 (33.33%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +++N A I    + G T LH AA+ G+  +   L+ +K+ ++AK+  G T LH 
Sbjct:  917 LIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHF 970          

HSP 11 Score: 51.9878 bits (123), Expect = 2.641e-6
Identity = 45/159 (28.30%), Postives = 80/159 (50.31%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            + +  L+  G +VN K  +GET+LH    LG+LD++ LL+   AD  ++ ++G +ALH AV+  + A V  ++ +             +N KNN GET +H+A            +   ++ +L+ NG D+     ++GET L+      N ++L   +
Sbjct: 1011 NLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGAD----------VNAKNNSGETPLHYAVIF---------NSLDLVSLLIHNGADIN-TKNNSGETVLNSIMEFNNCNILKSFI 1149          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.540e-12
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  A+  GH D
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLAAREGHED 529          

HSP 2 Score: 39.6614 bits (91), Expect = 1.540e-12
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  534 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 587          

HSP 3 Score: 45.4394 bits (106), Expect = 2.029e-9
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  270 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM 323          

HSP 4 Score: 37.7354 bits (86), Expect = 2.029e-9
Identity = 45/167 (26.95%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   72 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADVESKS-GFTPLHIAAHYGNINV 233          

HSP 5 Score: 40.0466 bits (92), Expect = 1.253e-7
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 257          

HSP 6 Score: 36.965 bits (84), Expect = 1.253e-7
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G +VN   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +  ++++ LL+NG    + T+  G TPL      G+  V+
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAA------QE---NHLEVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 172          

HSP 7 Score: 50.447 bits (119), Expect = 6.876e-6
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  332 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHI 389          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 52.7582 bits (125), Expect = 2.034e-12
Identity = 56/211 (26.54%), Postives = 100/211 (47.39%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  ++  GH D
Sbjct:  357 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKD-DQTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLSAREGHED 554          

HSP 2 Score: 40.4318 bits (93), Expect = 2.034e-12
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  559 LLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHV 612          

HSP 3 Score: 45.4394 bits (106), Expect = 1.642e-8
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  295 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHM 348          

HSP 4 Score: 34.2686 bits (77), Expect = 1.642e-8
Identity = 45/174 (25.86%), Postives = 76/174 (43.68%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTK-------STGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   V+ +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  I +K        +G TPLH  A  GN +V
Sbjct:   89 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINV 258          

HSP 5 Score: 50.8322 bits (120), Expect = 5.951e-6
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  357 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 414          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 51.9878 bits (123), Expect = 3.582e-12
Identity = 56/211 (26.54%), Postives = 100/211 (47.39%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILEF-LTRNHSTTKAK--NLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            C++ LL+    V+D      T LH+ +  G+  + K+LLD+KA+P ++   G + LH A K           +H A ++ + E  LT  H        N++          N  N  GETA+H AA+  Q         A++++ L+++G  ++   K   +TPLH  A  G +D++ +++   +     N    +G++PL  ++  GH D
Sbjct:  349 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQ---------AEVVRYLVQDGAQVEAKAKD-DQTPLHISARLGKADIVQQLL---QQGASPNAATTSGYTPLHLSAREGHED 546          

HSP 2 Score: 40.4318 bits (93), Expect = 3.582e-12
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L + A + +    G T LH+AA+ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  551 LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHV 604          

HSP 3 Score: 45.4394 bits (106), Expect = 2.655e-9
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  287 LLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHM 340          

HSP 4 Score: 36.965 bits (84), Expect = 2.655e-9
Identity = 46/167 (27.54%), Postives = 76/167 (45.51%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LL+  ANV+   K G T LHI S  G  +++K+L+   A+  +Q   G + L+ A +  H   VK +L+        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   89 VVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDNNADVESKS-GFTPLHIAAHYGNINV 250          

HSP 5 Score: 40.0466 bits (92), Expect = 2.920e-7
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+  ++  +TPLH+
Sbjct:  221 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHV 274          

HSP 6 Score: 35.8094 bits (81), Expect = 2.920e-7
Identity = 38/149 (25.50%), Postives = 74/149 (49.66%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +K+G ++N   + G   LH+ S+ G+++++  LL  +A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA+   +         +++K LL+NG    + T+  G TPL      G+  V+
Sbjct:   61 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA----SLAGQAEVVKVLVTNGAN------VNAQSQNGFTPLYMAAQENHL---------EVVKFLLDNGASQSLATED-GFTPLAVALQQGHDQVV 189          

HSP 7 Score: 51.2174 bits (121), Expect = 5.167e-6
Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ+N  +D   +  +TALH+AA  GH  VA+VLL  K+  NAK+  G TPLH+
Sbjct:  349 CVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 406          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q502K3|ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 44.2838 bits (103), Expect = 8.397e-11
Identity = 51/190 (26.84%), Postives = 90/190 (47.37%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            ++ L+ +GANVN K     T LH  +   N   + LLL + AD  ++     + LH A  +R   CV+ +L  ++           +N+ +  G   +H AA+     QE+       +K+LL  G ++    K     P+H+ A  G+ +V+  +V    +K   +K+   G++PL  A++ GH D V+
Sbjct:   57 MDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSS----------LNMADRTGRAPLHHAAQ--SGYQEM-------VKLLLNKGANLSASDKKD-RQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKR---GYTPLHAAAASGHVDVVK 223          

HSP 2 Score: 43.5134 bits (101), Expect = 8.397e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A ID  + FG TALH+A   G   VA  L+   + VN  +  G TPLHL
Sbjct:  225 LLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHL 278          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: K1QCS6 (Ankyrin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10026812 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.278e-49
Identity = 91/197 (46.19%), Postives = 122/197 (61.93%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX---XXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E C E L+K GA+VN   + GET +HI +R G L +L+ L++E  DP  Q   G + LH AV+H H A  KE+L +++   S   A  L+N +N EGET VH+AA+LV+        +  IM++LL+  GD  I TK T ET LHYCA +GN D+L+EIVK   N   +   NKQ++NGWSPLL AS  GH   V+I
Sbjct:  443 ERCAEMLMKGGADVNAVRENGETAMHIAARNGQLKMLQALMEEGGDPTQQSKNGETPLHVAVRHCHLAVAKELLTYVSMTSSRIDAVMLVNQQNWEGETPVHYAAELVKSMTHFEFEDTDIMRLLLQYDGDKNIQTKLTHETSLHYCARAGNEDILLEIVKHIGNTCVQNAVNKQSRNGWSPLLVASEQGHLQIVKI 639          

HSP 2 Score: 77.7962 bits (190), Expect = 1.278e-49
Identity = 39/55 (70.91%), Postives = 46/55 (83.64%), Query Frame = 2
Query:  584 ILQNNARIDVFDDF-GMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ +AR+DVFD++ G  ALHLAAE GH  VA+VLL HK+FVNAKSK GLTPLHL
Sbjct:  640 LLQYHARVDVFDEYHGKAALHLAAENGHEQVADVLLWHKAFVNAKSKLGLTPLHL 694          

HSP 3 Score: 42.743 bits (99), Expect = 7.744e-6
Identity = 44/162 (27.16%), Postives = 76/162 (46.91%), Query Frame = 3
Query:    6 SCIETLL--KSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNE-GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            S I  LL  K  A+++ + K G T++HI S+ G+ D     L +K  P    N+ G   LH+A    H   V+ +L       ++  AK   +   ++G TA+H A +           + Q++++LL  G  ++      GETPLH  A + + +   E++
Sbjct:  302 SAIVDLLVDKCKASISARTKDGSTLMHIASQYGHPDTALTFL-KKGVPLHMPNKSGAICLHTAAMRGHTNVVRALLS----KGASVDAKTKASFNCHDGYTALHLAVE---------CGKPQVVQMLLGYGAQVEFKGGKAGETPLHIAARTRDGERCAEML 449          

HSP 4 Score: 35.8094 bits (81), Expect = 7.744e-6
Identity = 17/58 (29.31%), Postives = 30/58 (51.72%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +++  A ++   + G TA+H+AA  G   + + L+        +SK G TPLH+
Sbjct:  445 CAEMLMKGGADVNAVRENGETAMHIAARNGQLKMLQALMEEGGDPTQQSKNGETPLHV 502          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210QIK2 (Ankyrin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01142 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.830e-48
Identity = 90/196 (45.92%), Postives = 117/196 (59.69%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVX--XXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E C E LLKSGANVN   + GET +HI +R G L ++  LL+E  +P  Q   G + LH AV+H H     E+L ++TR+ +   A  L+N  N EGET+VH+ A+L +        +  I ++LLE  GD  I TK T E+PLHY A SGN D+LMEIVK      +   N Q+KNGWSPLL AS  GH   V+I
Sbjct:  470 EKCGEMLLKSGANVNASQENGETAMHIAARYGQLKMVIALLEEGGNPTQQSKVGETPLHVAVRHCHLEVTTELLLYVTRHKARIDAVMLVNQHNWEGETSVHYVAELTKNMAHSEFEDTDITRLLLEYDGDTSIQTKLTHESPLHYSARSGNEDILMEIVKNIKTSVQSAVNTQSKNGWSPLLVASEQGHLQIVKI 665          

HSP 2 Score: 78.1814 bits (191), Expect = 2.830e-48
Identity = 39/55 (70.91%), Postives = 47/55 (85.45%), Query Frame = 2
Query:  584 ILQNNARIDVFDDF-GMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+AR+DVFD+  G  ALHL+AE GH LVA+VLL HK+FVNAKSK G+TPLHL
Sbjct:  666 LLQNHARVDVFDEHHGKAALHLSAENGHDLVADVLLWHKAFVNAKSKLGVTPLHL 720          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A0L8G817 (ANK_REP_REGION domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22038319mg PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.877e-47
Identity = 86/197 (43.65%), Postives = 120/197 (60.91%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXX---XXXXXGWSPLLYASSCGHHDAVRI 584
            E C E LLKSGA+ N +++ GETV H+ +R G+L+++K LL+E   P  Q   G++ LH AV++ H   V EIL  ++   S ++A  L+NL   EGET +H+A  L+  K      +  ++K LLE GGD+   TK T ETP HY A SGNS+VL+EI K++          KQ+ NGWSPLL AS  G  + V+I
Sbjct:  316 ELCAEMLLKSGADPNVRLENGETVFHLAARSGHLELIKTLLEEDCSPTQQSKTGDTPLHLAVRYCHPTLVSEILTNVSNKKSRSEAVFLVNLPQKEGETPMHYATDLIPDKIRSEFDDTDVIKTLLEFGGDISCTTKLTRETPFHYAARSGNSNVLLEITKSKSPSDIRAIVNKQSINGWSPLLVASEKGQLEIVKI 512          

HSP 2 Score: 82.4185 bits (202), Expect = 4.877e-47
Identity = 39/54 (72.22%), Postives = 46/54 (85.19%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQNNARIDVFD+ G  ALHLAAE GH  VA++LL +K+FVNAKSK G+TPLHL
Sbjct:  513 LLQNNARIDVFDEHGKAALHLAAENGHEEVADLLLEYKAFVNAKSKIGVTPLHL 566          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: T1IHG8 (ANK_REP_REGION domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.191e-44
Identity = 84/197 (42.64%), Postives = 121/197 (61.42%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEI---VXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E C   LLKSGA+VN   + GET LHI +R G+L +++LLL++ A+P  Q   G S LH AV+H H+     +L +  R  S   A  L+NL+  EGE+A+H+AA++ +        +  I++ L+E  GD+ ++TK+T ET +HY A +GNSDVL+E+   +     +   NKQA NGWSPLL AS  GH + V I
Sbjct:  597 EKCAGMLLKSGADVNAAGENGETALHIAARYGHLQMVELLLEDGANPNFQSKVGESPLHIAVRHCHYPVAAALLNYGGR--SKEFAARLVNLQTCEGESALHYAAEITKDTVHHPNEDVDIVRTLMELDGDINLMTKATNETAIHYAARAGNSDVLLEMTHHISANLLQTAMNKQAGNGWSPLLVASEQGHLEVVNI 791          

HSP 2 Score: 83.9593 bits (206), Expect = 1.191e-44
Identity = 38/54 (70.37%), Postives = 47/54 (87.04%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+AR+DVFD+ G  ALH+AAEKGHR V +VLL HK+FVNA+SK G+TPLHL
Sbjct:  792 LLQNHARVDVFDESGKAALHVAAEKGHRAVVDVLLQHKAFVNARSKVGITPLHL 845          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1D1VIN0 (ANK_REP_REGION domain-containing protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_09867 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.061e-44
Identity = 83/196 (42.35%), Postives = 127/196 (64.80%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXX---XXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            E C E L+KSGA+VN+ ++ GET +H+ +R G L ++++LL E+A+P +    G +ALH AV+  ++  VKE++E +    S   A N++N +N EGET+ H+A +L          + +I+ +LL+   D+ I TK + ETPLHYCA  GN ++LM I+K+Q   + ++  N+QAKNGWSPLL AS  GH + VR
Sbjct:  250 ELCAEMLIKSGADVNNTMENGETAMHVAARFGALRMVQILLLEEANPLATSASGETALHVAVRACNYFVVKELIEHVANKQSRNDATNMVNAQNLEGETSFHYATELTTDMAHSEGEDVKIVLLLLDYNADVNIQTKMSNETPLHYCARCGNVNILMTIIKHQGPGRLQVALNRQAKNGWSPLLTASEHGHEEVVR 445          

HSP 2 Score: 75.485 bits (184), Expect = 2.061e-44
Identity = 35/54 (64.81%), Postives = 44/54 (81.48%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+NNAR+DVFD+ G  ALH+AAE GH  + ++LL HK+FVNAKSK GLTP HL
Sbjct:  447 LLRNNARVDVFDEQGKAALHIAAENGHLDIVDLLLHHKAFVNAKSKLGLTPTHL 500          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048767.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 98.2117 bits (243), Expect = 7.333e-39
Identity = 77/197 (39.09%), Postives = 110/197 (55.84%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEI---VXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E   E LLKSGA VN + + GET +H+ +R G L +++ L +E AD   +   G + LH AV H H   V+ IL  L+   S  +A+  +  +N  GETA+H AA+L          +  I++ L+E   D+   T+  GETPLHYCA  GN+ VL E+   V + + +   NK +KNG SPLL A+  GH   VR+
Sbjct:  402 EKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRV 598          

HSP 2 Score: 81.2629 bits (199), Expect = 7.333e-39
Identity = 36/54 (66.67%), Postives = 49/54 (90.74%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N+AR+DVFD+ G+ ALHLAAE+GH  +A++LL+HK+FVNAK+K GLTPLHL
Sbjct:  599 LLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHL 652          

HSP 3 Score: 41.9726 bits (97), Expect = 3.469e-7
Identity = 44/153 (28.76%), Postives = 71/153 (46.41%), Query Frame = 3
Query:   27 KSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNE-GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            K  +NV  + K G T+LHI S+ G+ +     L +K  P    N+ G   LH+A K  H A VK +L       +TTK          +G+TA+H A +           + Q++++LL  G  +++      ETPLH  A     + + E++
Sbjct:  276 KFKSNVLARTKDGSTLLHIASQCGHPETALTFL-KKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLLKGAHVDATTK----------DGQTALHIAVQ---------NCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAARVKEGEKVAEML 408          

HSP 4 Score: 30.8018 bits (68), Expect = 3.469e-7
Identity = 16/52 (30.77%), Postives = 28/52 (53.85%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPL 739
            +L++ A ++   + G TA+H+AA  G   +   L    + +  +SK G TPL
Sbjct:  408 LLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPL 459          

HSP 5 Score: 36.1946 bits (82), Expect = 3.097e-6
Identity = 23/54 (42.59%), Postives = 28/54 (51.85%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  A     D  GMTA+HLAA  GH  +  VL A        SK GLT LH+
Sbjct:  802 LLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKIISSKTGLTALHV 855          

HSP 6 Score: 32.7278 bits (73), Expect = 3.097e-6
Identity = 32/114 (28.07%), Postives = 49/114 (42.98%), Query Frame = 3
Query:  132 KADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKIL-LENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +AD  +    G + LH A ++ H   VK  L+             L  L + EG T  H AA           S A I ++L    GG   + +K+ G  PLH  A+ G+++V+
Sbjct:  703 RADITATDIHGQTPLHLAAENDHSEVVKLFLK---------HRPELATLASVEGATCTHIAAA--------KGSVAVIRELLKFSQGGLTTLHSKANGSCPLHLAAAGGHTEVV 799          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000016978.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 98.2117 bits (243), Expect = 7.770e-39
Identity = 77/197 (39.09%), Postives = 110/197 (55.84%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEI---VXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E   E LLKSGA VN + + GET +H+ +R G L +++ L +E AD   +   G + LH AV H H   V+ IL  L+   S  +A+  +  +N  GETA+H AA+L          +  I++ L+E   D+   T+  GETPLHYCA  GN+ VL E+   V + + +   NK +KNG SPLL A+  GH   VR+
Sbjct:  402 EKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRV 598          

HSP 2 Score: 81.2629 bits (199), Expect = 7.770e-39
Identity = 36/54 (66.67%), Postives = 49/54 (90.74%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N+AR+DVFD+ G+ ALHLAAE+GH  +A++LL+HK+FVNAK+K GLTPLHL
Sbjct:  599 LLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHL 652          

HSP 3 Score: 41.5874 bits (96), Expect = 4.075e-7
Identity = 44/153 (28.76%), Postives = 71/153 (46.41%), Query Frame = 3
Query:   27 KSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNE-GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            K  +NV  + K G T+LHI S+ G+ +     L +K  P    N+ G   LH+A K  H A VK +L       +TTK          +G+TA+H A +           + Q++++LL  G  +++      ETPLH  A     + + E++
Sbjct:  276 KFKSNVLARTKDGSTLLHIASQCGHPETALTFL-KKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLLKGAHVDATTK----------DGQTALHIAVQ---------NCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAARVKEGEKVAEML 408          

HSP 4 Score: 30.4166 bits (67), Expect = 4.075e-7
Identity = 16/52 (30.77%), Postives = 28/52 (53.85%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPL 739
            +L++ A ++   + G TA+H+AA  G   +   L    + +  +SK G TPL
Sbjct:  408 LLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPL 459          

HSP 5 Score: 36.1946 bits (82), Expect = 3.303e-6
Identity = 23/54 (42.59%), Postives = 28/54 (51.85%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  A     D  GMTA+HLAA  GH  +  VL A        SK GLT LH+
Sbjct:  802 LLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKIISSKTGLTALHV 855          

HSP 6 Score: 32.7278 bits (73), Expect = 3.303e-6
Identity = 32/114 (28.07%), Postives = 49/114 (42.98%), Query Frame = 3
Query:  132 KADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKIL-LENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            +AD  +    G + LH A ++ H   VK  L+             L  L + EG T  H AA           S A I ++L    GG   + +K+ G  PLH  A+ G+++V+
Sbjct:  703 RADITATDIHGQTPLHLAAENDHSEVVKLFLK---------HRPELATLASVEGATCTHIAAA--------KGSVAVIRELLKFSQGGLTTLHSKANGSCPLHLAAAGGHTEVV 799          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 48.521 bits (114), Expect = 1.051e-13
Identity = 49/151 (32.45%), Postives = 71/151 (47.02%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHST-TKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LL  GA++    K G T LH+ ++ G +++  LLL ++A P +    G + LH A    H+   K  L  L +  S    AKN        G T +H AAK  QM         +I   LLE G D   +T+  G +PLH  +  GN D++
Sbjct:  498 LLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAA---HYDNQKVALLLLDQGASPHAAAKN--------GYTPLHIAAKKNQM---------EIATTLLEYGADTNAITRQ-GISPLHLASQEGNVDMV 627          

HSP 2 Score: 46.2098 bits (108), Expect = 1.051e-13
Identity = 22/54 (40.74%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            ++  +A I++ +  G+T LHLAA++    VAEVL+ H + V+ ++K G TPLH+
Sbjct:  630 LMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHV 683          

HSP 3 Score: 51.9878 bits (123), Expect = 7.941e-13
Identity = 53/216 (24.54%), Postives = 100/216 (46.30%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKH----------RHFACVKEILE----------FLTRNHSTTKAKN---LINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +C++ LL     V+D      T LH+ +  G+  + K+++D+KA+P ++   G + LH A K           +H A ++ + E          F+   +  T+  N     N  N  GETA+H AA+  Q          +++K L++NG  +   +K   +TPLH  +  G  +++ +++   ++    +    +G++PL  A+  GH D   I
Sbjct:  295 NCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQ---------TEVVKYLVQNGAYVDAKSKDD-QTPLHISSRLGKPEIIQQLL---QHGACPDSTTTSGYTPLHLAAREGHKDVASI 497          

HSP 4 Score: 40.0466 bits (92), Expect = 7.941e-13
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A + +    G T LH+AA+ G   VA +LL  ++  +A  K GLTPLH+
Sbjct:  498 LLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHV 551          

HSP 5 Score: 38.891 bits (89), Expect = 5.186e-8
Identity = 41/155 (26.45%), Postives = 69/155 (44.52%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            E+ +  L+  GA+ N     GET LH+ +R G  +++K L+   A   ++  +  + LH + +      ++++L+      STT +          G T +H AA+              +  ILL+ G  + I TK  G TPLH  A  G  +V
Sbjct:  393 ENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTS----------GYTPLHLAARE---------GHKDVASILLDQGASLGITTKK-GFTPLHVAAKYGKIEV 527          

HSP 6 Score: 36.5798 bits (83), Expect = 5.186e-8
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL   +  +A +K G TPLH+
Sbjct:  531 LLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHI 584          

HSP 7 Score: 39.2762 bits (90), Expect = 7.280e-8
Identity = 22/54 (40.74%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+ K++  +TPLH+
Sbjct:  168 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHV 221          

HSP 8 Score: 35.4242 bits (80), Expect = 7.280e-8
Identity = 42/149 (28.19%), Postives = 71/149 (47.65%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LKSG ++N   + G   LH+ S+ G+++++  L+   A   +   +GN+ALH A        VKE++         T   N +N ++  G T ++ AA      QE   +   +++ LL+NG    I T+  G TPL      G+  V+
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELV---------TNGAN-VNAQSQNGFTPLYMAA------QE---NHLDVVRYLLDNGSSQSIATED-GFTPLAVALQQGHDQVV 136          

HSP 9 Score: 47.7506 bits (112), Expect = 7.276e-6
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  ARID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  234 LLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHM 287          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048191.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:3100273:3104460:1 gene:ENSAMXG00000036724.1 transcript:ENSAMXT00000048191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.8986 bits (102), Expect = 1.070e-11
Identity = 52/190 (27.37%), Postives = 86/190 (45.26%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            ++ L+ +GANVN K     T LH  +   N   + LLL + AD  ++     +ALH A  +R   C   +L  ++           +N+ +  G  A+H AA+          S  Q M  LL N G     +      P+H+ A  G+ +V+  +V    +K   +K+   G++PL  A++ GH D V+
Sbjct:   43 MDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKFWQTALHIAAANRATRCADTLLPHISS----------LNIADRTGRAALHHAAQ----------SGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKR---GYTPLHAAAASGHVDVVK 209          

HSP 2 Score: 43.8986 bits (102), Expect = 1.070e-11
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A ID  + FG TALH+A   G   VA  L+   + VN  +  G TPLHL
Sbjct:  211 LLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTPLHL 264          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 47.3654 bits (111), Expect = 2.739e-11
Identity = 50/216 (23.15%), Postives = 99/216 (45.83%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI----------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHD 572
            +C++ LL+    V+D      T LH+ +  G+  + K+++D+KA+P ++   G + LH A K        +++E L ++ ++ +A                 +N++          N  N  GETA+H AA+  Q         A +++ LL+NG  + I  K   +T LH  +  G ++++  ++   +     +    +G++PL  A   GH +
Sbjct:  350 NCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRV----KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQ---------ADVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKAEIVQLLL---QKGAWASAATTSGYTPLHLAVREGHQE 548          

HSP 2 Score: 39.2762 bits (90), Expect = 2.739e-11
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+AA   ++ VA +LL H +  +A +K G TPLH+
Sbjct:  586 LLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHI 639          

HSP 3 Score: 45.0542 bits (105), Expect = 3.468e-11
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH  A  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  289 LLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHM 342          

HSP 4 Score: 41.2022 bits (95), Expect = 3.468e-11
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
             +  LLK GA+V+   K G T LHI S  G  D+++ L+   A+  +Q   G + L+ A +  H   V+ +LE        T +  T  A  L          L  N+ +  V   A  +  +++ + S A    +LL+N  +  + +KS G TPLH  A  GN +V
Sbjct:   91 VVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAA----LLLQNDHNADVESKS-GFTPLHIAAHYGNINV 252          

HSP 5 Score: 44.2838 bits (103), Expect = 1.006e-7
Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  572 CCPNILQNNARID-VFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +LQ++  +D V +D+ +TALH+AA  GH  VA+V++  K+  NAK+  G TPLH+
Sbjct:  351 CVQLLLQHDVPVDDVTNDY-LTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHI 408          

HSP 6 Score: 30.0314 bits (66), Expect = 1.006e-7
Identity = 46/211 (21.80%), Postives = 91/211 (43.13%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE-------------FLTRNHSTTKAKNLI------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +  L+ +GANVN + + G T L++ ++  +L++++ LL+  A       +G + L  A++  H   V  +LE                R   T  A  L+      ++++  G T +H AA    +          +  +LL  G  +  + ++   TPLH  A  GN +++  ++       + + + K+G +PL   +  GH   V +
Sbjct:  124 VVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNI---------NVATLLLNRGAAVDFMARND-ITPLHVAAKRGNGNMVKLLL---DRGAKIDAKTKDGLTPLHCGARSGHEQVVEM 321          

HSP 7 Score: 49.2914 bits (116), Expect = 2.235e-6
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  NA +++ +  G+T LHLAA++    VAEVLL H + V+A +K G TPLH+
Sbjct:  685 LLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHV 738          

HSP 8 Score: 47.3654 bits (111), Expect = 8.638e-6
Identity = 59/205 (28.78%), Postives = 91/205 (44.39%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTK----------------------AKNL-INLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGH 566
            LL+  A  +   KTG T LH+ +   N  +  LLLD  A P +    G + LH A K         +LEF    ++ T+                       KN  +N+ N  G T +H AA      QE  +  A+   +LL +G ++   TK TG TPLH     GN  ++  ++   +N+ + N + K+G++PL  A+  GH
Sbjct:  586 LLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAA------QEDRVGVAE---VLLNHGAEVDAHTK-TGYTPLHVACHYGNMKMVSFLL---ENQAKINSKTKSGYTPLHQAAQQGH 777          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.330e-12
Identity = 52/216 (24.07%), Postives = 98/216 (45.37%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAK-------------NLINL----------KNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +C++ LL   A V+D      T LH+ +  G+  + KLLLD   +P ++   G + LH A K      ++ +L+     H+TT++              N++ L           N  GET +H A++  Q+         +++K LL++G  + +  +   +TPLH  +  G ++++  ++   +     N    +G +PL +AS  GH D   +
Sbjct:  325 ACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQL---------EVVKTLLQSGARVGVKARED-QTPLHIASRLGKAEIVQLLL---QRGSDPNAPTASGSTPLYFASREGHGDVASL 527          

HSP 2 Score: 40.817 bits (94), Expect = 1.330e-12
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+N A I      G T LH+A++ G   VA +LL   +  + K K GLTPLH+
Sbjct:  528 LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHV 581          

HSP 3 Score: 43.1282 bits (100), Expect = 1.490e-11
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  +A I +    G+TA+HLAA++    VAE+L  HK+ VN  +K   TPLH+
Sbjct:  660 LLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHV 713          

HSP 4 Score: 41.9726 bits (97), Expect = 1.490e-11
Identity = 60/218 (27.52%), Postives = 92/218 (42.20%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEA-----------------------QIMKILLENGGDMKIVTKSTGETPLHYCASSGN---SDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             ++TLL+SGA V  K +  +T LHI SRLG  +I++LLL   +DP +    G++ L+ A +  H      +LE        TK          +G T +H A+K  +++    + E                        Q + +LL + G     T   G TPLH  A         VL+E+        +TN   + G +PL  A+  GH D V +
Sbjct:  458 VVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTK----------KGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLEL------GAETNMLTQQGVAPLHLAAQEGHADMVAL 659          

HSP 5 Score: 50.0618 bits (118), Expect = 1.768e-11
Identity = 58/215 (26.98%), Postives = 102/215 (47.44%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEI-----------LEFLTRNHSTTK------AKNLI------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            + ++ LL  GA ++ K + G T LH  +R G+  ++++LL+  A   ++   G S LH A +  H ACV+ +           L++LT  H          AK L+      N +   G T +H A K  ++K         +M++LL++G  +   T+S G TP+H  +  G+ +V+  ++   +N   +N     G +PL  AS  G  + V+
Sbjct:  259 NMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIK---------VMELLLKHGASIHTTTES-GLTPIHVASFMGHLNVVQLLL---QNGASSNATNVRGETPLHMASRAGQLEVVK 460          

HSP 6 Score: 35.039 bits (79), Expect = 1.768e-11
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            +LQ+ AR+ V      T LH+A+  G   + ++LL   S  NA +  G TPL+
Sbjct:  462 LLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLY 514          

HSP 7 Score: 36.5798 bits (83), Expect = 1.263e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 2
Query:  572 CCPNILQNNARID-VFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +L   A +D V  D+ +T LH+AA  GH  VA++LL      NA++  G TPLH+
Sbjct:  326 CVQLLLGRQAPVDDVTLDY-LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHI 383          

HSP 8 Score: 35.039 bits (79), Expect = 1.263e-7
Identity = 50/219 (22.83%), Postives = 93/219 (42.47%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTR---------------------------NHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +  L++ GAN+N + + G T L++ ++  +L+I+K LLD  A+      +G + L  A++  H   V  +LE  T+                           +++   +K ++N     G T +H AA    M           +  LL N G     T   G TPLH  A  GN++++  ++       + + + ++G +PL  A+  GH   + +
Sbjct:   91 IVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMN----------VATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLL---DRGAKIDTKTRDGLTPLHCAARSGHEKVIEM 296          

HSP 9 Score: 46.9802 bits (110), Expect = 2.210e-6
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH AA  GH  V E+LL   + + AK+K GL+PLH+
Sbjct:  264 LLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHM 317          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.355e-12
Identity = 55/215 (25.58%), Postives = 94/215 (43.72%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEF-----------LTRNHSTTKAKNL------------INLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            C++ L++  A V+D      T LH+ +  G+    K+LLD+ A+P  +   G + LH A K      ++ +L++           LT  H +    NL             N  N  GETA+H AA+  Q          ++++ LL NG  +    +   +TPLH  A  G  +++  ++   ++    +    NG++PL  A+  GH D   I
Sbjct:   54 CVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQ---------TEVVRSLLRNGAQVDAKAREE-QTPLHIAARLGKLEIVQLLL---QHMASPDAATSNGYTPLHVAAREGHEDVTAI 255          

HSP 2 Score: 37.3502 bits (85), Expect = 3.355e-12
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L++ A + V    G T LH+A++ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  256 LLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHV 309          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.593e-12
Identity = 49/152 (32.24%), Postives = 79/152 (51.97%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            +E LLK GA++    ++G T +H+ + +GNL+I+ +LL   A P +    G +ALH A +    A   E++  L RN +   A      K  E +T +H AA+L ++         +I+++LL++       T S G TPLH  A  G+ DV
Sbjct:   31 MELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAAR----AGQTEVVRSLLRNGAQVDA------KAREEQTPLHIAARLGKL---------EIVQLLLQHMASPDAAT-SNGYTPLHVAAREGHEDV 162          

HSP 2 Score: 37.7354 bits (86), Expect = 5.593e-12
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L++ A + V    G T LH+A++ G   VA +LL   +  +A  K GLTPLH+
Sbjct:  166 LLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHV 219          

HSP 3 Score: 42.3578 bits (98), Expect = 3.058e-9
Identity = 41/149 (27.52%), Postives = 67/149 (44.97%), Query Frame = 3
Query:   21 LLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDV 467
            LL+ GA+ N     GET LH+ +R G  ++++ LL   A   ++  E  + LH A +      V+ +L+ +    + T          + G T +H AA+              +  ILLE+G  + + TK  G TPLH  +  G  +V
Sbjct:   67 LLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAAT----------SNGYTPLHVAARE---------GHEDVTAILLEHGASLAVTTKK-GFTPLHVASKYGKMEV 195          

HSP 4 Score: 34.6538 bits (78), Expect = 3.058e-9
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ  A  D     G+T LH+A+   ++ VA +LL   +  +A +K G TPLH+
Sbjct:  199 LLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHI 252          

HSP 5 Score: 43.5134 bits (101), Expect = 2.800e-8
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ+ A  D     G T LH+AA +GH  V  +LL H + +   +K G TPLH+
Sbjct:  133 LLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHV 186          

HSP 6 Score: 30.4166 bits (67), Expect = 2.800e-8
Identity = 29/119 (24.37%), Postives = 53/119 (44.54%), Query Frame = 3
Query:  126 DEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            D+ A+P  +   G + LH A K      ++ +L++     + T++          G T +H +A +  +          I+ ILL+ GG     T   GET LH  A +G ++V+  ++
Sbjct:    3 DKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTES----------GLTPMHVSAFMGNL---------NIVLILLQ-GGASPNATNVRGETALHMAARAGQTEVVRSLL 101          

HSP 7 Score: 45.4394 bits (106), Expect = 8.269e-6
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  A  +     G+  LHL A++GH  VA +LLA  + VN  +K GL+PLHL
Sbjct:  265 LLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHL 318          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.800e-11
Identity = 58/213 (27.23%), Postives = 101/213 (47.42%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEI-----------LEFLTRNHSTTK------AKNLI------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            ++ LL  GA ++ K + G T LH  +R G+  ++++LL+  A   ++   G S LH A +  H ACV+ +           L++LT  H          AK L+      N +   G T +H A K  ++K         +M++LL++G  +   T+S G TP+H  +  G+ +V+  ++   +N   +N     G +PL  AS  G  + V+
Sbjct:  254 VKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIK---------VMELLLKHGASIHTTTES-GLTPIHVASFMGHLNVVQLLL---QNGASSNATNVRGETPLHMASRAGQLEVVK 453          

HSP 2 Score: 34.6538 bits (78), Expect = 1.800e-11
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            +LQ+ AR+ V      T LH+A+  G   + ++LL   S  NA +  G TPL+
Sbjct:  455 LLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLY 507          

HSP 3 Score: 43.1282 bits (100), Expect = 2.553e-11
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L  +A I +    G+TA+HLAA++    VAE+L  HK+ VN  +K   TPLH+
Sbjct:  655 LLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHV 708          

HSP 4 Score: 41.2022 bits (95), Expect = 2.553e-11
Identity = 60/220 (27.27%), Postives = 92/220 (41.82%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEA-------------------------QIMKILLENGGDMKIVTKSTGETPLHYCASSGN---SDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             ++TLL+SGA V  K +  +T LHI SRLG  +I++LLL   +DP +    G++ L+ A +  H      +LE        TK          +G T +H A+K  +++    + E                          Q + +LL + G     T   G TPLH  A         VL+E+        +TN   + G +PL  A+  GH D V +
Sbjct:  451 VVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTK----------KGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLEL------GAETNMLTQQGVAPLHLAAQEGHADMVAL 654          

HSP 5 Score: 47.7506 bits (112), Expect = 1.049e-10
Identity = 52/216 (24.07%), Postives = 98/216 (45.37%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAK-------------NLINL----------KNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +C++ LL   A V+D      T LH+ +  G+  + KLLLD   +P ++   G + LH A K      ++ +L+     H+TT++              N++ L           N  GET +H A++  Q+         +++K LL++G  + +  +   +TPLH  +  G ++++  ++   +     N    +G +PL +AS  GH D   +
Sbjct:  318 ACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQL---------EVVKTLLQSGARVGVKARED-QTPLHIASRLGKAEIVQLLL---QRGSDPNAPTASGSTPLYFASREGHGDVASL 520          

HSP 6 Score: 34.6538 bits (78), Expect = 1.049e-10
Identity = 21/56 (37.50%), Postives = 31/56 (55.36%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAK--SKCGLTPLHL 745
            +L+N A I      G T LH+A++ G   VA +LL   +  + K   + GLTPLH+
Sbjct:  521 LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHV 576          

HSP 7 Score: 46.9802 bits (110), Expect = 2.939e-10
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L   A+ID     G+T LH AA  GH  V E+LL   + + AK+K GL+PLH+
Sbjct:  257 LLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHM 310          

HSP 8 Score: 33.8834 bits (76), Expect = 2.939e-10
Identity = 55/220 (25.00%), Postives = 91/220 (41.36%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKI----------------------------VTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +  LLK  A ++   K G T LHI +  G  DI+++L++  A+  +Q   G + L+ A +  H     EI++FL           L N  N    T   F    V ++Q       Q++ +LLE+    K+                            VT  +G TPLH  A  GN +V   ++         +  A+NG +PL  A+  G+++ V++
Sbjct:   59 VVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHL----EIVKFL-----------LDNGANQSVATEDGFTPLAVALQQ----GHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLL---NLGAAVDFTARNGITPLHVAAKRGNNNMVKL 256          

HSP 9 Score: 39.6614 bits (91), Expect = 4.692e-9
Identity = 43/149 (28.86%), Postives = 72/149 (48.32%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            LK G ++N   + G   LH+ S+ G++D++  LL  +A+  +    GN+ALH A        V+ ++EF             IN ++  G T ++ AA      QE   +  +I+K LL+NG +  + T+  G TPL      G+  V+
Sbjct:   31 LKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGAN----------INAQSQNGFTPLYMAA------QE---NHLEIVKFLLDNGANQSVATED-GFTPLAVALQQGHEQVV 159          

HSP 10 Score: 36.965 bits (84), Expect = 4.692e-9
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQ+    DV    G T LH+AA  G+  VA +LL   + V+  ++ G+TPLH+
Sbjct:  191 LLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHV 244          

HSP 11 Score: 36.5798 bits (83), Expect = 5.384e-8
Identity = 52/210 (24.76%), Postives = 91/210 (43.33%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE-------------FLTRNHSTTKAKNLINLKNN------EGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            +  L++ GAN+N + + G T L++ ++  +L+I+K LLD  A+      +G + L  A++  H   V  +LE                R   T  A  L+  ++N       G T +H AA    M           +  LL N G     T   G TPLH  A  GN++++  ++       + + + ++G +PL  A+  GH   + +
Sbjct:   93 VRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMN----------VATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLL---DRGAKIDTKTRDGLTPLHCAARSGHEKVIEM 289          

HSP 12 Score: 36.5798 bits (83), Expect = 5.384e-8
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 2
Query:  572 CCPNILQNNARID-VFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C   +L   A +D V  D+ +T LH+AA  GH  VA++LL      NA++  G TPLH+
Sbjct:  319 CVQLLLGRQAPVDDVTLDY-LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHI 376          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 40.0466 bits (92), Expect = 4.836e-8
Identity = 49/192 (25.52%), Postives = 83/192 (43.23%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVR 581
            + +  LL   A +N+    G T LH+    G   ++  LLD  AD   +   G +ALH A    H A     LE L  +H+       +N ++ +G++ +H  A   +  +          + L++NGG++    K  G TPLH  A  G+  ++  ++    N     ++  +G  PL  A+  G  D  R
Sbjct:  127 TVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAIC---LELLVNHHAD------VNAQSYDGKSPLHMTAIHGRFTRS---------QTLIQNGGEIDCGDKE-GNTPLHIAARYGHELLINTLI---SNGADAARRGSHGMFPLHLAALSGFSDCCR 296          

HSP 2 Score: 32.7278 bits (73), Expect = 4.836e-8
Identity = 17/52 (32.69%), Postives = 26/52 (50.00%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCG 727
            CC  +L     +D  D+FG T LH AA  G+     +LL+  + +  K + G
Sbjct:  294 CCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYG 345          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO42780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Q6])

HSP 1 Score: 44.669 bits (104), Expect = 8.652e-6
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKST-GETPLHYCA 446
            C++ L  SGA++N +   G T L + +  G  D +  LL   AD     N G   LH+A  +     V  +L+ L  +H        IN ++ EG TA+H+AA             A+ +K+L+++  D +IV + T G+T LH+ A
Sbjct:   63 CVQFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAATYYSSGRTVGLLLQHLPSDH--------INKQDGEGMTALHWAAYH---------GRAEHVKLLIDH--DAEIVARDTEGKTALHWAA 190          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 49.6766 bits (117), Expect = 4.917e-13
Identity = 47/157 (29.94%), Postives = 73/157 (46.50%), Query Frame = 3
Query:   12 IETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            I  LL +GA      K G T LH+ S+ G +D+ +LLL+  A+P +    G + LH AV H +   VK ++      HST +           G T +H AAK  Q+         ++  +LL+NG      +   G TPLH  +  G  D++  ++
Sbjct:  517 IRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTAR----------NGYTPLHIAAKQNQI---------EVASVLLQNGASPNCESLQ-GITPLHLASQEGRPDMVAMLI 653          

HSP 2 Score: 42.743 bits (99), Expect = 4.917e-13
Identity = 19/54 (35.19%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            ++   A +++ +  G+T LHL A++GH  +A+ L+   + V A S+ G TPLH+
Sbjct:  652 LISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHV 705          

HSP 3 Score: 43.8986 bits (102), Expect = 8.287e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA   +  VA++LL   + VN   K G+TPLH+
Sbjct:  190 LLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHI 243          

HSP 4 Score: 33.8834 bits (76), Expect = 8.287e-9
Identity = 38/153 (24.84%), Postives = 75/153 (49.02%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            +K+G N+N   + G   LH+ S+ G++ ++  LL    +  +   +GN+ALH A        V E++ +             +N ++++G + ++ AA      QE   +  +++K LLENG +  + T+  G TPL      G+ +V+  ++
Sbjct:   30 IKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGAN----------VNAQSHKGFSPLYMAA------QE---NHLEVVKFLLENGANQSLPTED-GFTPLAVALQQGHENVVALLI 162          

HSP 5 Score: 38.1206 bits (87), Expect = 7.738e-7
Identity = 20/40 (50.00%), Postives = 26/40 (65.00%), Query Frame = 2
Query:  626 GMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            G T LH+A++ G   VAE+LL   +  NA  K GLTPLH+
Sbjct:  534 GFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHV 573          

HSP 6 Score: 33.113 bits (74), Expect = 7.738e-7
Identity = 50/215 (23.26%), Postives = 91/215 (42.33%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKA-----------------KNLI------NLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            C+  LL+  A ++D      T LH+ +  G+  + K+LLD+ A   ++   G + LH A K  H   +  +L+      + T++                 KNL+      N  N + ET +H A++             ++ + LL+N   +    K   +TPLH  A  G+ +++  ++    +K   +     G +PL  A+  GH   +RI
Sbjct:  318 CVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASR---------AGHCEVAQFLLQNAAQVDARAKDD-QTPLHCAARMGHKELVKLLL---DHKANPDSATTAGHTPLHIAAREGHIHTIRI 519          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 1.224e-11
Identity = 22/54 (40.74%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+  ++ID     G+T LH AA  GH  V E+LL   + + +K+K GL+PLH+
Sbjct:  263 LLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHM 316          

HSP 2 Score: 41.5874 bits (96), Expect = 1.224e-11
Identity = 54/206 (26.21%), Postives = 90/206 (43.69%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILE------FLTRNHSTTKAKNLIN--------LKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
             +  L+K GANV+   K G T LHI S  G  +++K L+   A+  +Q   G + L+ A +  H   V+ +LE        T +  T  A  L          L  N+ +  V   A  +  +++    + +   +LL+N  +  + +KS G TPLH  A  GN +V   ++          +      +PL  AS  G+ + VR+
Sbjct:   65 VVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD----DTKAAALLLQNDHNADVESKS-GFTPLHIAAHYGNINVATLLLNRGAAVDFKARND---ITPLHVASKRGNSNMVRL 262          

HSP 3 Score: 39.2762 bits (90), Expect = 3.916e-8
Identity = 22/54 (40.74%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN+   DV    G T LH+AA  G+  VA +LL   + V+ K++  +TPLH+
Sbjct:  197 LLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHV 250          

HSP 4 Score: 36.5798 bits (83), Expect = 3.916e-8
Identity = 40/149 (26.85%), Postives = 75/149 (50.34%), Query Frame = 3
Query:   24 LKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            L++G ++N   + G   LH+ S+ G+++++  L+ + A+  +   +GN+ALH A      A   E+++ L  N +       +N ++  G T ++ AA      QE   +   ++++LLENG    I T+  G TPL      G+  V+
Sbjct:   37 LQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIA----SLAGQTEVVKELVSNGAN------VNAQSQNGFTPLYMAA------QE---NHLDVVQLLLENGSSQSIATED-GFTPLAVALQQGHDQVV 165          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000005069.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 45.0542 bits (105), Expect = 1.762e-11
Identity = 41/156 (26.28%), Postives = 73/156 (46.79%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVL 470
            E  +  LLK  A+VN + K  +T LH+ +    +   + L+ +     S  N  + A  +A+ H  F+   E++  L    S       IN  + +   A+H+AA +  +         +++K+L+E+G ++    K  G +PLH  ASSG S  +
Sbjct:  130 EDAVAVLLKHSADVNARDKNWQTPLHVAASNKAVRCAEALVPQ----LSNVNVSDRAGRTALHHAAFSGHTEMVRLLLSRGSN------INAFDKKDRRAIHWAAYMGHL---------EVVKLLVESGAEVDCKDKK-GYSPLHAAASSGMSSTV 265          

HSP 2 Score: 41.9726 bits (97), Expect = 1.762e-11
Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAE-KGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            ++Q  A ++  ++ G +ALH A+  +   L  E+LLAH + +N++SK G TPLH+
Sbjct:  301 LIQAGANVNQVNERGFSALHFASSSRQGALCQELLLAHGACINSRSKDGKTPLHM 355          

HSP 3 Score: 34.2686 bits (77), Expect = 6.968e-6
Identity = 22/57 (38.60%), Postives = 28/57 (49.12%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            CC  +L +   ID  D+FG T LH AA  G+     +LL   +  N K   G  PLH
Sbjct:  430 CCRKLLSSGFVIDTPDEFGRTCLHAAAAGGNLECLNLLLNVGADFNRKDHFGRAPLH 486          

HSP 4 Score: 33.4982 bits (75), Expect = 6.968e-6
Identity = 45/160 (28.12%), Postives = 72/160 (45.00%), Query Frame = 3
Query:    6 SCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNE-GNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIV 482
            S +  LL  G +VN+    G T LH+    G   ++  L+   A+  +Q NE G SALH A   R  A  +E+L               IN ++ +G+T +H AA         S S+A     L++NG ++    K+   T LH  A  G+  ++  ++
Sbjct:  263 STVHYLLGLGVHVNEANSYGNTPLHLACYNGQDVVVGELIQAGAN-VNQVNERGFSALHFASSSRQGALCQELL---------LAHGACINSRSKDGKTPLHMAAT----HGRFSCSQA-----LIQNGAEVDCEDKNR-NTALHIAARYGHELIITALL 402          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 45.4394 bits (106), Expect = 6.859e-11
Identity = 57/221 (25.79%), Postives = 98/221 (44.34%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXX-XXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEI-----LEFLTRNHSTTKAKNLINLKNNEGE-TAVHFAAK---------LVQMKQELSISEAQ---------------IMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            C+  L+ SGA+VND  + G T LH  +        L+ LL   A+P  + N+G +A+H A  + H  C++ I     L+ L      T   +++N  +     + +H AA          LVQ   +L +  +Q                + +L+  G  + +   +   TP+H  A++G+S+ L  ++ N   +   + Q  NG +PL+ A   GH D V
Sbjct:  453 CLFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLME----TSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCV 669          

HSP 2 Score: 39.6614 bits (91), Expect = 6.859e-11
Identity = 21/58 (36.21%), Postives = 29/58 (50.00%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  ++L   A ++  D +G TALH  A  GH    E LL H +    +   G TP+HL
Sbjct:  668 CVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHL 725          

HSP 3 Score: 38.5058 bits (88), Expect = 2.321e-6
Identity = 51/210 (24.29%), Postives = 89/210 (42.38%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNL---------------------------INLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASS 557
            C+E L+ +GA+VN K K G+T LH+ +  G     + +++  A+   +   GN+ LH A ++ H    + ++  L  N + T  + +                           I+  ++ G T +H AA         +    + + +LL  G D      S G TPLHY A++ N   L  +V    +    N   + G +PL YA++
Sbjct:  288 CLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGH----ELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAA---------AGGNLECLNLLLNTGADFN-RKDSFGRTPLHYAAANCNYQCLFALV---GSGASVNDLDERGCTPLHYAAA 480          

HSP 4 Score: 31.187 bits (69), Expect = 2.321e-6
Identity = 14/38 (36.84%), Postives = 23/38 (60.53%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVL 685
            C   +L+N+A   + D+ G  A+H A+  GHRL  E++
Sbjct:  487 CLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELI 524          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 45.4394 bits (106), Expect = 6.972e-11
Identity = 57/221 (25.79%), Postives = 98/221 (44.34%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXX-XXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEI-----LEFLTRNHSTTKAKNLINLKNNEGE-TAVHFAAK---------LVQMKQELSISEAQ---------------IMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAV 578
            C+  L+ SGA+VND  + G T LH  +        L+ LL   A+P  + N+G +A+H A  + H  C++ I     L+ L      T   +++N  +     + +H AA          LVQ   +L +  +Q                + +L+  G  + +   +   TP+H  A++G+S+ L  ++ N   +   + Q  NG +PL+ A   GH D V
Sbjct:  453 CLFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLME----TSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCV 669          

HSP 2 Score: 39.6614 bits (91), Expect = 6.972e-11
Identity = 21/58 (36.21%), Postives = 29/58 (50.00%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            C  ++L   A ++  D +G TALH  A  GH    E LL H +    +   G TP+HL
Sbjct:  668 CVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHL 725          

HSP 3 Score: 38.5058 bits (88), Expect = 2.321e-6
Identity = 51/210 (24.29%), Postives = 89/210 (42.38%), Query Frame = 3
Query:    9 CIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNL---------------------------INLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASS 557
            C+E L+ +GA+VN K K G+T LH+ +  G     + +++  A+   +   GN+ LH A ++ H    + ++  L  N + T  + +                           I+  ++ G T +H AA         +    + + +LL  G D      S G TPLHY A++ N   L  +V    +    N   + G +PL YA++
Sbjct:  288 CLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGH----ELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAA---------AGGNLECLNLLLNTGADFN-RKDSFGRTPLHYAAANCNYQCLFALV---GSGASVNDLDERGCTPLHYAAA 480          

HSP 4 Score: 31.187 bits (69), Expect = 2.321e-6
Identity = 14/38 (36.84%), Postives = 23/38 (60.53%), Query Frame = 2
Query:  572 CCPNILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVL 685
            C   +L+N+A   + D+ G  A+H A+  GHRL  E++
Sbjct:  487 CLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELI 524          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 186.037 bits (471), Expect = 1.098e-67
Identity = 111/196 (56.63%), Postives = 139/196 (70.92%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXX--XXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E C E LLKSGANVN+ +K GE+ LHI SR GNL++LK LL E ADP   C +GNS LH  V++ H+  V+E++ F  +  S   A  L+NL NNEGETAVHFAA+LVQ ++     +  I+K+LLE  GD+KI TK T ETPLHYCA++GNSDVL+EIV     K ++  NKQAKNGWSPLL+AS  GHH+ V I
Sbjct:  646 EKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSI 841          

HSP 2 Score: 89.7373 bits (221), Expect = 1.098e-67
Identity = 43/54 (79.63%), Postives = 49/54 (90.74%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+NNAR+DVFD+ GMTALHLAAEKGH+ VA VLL HK+FVNAKSK GLTPLHL
Sbjct:  842 LLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHL 895          

HSP 3 Score: 52.7582 bits (125), Expect = 5.938e-12
Identity = 56/178 (31.46%), Postives = 85/178 (47.75%), Query Frame = 3
Query:   60 TGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMK---QELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            TG T LH+ +  G+  ++K+LLD  A+P  + N+G + LH A K+ HF     +LE L    S         + N  G T +H AA   Q+    + L+   A I     + G  MK V   +G TPLH  + SG+ + L+ ++ N       +    NG +PL +AS  GH +   I
Sbjct: 1028 TGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHF----HLLEVLKPKISFRV------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHEN-LVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSI 1194          

HSP 4 Score: 35.8094 bits (81), Expect = 5.938e-12
Identity = 18/42 (42.86%), Postives = 24/42 (57.14%), Query Frame = 2
Query:  620 DF-GMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            DF G TALH A+  GH  +A + +   + +NA    G TPLH
Sbjct: 1207 DFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLH 1248          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 186.037 bits (471), Expect = 1.164e-67
Identity = 111/196 (56.63%), Postives = 139/196 (70.92%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXX--XXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E C E LLKSGANVN+ +K GE+ LHI SR GNL++LK LL E ADP   C +GNS LH  V++ H+  V+E++ F  +  S   A  L+NL NNEGETAVHFAA+LVQ ++     +  I+K+LLE  GD+KI TK T ETPLHYCA++GNSDVL+EIV     K ++  NKQAKNGWSPLL+AS  GHH+ V I
Sbjct:  646 EKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSI 841          

HSP 2 Score: 89.3521 bits (220), Expect = 1.164e-67
Identity = 43/54 (79.63%), Postives = 49/54 (90.74%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+NNAR+DVFD+ GMTALHLAAEKGH+ VA VLL HK+FVNAKSK GLTPLHL
Sbjct:  842 LLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHL 895          

HSP 3 Score: 52.373 bits (124), Expect = 6.870e-12
Identity = 56/178 (31.46%), Postives = 85/178 (47.75%), Query Frame = 3
Query:   60 TGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMK---QELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            TG T LH+ +  G+  ++K+LLD  A+P  + N+G + LH A K+ HF     +LE L    S         + N  G T +H AA   Q+    + L+   A I     + G  MK V   +G TPLH  + SG+ + L+ ++ N       +    NG +PL +AS  GH +   I
Sbjct: 1028 TGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHF----HLLEVLKPKISFRV------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHEN-LVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSI 1194          

HSP 4 Score: 35.8094 bits (81), Expect = 6.870e-12
Identity = 18/42 (42.86%), Postives = 24/42 (57.14%), Query Frame = 2
Query:  620 DF-GMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            DF G TALH A+  GH  +A + +   + +NA    G TPLH
Sbjct: 1207 DFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLH 1248          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 185.652 bits (470), Expect = 1.387e-67
Identity = 111/196 (56.63%), Postives = 139/196 (70.92%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXX--XXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            E C E LLKSGANVN+ +K GE+ LHI SR GNL++LK LL E ADP   C +GNS LH  V++ H+  V+E++ F  +  S   A  L+NL NNEGETAVHFAA+LVQ ++     +  I+K+LLE  GD+KI TK T ETPLHYCA++GNSDVL+EIV     K ++  NKQAKNGWSPLL+AS  GHH+ V I
Sbjct:  646 EKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSI 841          

HSP 2 Score: 89.7373 bits (221), Expect = 1.387e-67
Identity = 43/54 (79.63%), Postives = 49/54 (90.74%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +L+NNAR+DVFD+ GMTALHLAAEKGH+ VA VLL HK+FVNAKSK GLTPLHL
Sbjct:  842 LLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHL 895          

HSP 3 Score: 53.1434 bits (126), Expect = 5.027e-12
Identity = 56/178 (31.46%), Postives = 85/178 (47.75%), Query Frame = 3
Query:   60 TGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMK---QELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXXXXXXXXXXGWSPLLYASSCGHHDAVRI 584
            TG T LH+ +  G+  ++K+LLD  A+P  + N+G + LH A K+ HF     +LE L    S         + N  G T +H AA   Q+    + L+   A I     + G  MK V   +G TPLH  + SG+ + L+ ++ N       +    NG +PL +AS  GH +   I
Sbjct: 1028 TGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHF----HLLEVLKPKISFRV------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHEN-LVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSI 1194          

HSP 4 Score: 35.4242 bits (80), Expect = 5.027e-12
Identity = 18/42 (42.86%), Postives = 24/42 (57.14%), Query Frame = 2
Query:  620 DF-GMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLH 742
            DF G TALH A+  GH  +A + +   + +NA    G TPLH
Sbjct: 1207 DFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLH 1248          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 178.333 bits (451), Expect = 4.377e-65
Identity = 104/196 (53.06%), Postives = 139/196 (70.92%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXX--XXXXXXXXGWSPLLYASSCGHHDAVRI 584
            ++C E LLKSGANVN  +KTGETVLH++S++GNL+++K L +E A P  QCNEGNS+ H AVK+ HF  VKE ++F+ +N +    KN+IN  N  GET++HFA KL +        +  I+K+LLENGGD+KI      E+PLHYCA++GNSD+L EIV+   N++    NKQ KNGWSPLL+AS  GHH +V I
Sbjct:  616 DNCFEMLLKSGANVNAVMKTGETVLHVVSKMGNLEMVKSLFNEGACPIIQCNEGNSSFHVAVKNCHFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDNDESPLHYCAAAGNSDILTEIVQFYGNEMHNFVNKQTKNGWSPLLFASDNGHHKSVEI 811          

HSP 2 Score: 88.5817 bits (218), Expect = 4.377e-65
Identity = 40/54 (74.07%), Postives = 50/54 (92.59%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN++R+D+FD++GMTALHLAAEKGH  VAE+LL +KSFVNAKSK GLTPLH+
Sbjct:  812 LLQNDSRVDLFDEYGMTALHLAAEKGHSEVAEILLTNKSFVNAKSKHGLTPLHM 865          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 178.333 bits (451), Expect = 4.451e-65
Identity = 104/196 (53.06%), Postives = 139/196 (70.92%), Query Frame = 3
Query:    3 ESCIETLLKSGANVNDKIKTGETVLHILSRXXXXXXXXXXXDEKADPFSQCNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETAVHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASSGNSDVLMEIVXXXXXXX--XXXXXXXXGWSPLLYASSCGHHDAVRI 584
            ++C E LLKSGANVN  +KTGETVLH++S++GNL+++K L +E A P  QCNEGNS+ H AVK+ HF  VKE ++F+ +N +    KN+IN  N  GET++HFA KL +        +  I+K+LLENGGD+KI      E+PLHYCA++GNSD+L EIV+   N++    NKQ KNGWSPLL+AS  GHH +V I
Sbjct:  589 DNCFEMLLKSGANVNAVMKTGETVLHVVSKMGNLEMVKSLFNEGACPIIQCNEGNSSFHVAVKNCHFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDNDESPLHYCAAAGNSDILTEIVQFYGNEMHNFVNKQTKNGWSPLLFASDNGHHKSVEI 784          

HSP 2 Score: 88.5817 bits (218), Expect = 4.451e-65
Identity = 40/54 (74.07%), Postives = 50/54 (92.59%), Query Frame = 2
Query:  584 ILQNNARIDVFDDFGMTALHLAAEKGHRLVAEVLLAHKSFVNAKSKCGLTPLHL 745
            +LQN++R+D+FD++GMTALHLAAEKGH  VAE+LL +KSFVNAKSK GLTPLH+
Sbjct:  785 LLQNDSRVDLFDEYGMTALHLAAEKGHSEVAEILLTNKSFVNAKSKHGLTPLHM 838          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK35.641e-1326.42ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK36.021e-1326.42ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK38.509e-1326.54ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK21.729e-1127.60ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.452e-1039.66ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-47.442e-3337.57TRP (Transient receptor potential) channel family ... [more]
unc-441.198e-1144.44AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.198e-1144.44AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.228e-1144.44AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.228e-1144.44AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nompC6.468e-3036.92gene:FBgn0016920 transcript:FBtr0347408[more]
nompC6.966e-3036.92gene:FBgn0016920 transcript:FBtr0347409[more]
nompC7.442e-3036.92gene:FBgn0016920 transcript:FBtr0343224[more]
nompC4.306e-2936.92gene:FBgn0016920 transcript:FBtr0304843[more]
nompC4.873e-2936.92gene:FBgn0016920 transcript:FBtr0300012[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX469921.16.751e-1223.15ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a7.032e-1223.15ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a7.032e-1223.15ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.11.276e-1123.26ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ankrd52a1.471e-1126.84ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx141.370e-3068.52sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
snx142.971e-3068.52sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
tpm49.111e-1425.00tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm49.263e-1425.00tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm49.344e-1425.00tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank32.108e-1327.01ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.539e-1326.89ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.561e-1326.89ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.689e-1326.89ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.689e-1326.89ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4UMH6|Y381_RICFE2.568e-1330.97Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|G5E8K5|ANK3_MOUSE1.540e-1226.89Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT2.034e-1226.54Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q12955|ANK3_HUMAN3.582e-1226.54Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|Q502K3|ANR52_DANRE8.397e-1126.84Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QCS61.278e-4946.19Ankyrin-1 OS=Crassostrea gigas OX=29159 GN=CGI_100... [more]
A0A210QIK22.830e-4845.92Ankyrin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
A0A0L8G8174.877e-4743.65ANK_REP_REGION domain-containing protein (Fragment... [more]
T1IHG81.191e-4442.64ANK_REP_REGION domain-containing protein OS=Striga... [more]
A0A1D1VIN02.061e-4442.35ANK_REP_REGION domain-containing protein OS=Ramazz... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048767.17.333e-3939.09serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSAMXT00000016978.27.770e-3939.09serine/threonine-protein phosphatase 6 regulatory ... [more]
ank3b1.051e-1332.45ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ENSAMXT00000048191.11.070e-1127.37pep primary_assembly:Astyanax_mexicanus-2.0:15:310... [more]
ank3a2.739e-1123.15ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.11.330e-1224.07pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.13.355e-1225.58pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.15.593e-1232.24pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000000095.11.800e-1127.23pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007954.14.836e-825.52pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO427808.652e-630.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b4.917e-1329.94ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000040233.11.224e-1140.74pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
ENSORLT00000005069.21.762e-1126.28serine/threonine-protein phosphatase 6 regulatory ... [more]
ankrd28b6.859e-1125.79ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b6.972e-1125.79ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020706.11.098e-6756.63SMESG000020706.1[more]
SMESG000020706.11.164e-6756.63SMESG000020706.1[more]
SMESG000020706.11.387e-6756.63SMESG000020706.1[more]
SMESG000020709.14.377e-6553.06SMESG000020709.1[more]
SMESG000020709.14.451e-6553.06SMESG000020709.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002065 ID=SMED30002065|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=747bp
GAGAAAGTTGCATTGAAACATTATTAAAAAGTGGTGCAAATGTGAATGAT
AAAATAAAAACCGGAGAAACAGTGCTTCATATTCTATCAAGATTGGGGAA
TTTAGATATTCTAAAGTTGTTATTGGATGAAAAAGCGGATCCATTTTCTC
AATGTAACGAAGGGAATAGTGCTTTGCACAGTGCAGTTAAACATAGACAT
TTTGCATGTGTGAAAGAAATTTTGGAGTTTTTAACAAGAAATCACTCGAC
GACCAAAGCAAAGAATTTAATCAATCTAAAAAATAATGAAGGAGAAACAG
CAGTTCATTTTGCTGCGAAATTAGTTCAAATGAAACAAGAATTGAGTATA
AGTGAAGCTCAAATTATGAAAATATTATTAGAAAATGGAGGAGATATGAA
AATCGTGACAAAATCTACAGGTGAAACTCCTTTGCATTATTGTGCATCTT
CAGGTAATTCTGACGTATTGATGGAAATCGTCAAAAACCAAAAAAATAAA
ATTCAAACAAACAAACAAGCAAAGAATGGCTGGTCACCTTTATTATATGC
AAGTAGTTGTGGACATCATGATGCTGTCCGAATATTCTTCAAAACAATGC
TAGAATTGATGTTTTTGATGACTTTGGAATGACAGCCCTTCACTTGGCGG
CAGAGAAAGGACATCGCTTAGTTGCTGAAGTATTGTTGGCTCATAAATCT
TTCGTTAATGCAAAATCAAAATGCGGATTAACACCTTTGCATTTGGC
back to top

protein sequence of SMED30002065-orf-1

>SMED30002065-orf-1 ID=SMED30002065-orf-1|Name=SMED30002065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
ESCIETLLKSGANVNDKIKTGETVLHILSRLGNLDILKLLLDEKADPFSQ
CNEGNSALHSAVKHRHFACVKEILEFLTRNHSTTKAKNLINLKNNEGETA
VHFAAKLVQMKQELSISEAQIMKILLENGGDMKIVTKSTGETPLHYCASS
GNSDVLMEIVKNQKNKIQTNKQAKNGWSPLLYASSCGHHDAVRIFFKTML
ELMFLMTLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005262calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0070588calcium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 139..168
e-value: 0.35
score: 19.9
coord: 96..134
e-value: 190.0
score: 10.5
coord: 175..204
e-value: 0.001
score: 28.3
coord: 53..83
e-value: 3.1
score: 16.8
coord: 20..49
e-value: 0.0063
score: 25.7
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 20..52
score: 9.725
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 139..171
score: 8.603
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 96..137
score: 9.297
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 175..207
score: 10.74
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..210
e-value: 3.9E-48
score: 166.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 2..209
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 3..75
e-value: 1.4E-12
score: 48.0
coord: 120..206
e-value: 5.2E-14
score: 52.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..210
score: 40.346
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 2..75
coord: 66..209