Doublecortin domain-containing protein 2

Overview
NameDoublecortin domain-containing protein 2
Smed IDSMED30002064
Length (bp)2532
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Doublecortin domain-containing protein 2 (SMED30002064) t-SNE clustered cells

Violin plots show distribution of expression levels for Doublecortin domain-containing protein 2 (SMED30002064) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Doublecortin domain-containing protein 2 (SMED30002064) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Doublecortin domain-containing protein 2 (SMED30002064) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002064

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
ciliated epithelial cellSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002064SMESG000079430.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 Contig14992newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002064SMESG000079430.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 Contig14992uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v6_6464_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v6_6464_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30002064SMESG000040481.1 SMESG000038137.1 Contig36798newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002064SMESG000040481.1 SMESG000038137.1 Contig36798uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30002064SMESG000040482.1 SMESG000040481.1 SMESG000040480.1 SMESG000038137.1 dd_Smed_v4_6464_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Human
Match: DCDC2 (doublecortin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18141])

HSP 1 Score: 124.02 bits (310), Expect = 3.284e-29
Identity = 90/358 (25.14%), Postives = 180/358 (50.28%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDK-IESRITQNLYTKSNI-----IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPK---------NSEKRSLKKQ----KNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQD 1158
            +VK++L+++NGD ++ G+RVV+++K   ++E FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA  + E+ K +NY   +++  +         + +P+ + N ++   I SRI  +   +  +     I++  NGD   PA +++I  +       +++ + +++ L+ +  + R+YTL G+++    ++ENG+FYVA   + F+ + Y ++L      R P  +      + +P     ++S+GS N+  +  +  S +++  +P          NSEK +  KQ    KN  E      +  F+    R E   A E  E   +   V +P + +P      E+D
Sbjct:   15 VVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQ-EAFKKLNY---LDIGEI---------KKRPMEVVNTEVKPVIHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLR-SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKA----SSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQE--DEDTQVEVPVDQRPAEIVDEEED 352          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Human
Match: DCDC2B (doublecortin domain containing 2B [Source:HGNC Symbol;Acc:HGNC:32576])

HSP 1 Score: 99.7525 bits (247), Expect = 6.768e-22
Identity = 72/276 (26.09%), Postives = 128/276 (46.38%), Query Frame = 1
Query:  136 SVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTK---SNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKP 954
            S   K +++++NGD +FPG ++VV ++  P  E FL ++T ++     A+R + TP HG  + +L DL   G+YVA           +++   ++ LPH  K     S RL+   +     D    R  Q      + I+VF+NGD  +P   + +     +    ++K + ++V LQ    + ++ TL G  +   K++  G +YVA   + F+++ Y ++L       VPS  +  +   Q P  KS    QG+             E  ++KP
Sbjct:    5 SPAAKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQ-APLAVRALYTPCHGHPVTNLADLKNRGQYVA---------AGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGR--QLPAGAPSYIHVFRNGDLVSPPFSLKLSQAASQDWETVLKLLTEKVKLQSGA-VCKLCTLEGLPLSAGKELVTGHYYVAVGEDEFKDLPYLELL-------VPSP-SLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKP 259          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Human
Match: DCDC2C (doublecortin domain containing 2C [Source:HGNC Symbol;Acc:HGNC:32696])

HSP 1 Score: 90.8929 bits (224), Expect = 6.633e-19
Identity = 65/240 (27.08%), Postives = 125/240 (52.08%), Query Frame = 1
Query:  112 KNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLR-LANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSK 828
            + P    ++   K I++++NGD ++ GK+ V++++    +E  LE +T+ ++   G +R + TP  G R+  L+ L   GKYVA  + E  K ++Y     ++ +P    +   +LK ++ + + DI+ + S+  Q  +  S  I VF NG  F P  K++I         +++  I ++V       +R+++T+NG ++  +KD+++  FYVA   E F      +  P  +  RVPS+
Sbjct:    4 RGPSAPVDTTPAKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLTEQVDVPFG-VRRLFTPTRGHRVLGLDALQAGGKYVAAGR-ERFKELDY-----IHIVPRKP-AKIRKLKEIKPVVHCDIN-VPSK-WQTYHRISRHINVFTNGRLFIPPAKIIIPKFSLSDWDIVLATIGEKVFPLGG--VRKLFTMNGHLLGDSKDLQDNHFYVAVGLETF------KYFPYWKSPRVPSE 225          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Human
Match: ASPM (abnormal spindle microtubule assembly [Source:HGNC Symbol;Acc:HGNC:19048])

HSP 1 Score: 61.2326 bits (147), Expect = 1.017e-8
Identity = 89/353 (25.21%), Postives = 140/353 (39.66%), Query Frame = 1
Query: 1315 NKAATKIQAGFRGYQTRQRL-KFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTR---HTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXR----------------IQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI-----SEKPVTKPKS----LSPEEQAQERNDAAAKIQAAFRGH 2286
            NKAA  IQ+ +R Y+T+++   +    I   +  +  K      +T+ +  +Y    K A KIQ+ +RG   R+                                 + + M +AA  I+A F+ +Q+R   HT++          R    GK Q      K   I KAV  +QA FRG R+R +L+    AA  IQ+ +R Y+ +    +  +  +          +R                IQA FRG K R     +  K    AA  IQ  FR    R+ F+   K+A  IQ  +R++   K        +  V K +S        ++ +E + AA  IQ+ FR H
Sbjct: 2044 NKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIK------ITNHQHKEYLNLKKTAIKIQSVYRGIRVRR---------------------------------HIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQ----REKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKAR-----RHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQSTFRMH 2348          

HSP 2 Score: 58.9214 bits (141), Expect = 5.117e-8
Identity = 39/129 (30.23%), Postives = 68/129 (52.71%), Query Frame = 1
Query: 1795 EIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKE 2181
            +++KA   +QA +RGY++R  +K +  AA +IQ+ FRGY  R               +  ++  +IQ  +R +KT            + A I +Q+ +RG+K RK+   + ++A KIQ+ FR  K +K+
Sbjct: 1800 QVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKR-----------VKYQSVLQSIIKIQRWYRAYKT-LHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQ 1916          

HSP 3 Score: 56.9954 bits (136), Expect = 1.805e-7
Identity = 92/372 (24.73%), Postives = 156/372 (41.94%), Query Frame = 1
Query: 1318 KAATKIQAGFRGYQTRQRLK---------------FNKPEIKQSKISQNPKKSQPESLTSEKESD---YNIKDKAAA-KIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGY-----------QTRH---TLQNKVPRKTNNEREKQNGKN--------QEPTNENKDKEIEKAVITIQAGFRGYRI---RNSLKVRDKAAQ-RIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKT----RKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGH 2286
            KAAT +QA +RGY+ RQ +K               +NK  +K   + Q+  K Q      +   D   + +K KAA   +Q+ +RG+  R+ ++ +           +  K Q+  R+ +T          AA++IQ +FR +           + RH    LQ+    KT   + ++  K         +    + K K ++KA + IQ  +R Y I   +N L ++ KAA   +Q+ +RG + R+ +K  N+               IQ+ +R +KT+K+               IQ  +RG K      KE++   K+A KIQ+ +R  + R+ I                 Q  + AA  I+A F+ H
Sbjct: 1803 KAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNK-RVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKT----------AALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVT-----------IQSKYRAYKTKKKYATYRASAII-----IQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHI-----------------QHMHRAATFIKAMFKMH 2130          

HSP 4 Score: 53.1434 bits (126), Expect = 3.041e-6
Identity = 88/351 (25.07%), Postives = 143/351 (40.74%), Query Frame = 1
Query: 1318 KAATKIQAGFRGYQTRQRLK-------FNKPEIK--QSKISQNPKKSQPESLTSEKESDYNIKD---------KAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS*II 2316
            K A KIQ+ +RG + R+ ++       F K   K  QS+IS +  +     +     + Y  K          KA   +QA FRG   R+ L+                                  M+ AA +IQ+++R Y+ + T  NK+ + T   +++     +      +  ++  +VI IQA FRG + R  LK+   AA  IQ  FR    RR              + ++ A  IQ  +R         + +    +NA IKIQ+ +R +  RK      ++A  IQ+ FR ++           K  S+  ++Q Q   + AAK+Q   R H  R+ HS +I
Sbjct: 2095 KTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQREKYLTILKAVKVLQASFRGVRVRRTLRK---------------------------------MQTAATLIQSNYRRYR-QQTYFNKLKKITKTVQQRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRR-----------RFLSLKKTAILIQRKYRAHLC--TKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQA---LKQASVVIQQQYQA--NRAAKLQ---RQHYLRQRHSAVI 2390          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Human
Match: DCDC2 (doublecortin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18141])

HSP 1 Score: 51.6026 bits (122), Expect = 1.295e-7
Identity = 24/67 (35.82%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  199 VVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINY 399
            VV+++K   ++E FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA  + E+ K +NY
Sbjct:    2 VVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQ-EAFKKLNY 67          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Celegans
Match: rpi-1 (pep chromosome:WBcel235:II:13959239:13962417:-1 gene:WBGene00012332.1 transcript:W07G1.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rpi-1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.297e-9
Identity = 31/83 (37.35%), Postives = 51/83 (61.45%), Query Frame = 1
Query:  541 IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQ 789
            I ++KNGDR+   +K VI  +  K M  L+  + DR+ L      +++YT +G+I+   K++E+GK YVAAS + F  + YG+
Sbjct:   37 ISIYKNGDRYHRGVKFVINPRVIKDMEPLLNQVNDRIELSHG--AKKLYTTDGKIVNSIKELEDGKIYVAASAQ-FIPMRYGE 116          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Celegans
Match: rpi-1 (pep chromosome:WBcel235:II:13959239:13962417:-1 gene:WBGene00012332.1 transcript:W07G1.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rpi-1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.400e-9
Identity = 31/83 (37.35%), Postives = 51/83 (61.45%), Query Frame = 1
Query:  541 IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQ 789
            I ++KNGDR+   +K VI  +  K M  L+  + DR+ L      +++YT +G+I+   K++E+GK YVAAS + F  + YG+
Sbjct:   37 ISIYKNGDRYHRGVKFVINPRVIKDMEPLLNQVNDRIELSHG--AKKLYTTDGKIVNSIKELEDGKIYVAASAQ-FIPMRYGE 116          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Celegans
Match: C06C3.3 (pep chromosome:WBcel235:II:9369178:9372485:-1 gene:WBGene00007374.1 transcript:C06C3.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06C3.3)

HSP 1 Score: 60.8474 bits (146), Expect = 3.339e-9
Identity = 32/92 (34.78%), Postives = 48/92 (52.17%), Query Frame = 1
Query:  541 IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGR 816
            I VF+NGD F     +V+  ++ KH  V + A+ D  LL+    +RR++T  G  + +  D+E    YVA    PF N+ YGQ    +R  R
Sbjct:   19 IRVFRNGDMFDHGRILVVTRKQFKHWIVFLDALTD--LLRTATAVRRLFTTQGIPVHHFDDLETNGEYVAVETGPFVNVPYGQARFTLRLKR 108          

HSP 2 Score: 51.2174 bits (121), Expect = 3.242e-6
Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  154 ILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKG 375
            I +F+NGD +  G+ +VV +K   +W  FL+ +T  L     A+R + T   G  +   +DL TNG+YVA+  G
Sbjct:   19 IRVFRNGDMFDHGRILVVTRKQFKHWIVFLDALTDLLRTAT-AVRRLFT-TQGIPVHHFDDLETNGEYVAVETG 90          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Fly
Match: CG14687 (gene:FBgn0037835 transcript:FBtr0082280)

HSP 1 Score: 71.2478 bits (173), Expect = 2.905e-14
Identity = 44/114 (38.60%), Postives = 61/114 (53.51%), Query Frame = 1
Query: 1648 EKAAVIIQASFRGYQTRHTLQ----NKVPRKTNNEREKQNG---------------KNQEPTNENKDKEIE-KAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRIL 1929
            E AA+ IQA FRGY+ R  +     N  PR+   +R K NG               ++Q    EN  K +E ++   IQAGFRG+ +R   K+   AA +IQAGFRG++TR+ L
Sbjct:   18 ESAAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQRQRPKNNGLMENQNNTGNPRPSGEDQHTATENGGKSVEDRSATKIQAGFRGFLVRKKQKIATDAAVKIQAGFRGFKTRKEL 131          

HSP 2 Score: 54.299 bits (129), Expect = 1.953e-8
Identity = 54/181 (29.83%), Postives = 78/181 (43.09%), Query Frame = 1
Query: 1000 EIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILK 1542
            E AA KIQA FRG++ RKEI ++ +N  P P+++     +  +PKN    E   N      +   E++        T+N  ++VE                    +++ATKIQAGFRG+  R++ K                                I   AA KIQAGFRG+ TR+ LK
Sbjct:   18 ESAAIKIQAGFRGYRVRKEIHRSSKN--PHPRRN-----QRQRPKNNGLMENQNN--TGNPRPSGEDQHT-----ATENGGKSVE--------------------DRSATKIQAGFRGFLVRKKQK--------------------------------IATDAAVKIQAGFRGFKTRKELK 132          

HSP 3 Score: 51.2174 bits (121), Expect = 2.658e-7
Identity = 45/151 (29.80%), Postives = 66/151 (43.71%), Query Frame = 1
Query: 1321 AATKIQAGFRGYQTR-----------------QRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVP 1722
            AA KIQAGFRGY+ R                 QR K N   ++    + NP+ S  +  T+ +    +++D++A KIQAGFRG+  R+  K +++                                 AAV IQA FRG++TR  L+   P
Sbjct:   20 AAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQRQRPK-NNGLMENQNNTGNPRPSGEDQHTATENGGKSVEDRSATKIQAGFRGFLVRK--KQKIAT-------------------------------DAAVKIQAGFRGFKTRKELKQCEP 136          

HSP 4 Score: 47.7506 bits (112), Expect = 4.284e-6
Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = 1
Query: 2074 IQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI 2184
            IQAGFRG+  RK+  +   +A KIQAGFR +KTRKE+
Sbjct:   95 IQAGFRGFLVRKKQKIATDAAVKIQAGFRGFKTRKEL 131          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Zebrafish
Match: dcdc2b (doublecortin domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-051113-124])

HSP 1 Score: 110.153 bits (274), Expect = 5.619e-25
Identity = 66/217 (30.41%), Postives = 120/217 (55.30%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL 795
            VK++++++NGD +F G+R VVN++     +  L DIT ++     A+R + TP +G R+  L DL    +YVA +  E  K ++Y  A  +      T+S +       LA  ++    S   + + T   II+VF+NGD  +PA++++I     K++  ++  I ++ +L+    +RRI TL G  +  A+++E G+ YVA  +E F+ + Y ++L
Sbjct:   13 VKSVMVYRNGDPFFSGRRFVVNQRQIATMDALLNDITLNIGA-PLAVRTLYTPRYGHRVADLGDLQQGAQYVA-AGSERFKKLDYLSA-GLKKAVEPTQSKT-------LARPNV----SAKWRKVITLPCIIHVFRNGDILSPAMRLIIPRHMLKNLEQILSLISEKAMLRTG-AVRRICTLEGFTVTSAEELETGQCYVAVGSERFKKLPYVEIL 214          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Zebrafish
Match: si:dkey-25g12.4 (si:dkey-25g12.4 [Source:ZFIN;Acc:ZDB-GENE-160113-73])

HSP 1 Score: 97.4413 bits (241), Expect = 3.203e-21
Identity = 72/256 (28.12%), Postives = 128/256 (50.00%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRIT-----QNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEY------GQV--LPVIRGGRVPSKRNKIKFLNQMPSPKSD 876
            K + +F+NGD ++PG+R ++N++ +  ++ FL  +T+ +    GA+R++ TP +G R+ SL+ L     YVA + GE LK ++Y+   N+   P   KS S  ++P+         + SRI      + +  +S  I VF NGD   P  +++I          ++  + ++V L+    + R+  LNG  +R A +++N   YVA   E F ++ Y      G +    VI    +PS+R + +  N    P  D
Sbjct:   10 KTVTVFRNGDAFYPGRRFIINQRQSVTFDTFLNTVTRDITAPFGAVRNIYTP-NGHRVVSLQQLMHGQMYVA-AGGERLKKMDYN---NITQKPAKKKSES--IQPV---------VHSRIIVPARWKRISNESCTINVFINGDILVPPARILIPKHTLASWENVLAMVTEKVSLRTGA-VHRLCMLNGRPLRGAYELQNNHSYVAVGAEKFRSLPYHLAPSKGAIHSFTVINNDILPSQRKEKQHRNLFAKPGVD 248          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Zebrafish
Match: dcdc2b (doublecortin domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-051113-124])

HSP 1 Score: 71.633 bits (174), Expect = 3.916e-14
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHM 618
            VK++++++NGD +F G+R VVN++     +  L DIT ++     A+R + TP +G R+  L DL    +YVA +  E  K ++Y  A  +      T+S +       LA  ++     ++     T   II+VF+NGD  +PA++++I     +HM
Sbjct:   13 VKSVMVYRNGDPFFSGRRFVVNQRQIATMDALLNDITLNIGAPL-AVRTLYTPRYGHRVADLGDLQQGAQYVA-AGSERFKKLDYLSA-GLKKAVEPTQSKT-------LARPNVSAKWRKVI----TLPCIIHVFRNGDILSPAMRLIIP----RHM 152          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Zebrafish
Match: aspm (abnormal spindle microtubule assembly [Source:ZFIN;Acc:ZDB-GENE-050208-620])

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 85/368 (23.10%), Postives = 162/368 (44.02%), Query Frame = 1
Query: 1309 KRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQIL-------------KSQVSXXXXXXXXXXXXXXXXXXR--VNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXX----------------XXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI-SEKPVTKPKSLSPE---------EQAQERNDAAAKIQAAFRGHV 2289
            ++NKAA KIQ  +RGY  R++L+  K E +   +         ++  + +  +   K+++A  IQA FR +H +++L             + Q+  + Y   ++K    Q   R  +  +   N +    A+V+IQ++FR Y  R  L +K+ +     +       Q    + +  EI+ AV+ +QA FRG+++R S+    ++A  IQ  FR +  +R      +                         + A+ RIQA +RG   R     K+       A  IQ+ +R +  +  F+   ++A  IQ  +R+++  +++ +E    K  ++  +         ++ Q +N AA  IQ+  R H+
Sbjct: 1290 RQNKAAVKIQTLWRGYSAREKLRVLKKE-RHYALQNAAATLIQKTYKAWRVKNLLKKNRSAFVIQAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKEL-SKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFRKEYMALKSASVRIQAMWRGRAER-----KKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAAVVIQRQYRAFRDGQKVHAEYTKIKRAAIILQSAYRGRRIRQELQRKNKAATLIQSVMRAHM 1650          

HSP 2 Score: 63.5438 bits (153), Expect = 1.092e-9
Identity = 90/335 (26.87%), Postives = 141/335 (42.09%), Query Frame = 1
Query: 1315 NKAATKIQAGFRGYQTRQR---LKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFR-SYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS 2307
            ++AAT +QA +R Y  R+R   +K    +I+Q   + N  K Q +S    ++         A  +QA +RG   R+ L+ Q           +  K+              +AM+ +AVIIQ+ FR Y     +Q +  RK                     + + K+ I IQA FRG+ +R  L  + +A+  IQA FR YQ R   K+     +            +Q  FR  K R +    + +   NAA+ +Q  FRG K R E   + K+A  IQ+  R S + ++ + EK                   AA  IQ+A+RGH  R  ++
Sbjct: 2366 HQAATIVQATYRAYSGRKRYLEMKCAAIDIQQRYRAVNAAKQQRKSYLKVRQ--------GALVLQACYRGRKVRRNLQLQCQAAVLIQSYFRRHKEMV----------KYQAMKLSAVIIQSHFRSY-----IQARADRKNY-------------------QHLRKSAIVIQAAFRGHSLRRHLARKQEASVIIQASFRMYQQRSAFKKQRWAARV-----------LQQRFRALKLR-DEHVCQYQQVRNAAVCLQRYFRGMKGR-ELARRSKAARTIQSFLRMSVQRQRFMKEKA------------------AAIAIQSAYRGHFARAQYT 2627          

HSP 3 Score: 63.5438 bits (153), Expect = 1.304e-9
Identity = 82/292 (28.08%), Postives = 121/292 (41.44%), Query Frame = 1
Query: 1312 RNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQ---ILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQ-NKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRN---SLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSY 2166
            +N AATKIQA  R +  ++RL           I QN                     KAA KIQ  +RGY  R+   +LK +       A     +K  +  RV      N     ++A +IQA+FR +  +  L+ N    +       Q  K Q         E+++  + +QA FRG+  R+   +LK R  A+  IQ+ FR Y  R+ L +  Q               IQ  FR    R + + K     ++A + +QA FRG+K RK      +SA  IQ  FR +
Sbjct: 1268 KNLAATKIQALARKFILKRRL-----------IRQN---------------------KAAVKIQTLWRGYSAREKLRVLKKERHYALQNAAATLIQKTYKAWRVKNLLKKN-----RSAFVIQAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYL-------EMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVL-----------IQRWFRACVQR-KAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRF 1503          

HSP 4 Score: 60.8474 bits (146), Expect = 8.183e-9
Identity = 88/359 (24.51%), Postives = 145/359 (40.39%), Query Frame = 1
Query: 1321 AATKIQAGFRGYQTR--------------------------QRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTR-HTLQNKVPRKTNNEREKQ-NGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVT--------KPKSLSPEE--QAQERNDAAAKIQAAFRG 2283
            AA  +QA +RG +TR                          QRL++    ++Q +   N    Q  +   EK+S       AA  +QA +RG  TRQ LK                                  M +AA I+QA++R Y  R   L+ K       +R +  N   Q+  +  K   + +  + +QA +RG ++R +L+++ +AA  IQ+ FR ++           +       + +A  IQ+ FR +  +     K  ++   +AI IQA FRG+  R+    K +++  IQA FR Y+ R    ++           +   L  E   Q Q+  +AA  +Q  FRG
Sbjct: 2272 AALILQAAYRGMKTRHTLKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQQ-RFRANRIMRQEMAALQEKKS-------AALILQAAYRGMKTRQTLKQ---------------------------------MHQAATIVQATYRAYSGRKRYLEMKCAAIDIQQRYRAVNAAKQQRKSYLK---VRQGALVLQACYRGRKVRRNLQLQCQAAVLIQSYFRRHK-----------EMVKYQAMKLSAVIIQSHFRSY-IQARADRKNYQHLRKSAIVIQAAFRGHSLRRHLARKQEASVIIQASFRMYQQRSAFKKQRWAARVLQQRFRALKLRDEHVCQYQQVRNAAVCLQRYFRG 2574          

HSP 5 Score: 52.373 bits (124), Expect = 2.826e-6
Identity = 86/341 (25.22%), Postives = 134/341 (39.30%), Query Frame = 1
Query: 1321 AATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXR--VNETNDNNNEAMEKAAVIIQASFRGYQTRH---TLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI----SEKPVTKPKSLSPEEQAQERND------AAAKIQAAFRGHVYRR 2298
            AA  IQ+ FRG + R  L+         K  Q  K  Q       +   Y  +  AA+ +Q  FR   T+  +  Q +         ++  +    R  + E         +K A IIQ  +R Y+ RH    L+N   R     R   + + Q      +   +  A IT+Q+ +RG R R  +  R KAA  IQA ++ Y+TR                 + A+  IQ  +R    R +   +     + +A+ IQA +RG   R++   +  +A  IQ  + +YK RK      +     +    S      +R D      A   IQA+FRG   RR
Sbjct: 1761 AAVVIQSAFRGMKVRNYLR---------KSHQAAKVIQAHFRGHSQLKKYRRQQWAASVLQQRFRATVTKNAVMKQYAAIKTATICIQSAFRGMVARKQIAEK--------QKCAKIIQKMYRAYKQRHDYLALRNATIRIQQQYRAVVSARQQH----QRYCSLRAAAITLQSSYRGLRARKEINRRQKAATVIQAAYKMYRTR-----------VPFQAMKLASLVIQRQYRCHLLR-KKARENFLKLKQSAVAIQAIYRGKLARRDLARRHFAATIIQRKYLAYKQRKCFLTLQAAVIFCQQHYRSILLTRHDRKDYLTKRRAVVAIQASFRGMNVRR 2068          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Zebrafish
Match: rp1l1a (rp1 like 1a [Source:ZFIN;Acc:ZDB-GENE-120711-1])

HSP 1 Score: 62.003 bits (149), Expect = 3.543e-9
Identity = 58/216 (26.85%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLP-------HHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDI-ENGKFYVAASNEPF 768
            VK I  +K+GD  F G ++ V+K+    ++  L+D+++ + P    +R + TP     IK LE     G Y+   +        Y K IN+  +        HH+  N+ R KP R      D+  S    + +     I + KN D   PA++  I L  +   S+ V   E   L+Q +  ++R+YTL G  I   + + +     V    EPF
Sbjct:   40 VKRITFYKSGDSQFKGVKMAVHKRTFKCFDALLDDLSQKV-PLPFGVRTITTPRGTHSIKHLEQFEDGGCYLCSDR-------RYVKPINMEEVGKRQAVWHHHSHPNNTRRKPSR-----PDEPLSGHQHHHHRHPKRIILVKNSD---PAVRRSIILSRRTARSLRVFTEEISELMQCH--VKRLYTLEGRKIDSIQSLMQCPSVLVCVGREPF 237          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Xenopus
Match: DCDC2 (doublecortin domain containing 2 [Source:NCBI gene;Acc:100493004])

HSP 1 Score: 110.923 bits (276), Expect = 5.562e-25
Identity = 59/217 (27.19%), Postives = 126/217 (58.06%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL 795
            VK++ +F+NGD ++ G+R+++++K    ++ FL+D+T  +    GA+R++ TP +G R+ SL+DL     YVA  + E+ K ++Y   +++  +   T     ++KP+  +  ++    +R  +N + +   +++  NGD   P I+++I  +  +   +++  + ++V L+ +  + R+YTL G  I+   ++ENG+FYVA   E F+ + Y  ++
Sbjct:   23 VKSVHVFRNGDPFYRGRRMLIHEKRVGTFDVFLKDVTGGVQAPFGAVRNIYTPRNGHRVTSLDDLQPGECYVAGGR-ETFKKLDY---LHIGEIKRKTVDPLSQVKPVSHSRINVS---ARFRKN-FQEPCTVFLVANGDTMNPFIRLLIPRKTLEQWELVLALVTEKVKLR-SGAVHRLYTLEGTPIQNGLELENGQFYVAVGREKFKKLPYSDLI 230          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Xenopus
Match: DCDC2B (doublecortin domain containing 2B [Source:NCBI gene;Acc:100496860])

HSP 1 Score: 88.5817 bits (218), Expect = 5.085e-18
Identity = 87/358 (24.30%), Postives = 166/358 (46.37%), Query Frame = 1
Query:  115 NPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSN-------------IIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRG-GRVPSKRN-------KIKFLNQ-----MPSPKSDKRSQGSSNEE-------PT--DRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNE 1083
            +P     + L KN+++++NGD +  G+++VVN+K    +E FL ++T  +     A+R + TP +G RI  L +L   G YVA    E  + ++Y        L    K  +F+ KP             R  Q +Y K N             +I+VF+NGD  TP  +V++     K   +++  +  ++ L  +  +R++ TL+G  +    ++ +G++YVA  +E ++ + Y ++L +    G + ++R        K+  ++Q      P+ +  +R   +  EE       P+  + S    +  +V PK+  K +L+          T  +  F+  +TR+E+E A+E  E
Sbjct:    3 SPSGVQLAPLAKNVVVYRNGDPFHMGRKMVVNEKQFLTFEAFLNEVTSCIQAPV-AVRCIYTPRNGHRITQLGELLNKGHYVA-GGTEKFRKLDY--------LHTEIKQPAFQ-KP-------------REVQQVYPKLNFIERWRKDTQLPCVIHVFRNGDLMTPPFRVLLYPAILKEWELVLSLLTQKLNLN-SGAVRKLCTLDGVSLSNGAELVSGEYYVALGSEKYKCLPYQELLTLNEDKGHLGARRKVAKAGVVKVHSVSQDGYSDSPTREDGRRVYSTGAEENPKLSKHPSKGEESIFYAKPVRVYPKHKAKLNLED--------TTGKEGVFKVKETRQELEGAREVKE 327          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 66.2402 bits (160), Expect = 2.433e-10
Identity = 98/458 (21.40%), Postives = 184/458 (40.17%), Query Frame = 1
Query: 1006 AATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKN--IKPKN-TEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTR---QRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXX----------------XXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI------SEKPVTKPKS----LSPEEQAQERNDAAAKIQAAFRG 2283
            AA  IQ+AFRG + R+++         + + +  ++ +   +  +N T   +Q    K++  +++++   ++      Q   R  + +               +  + +AT IQA FR ++ +     L+     I+Q   +    KS+ ++   +++S        A  IQA FRG   R++L                                   M KAA  IQASFR +Q R +   KV    +  +++        + + +   I++AV+ IQ+ +RG+++R  L+ + + A RIQ+ ++ ++ R + +                               A   IQA  RG   R     +  K   +AA  IQ+ +R Y  RK ++M +++   IQ  +R+ K R         S K  T  ++    +      Q+ + AAA IQ AF+ 
Sbjct: 2179 AALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERI------------NHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQS--------AVTIQATFRGMKERKML---------------------------------SIMHKAASTIQASFRMHQCR-SQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVR-----RNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKS 2577          

HSP 2 Score: 58.9214 bits (141), Expect = 3.938e-8
Identity = 96/355 (27.04%), Postives = 157/355 (44.23%), Query Frame = 1
Query: 1318 KAATKIQAGFRGYQTR---QRLKFNKPEIKQSKISQNPKKSQPE--------------SLTSEKESDYNIKDKAAA-KIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVT--------KPKSLSPEEQAQERN--DAAAKIQAAFRGHVYRR 2298
            KAAT +QAGFRG +TR   Q++      I+Q+  S   +KS  E              S+    E    +K ++AA  IQA +RG   R+ LK +          +   + Q   R++  +  +  A ++AAV+IQ  +R Y++   L++K   K  N         +   +    +++  A   +QA +R +R R        A +  Q  FR  + R           +       A KRIQ+ FR  K            +++AAI IQA ++ +  R+E+V   ++A  IQA FR ++TRK +    V+        +   L+  ++AQ  +   AA  IQ+AFRG +  R
Sbjct: 2543 KAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLR---------HRAAAQIQSLFRMHRQH-VSYLANKQAAVVIQRHYRRYRS-CKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRAR-------VDAVKKYATIRMAVKRIQSAFRARKA------ARDAEKDSAAIVIQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHR 2873          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 65.855 bits (159), Expect = 2.981e-10
Identity = 98/458 (21.40%), Postives = 184/458 (40.17%), Query Frame = 1
Query: 1006 AATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKN--IKPKN-TEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTR---QRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXX----------------XXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI------SEKPVTKPKS----LSPEEQAQERNDAAAKIQAAFRG 2283
            AA  IQ+AFRG + R+++         + + +  ++ +   +  +N T   +Q    K++  +++++   ++      Q   R  + +               +  + +AT IQA FR ++ +     L+     I+Q   +    KS+ ++   +++S        A  IQA FRG   R++L                                   M KAA  IQASFR +Q R +   KV    +  +++        + + +   I++AV+ IQ+ +RG+++R  L+ + + A RIQ+ ++ ++ R + +                               A   IQA  RG   R     +  K   +AA  IQ+ +R Y  RK ++M +++   IQ  +R+ K R         S K  T  ++    +      Q+ + AAA IQ AF+ 
Sbjct: 2206 AALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERI------------NHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQS--------AVTIQATFRGMKERKML---------------------------------SIMHKAASTIQASFRMHQCR-SQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVR-----RNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKS 2604          

HSP 2 Score: 58.9214 bits (141), Expect = 4.743e-8
Identity = 96/355 (27.04%), Postives = 157/355 (44.23%), Query Frame = 1
Query: 1318 KAATKIQAGFRGYQTR---QRLKFNKPEIKQSKISQNPKKSQPE--------------SLTSEKESDYNIKDKAAA-KIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVT--------KPKSLSPEEQAQERN--DAAAKIQAAFRGHVYRR 2298
            KAAT +QAGFRG +TR   Q++      I+Q+  S   +KS  E              S+    E    +K ++AA  IQA +RG   R+ LK +          +   + Q   R++  +  +  A ++AAV+IQ  +R Y++   L++K   K  N         +   +    +++  A   +QA +R +R R        A +  Q  FR  + R           +       A KRIQ+ FR  K            +++AAI IQA ++ +  R+E+V   ++A  IQA FR ++TRK +    V+        +   L+  ++AQ  +   AA  IQ+AFRG +  R
Sbjct: 2570 KAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLR---------HRAAAQIQSLFRMHRQH-VSYLANKQAAVVIQRHYRRYRS-CKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRAR-------VDAVKKYATIRMAVKRIQSAFRARKA------ARDAEKDSAAIVIQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHR 2900          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 65.855 bits (159), Expect = 3.272e-10
Identity = 98/458 (21.40%), Postives = 184/458 (40.17%), Query Frame = 1
Query: 1006 AATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKN--IKPKN-TEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTR---QRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXX----------------XXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEI------SEKPVTKPKS----LSPEEQAQERNDAAAKIQAAFRG 2283
            AA  IQ+AFRG + R+++         + + +  ++ +   +  +N T   +Q    K++  +++++   ++      Q   R  + +               +  + +AT IQA FR ++ +     L+     I+Q   +    KS+ ++   +++S        A  IQA FRG   R++L                                   M KAA  IQASFR +Q R +   KV    +  +++        + + +   I++AV+ IQ+ +RG+++R  L+ + + A RIQ+ ++ ++ R + +                               A   IQA  RG   R     +  K   +AA  IQ+ +R Y  RK ++M +++   IQ  +R+ K R         S K  T  ++    +      Q+ + AAA IQ AF+ 
Sbjct: 2147 AALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERI------------NHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQS--------AVTIQATFRGMKERKML---------------------------------SIMHKAASTIQASFRMHQCR-SQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVR-----RNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKS 2545          

HSP 2 Score: 58.5362 bits (140), Expect = 6.487e-8
Identity = 96/355 (27.04%), Postives = 157/355 (44.23%), Query Frame = 1
Query: 1318 KAATKIQAGFRGYQTR---QRLKFNKPEIKQSKISQNPKKSQPE--------------SLTSEKESDYNIKDKAAA-KIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVT--------KPKSLSPEEQAQERN--DAAAKIQAAFRGHVYRR 2298
            KAAT +QAGFRG +TR   Q++      I+Q+  S   +KS  E              S+    E    +K ++AA  IQA +RG   R+ LK +          +   + Q   R++  +  +  A ++AAV+IQ  +R Y++   L++K   K  N         +   +    +++  A   +QA +R +R R        A +  Q  FR  + R           +       A KRIQ+ FR  K            +++AAI IQA ++ +  R+E+V   ++A  IQA FR ++TRK +    V+        +   L+  ++AQ  +   AA  IQ+AFRG +  R
Sbjct: 2511 KAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLR---------HRAAAQIQSLFRMHRQH-VSYLANKQAAVVIQRHYRRYRS-CKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRAR-------VDAVKKYATIRMAVKRIQSAFRARKA------ARDAEKDSAAIVIQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHR 2841          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Mouse
Match: Dcdc2a (doublecortin domain containing 2a [Source:MGI Symbol;Acc:MGI:2652818])

HSP 1 Score: 121.709 bits (304), Expect = 1.182e-28
Identity = 88/357 (24.65%), Postives = 180/357 (50.42%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDK-IESRITQNLYTKSNI-----IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKP--------KNSEKRSLKKQKNDNEIAATKI----QAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQD 1158
            +VK++L+++NGD +F G+RVV+++K   +++ FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA    E+ K +NY   +++  +         + +P+   N ++   I SRI  +   + ++     I++  NGD  +PA +++I  +       +++ + +++ L+ +  + R+YTL G+++    ++ENG+FYVA   + F+ + Y ++L      R P  +      + +P     ++S+GS N   +  +  S +++  +P         NSEK +  KQ   ++ +   I    +  F+    R E   A E  E   +   V +P + +P      E+D
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVAGGP-EAFKKLNY---LDIGEI---------KKRPMEAVNTEVKPVIHSRINVSARFRKSLHEPCTIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLR-SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQK----ASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKTSHQAIPDNGEGIFKAGAERSETRGAAEVQE--DEDTQVEVPVDQRPAEIVDEEED 351          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Mouse
Match: Dcdc2a (doublecortin domain containing 2a [Source:MGI Symbol;Acc:MGI:2652818])

HSP 1 Score: 116.316 bits (290), Expect = 1.531e-27
Identity = 75/290 (25.86%), Postives = 156/290 (53.79%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDK-IESRITQNLYTKSNI-----IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKN 993
            +VK++L+++NGD +F G+RVV+++K   +++ FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA    E+ K +NY   +++  +         + +P+   N ++   I SRI  +   + ++     I++  NGD  +PA +++I  +       +++ + +++ L+ +  + R+YTL G+++    ++ENG+FYVA   + F+ + Y ++L      R P  +      + +P     ++S+GS N   +  +  S +++  +P    KR  KK  N
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVA-GGPEAFKKLNY---LDIGEI---------KKRPMEAVNTEVKPVIHSRINVSARFRKSLHEPCTIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLR-SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQKA----SSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPL---KRKGKKDSN 283          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Mouse
Match: Dcdc2c (doublecortin domain containing 2C [Source:MGI Symbol;Acc:MGI:1915761])

HSP 1 Score: 94.3597 bits (233), Expect = 2.729e-20
Identity = 68/225 (30.22%), Postives = 122/225 (54.22%), Query Frame = 1
Query:  112 KNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLR-LANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEY 783
            + P    ++   K IL+++NGDQ++ G++ V +++   N+E  LE +T+ +    G +R + TP  G  +  L+ L T GKYVA  + E  K ++Y     ++ +P    S   +LK ++ + + DI K+ SR      T S  I VF NG  F P IKV+I        + ++  I ++V       +R+++T++G ++  +K++++  FYVAA  E F++I Y
Sbjct:    4 RGPYALVDTTPAKTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFG-VRRLYTPTRGHPVLGLDALQTGGKYVAAGR-ERFKKLDY-----IHIVPRKP-SKMRKLKEIKPVVHCDI-KVPSRWQIQSRT-SRYINVFTNGRLFIPPIKVIIPKFSLSDWNSVLAMIGEKVFPLGG--VRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKSIPY 216          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Mouse
Match: Dcdc2c (doublecortin domain containing 2C [Source:MGI Symbol;Acc:MGI:1915761])

HSP 1 Score: 94.7449 bits (234), Expect = 3.135e-20
Identity = 68/225 (30.22%), Postives = 122/225 (54.22%), Query Frame = 1
Query:  112 KNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLR-LANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEY 783
            + P    ++   K IL+++NGDQ++ G++ V +++   N+E  LE +T+ +    G +R + TP  G  +  L+ L T GKYVA  + E  K ++Y     ++ +P    S   +LK ++ + + DI K+ SR      T S  I VF NG  F P IKV+I        + ++  I ++V       +R+++T++G ++  +K++++  FYVAA  E F++I Y
Sbjct:    4 RGPYALVDTTPAKTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFG-VRRLYTPTRGHPVLGLDALQTGGKYVAAGR-ERFKKLDY-----IHIVPRKP-SKMRKLKEIKPVVHCDI-KVPSRWQIQSRT-SRYINVFTNGRLFIPPIKVIIPKFSLSDWNSVLAMIGEKVFPLGG--VRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKSIPY 216          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Mouse
Match: Dcdc2b (doublecortin domain containing 2b [Source:MGI Symbol;Acc:MGI:2686212])

HSP 1 Score: 83.5741 bits (205), Expect = 1.019e-16
Identity = 56/221 (25.34%), Postives = 105/221 (47.51%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLP---HHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNI-IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL 795
             K IL+++NGD +FPG ++VV ++  P  E  L ++T ++     A+R + T   G  + +L DL   G+YVA           +++   ++ LP    H    + +     ++ R  D +     Q L   +   I+VF+NGD  +P   + +     +    ++K + ++V LQ    + ++ TL G  +     + NG +YVA   E F+ + Y ++L
Sbjct:    2 AKRILVYRNGDAFFPGHQLVVTQRRYPTMEALLYEVTSAVQ-APLAVRVLYTLSDGHPVTNLADLQNGGQYVA---------AGFERFHKIHYLPPGMKHPGGKTRQQHEPPVSQRPCDGV---FGQWLPADAPCYIHVFRNGDLLSPPFSLKLSQTAIQDWDTVLKLLSEKVTLQSGA-VHKLCTLEGLPLSTGTALVNGHYYVAVGEEEFKALPYMELL 208          
BLAST of Doublecortin domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9UHG0|DCDC2_HUMAN (Doublecortin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCDC2 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 1.577e-28
Identity = 90/358 (25.14%), Postives = 180/358 (50.28%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDK-IESRITQNLYTKSNI-----IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPK---------NSEKRSLKKQ----KNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQD 1158
            +VK++L+++NGD ++ G+RVV+++K   ++E FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA  + E+ K +NY   +++  +         + +P+ + N ++   I SRI  +   +  +     I++  NGD   PA +++I  +       +++ + +++ L+ +  + R+YTL G+++    ++ENG+FYVA   + F+ + Y ++L      R P  +      + +P     ++S+GS N+  +  +  S +++  +P          NSEK +  KQ    KN  E      +  F+    R E   A E  E   +   V +P + +P      E+D
Sbjct:   15 VVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQ-EAFKKLNY---LDIGEI---------KKRPMEVVNTEVKPVIHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLR-SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKA----SSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQE--DEDTQVEVPVDQRPAEIVDEEED 352          
BLAST of Doublecortin domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|D3ZR10|DCDC2_RAT (Doublecortin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Dcdc2 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.398e-28
Identity = 87/358 (24.30%), Postives = 179/358 (50.00%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDID-------KIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKP--------KNSEKRSLKKQ----KNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQD 1158
            +VK++L+++NGD +F G+RVV+++K   +++ FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA  + E+ K +NY   +++  +         + +P+   N ++         + +R  + L+     I++  NGD  +PA +++I  +       +++ + +++ L+ +  + R+YTL G+++    ++ENG+FYVA   + F+ + Y ++L      R P  +      + +P     ++S+GS N   +  +  S +++  +P         NSEK +  KQ    KN ++      +  F+    R E   A E  E   +   V +P + +P      E+D
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDIFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVAGGQ-EAFKKLNY---LDIGEI---------KKRPMEAVNTEVKPVIHSKINVSARFRKALHEPCT-IFLIANGDLISPASRLLIPRKALNQWDHVLQMVTEKITLR-SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQK----ASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKNSHQAIPDNDEGIFKAGAERSETRGAAEVQE--DEDTQVEVPVDQRPAEIVDEEED 351          
BLAST of Doublecortin domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5DU00|DCDC2_MOUSE (Doublecortin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcdc2 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 8.978e-28
Identity = 88/357 (24.65%), Postives = 180/357 (50.42%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDK-IESRITQNLYTKSNI-----IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKP--------KNSEKRSLKKQKNDNEIAATKI----QAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQD 1158
            +VK++L+++NGD +F G+RVV+++K   +++ FL+++T  +    GA+R++ TP  G RI+ L+ + + G YVA    E+ K +NY   +++  +         + +P+   N ++   I SRI  +   + ++     I++  NGD  +PA +++I  +       +++ + +++ L+ +  + R+YTL G+++    ++ENG+FYVA   + F+ + Y ++L      R P  +      + +P     ++S+GS N   +  +  S +++  +P         NSEK +  KQ   ++ +   I    +  F+    R E   A E  E   +   V +P + +P      E+D
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVAGGP-EAFKKLNY---LDIGEI---------KKRPMEAVNTEVKPVIHSRINVSARFRKSLHEPCTIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLR-SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQK----ASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKTSHQAIPDNGEGIFKAGAERSETRGAAEVQE--DEDTQVEVPVDQRPAEIVDEEED 351          
BLAST of Doublecortin domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|A2VCK2|DCD2B_HUMAN (Doublecortin domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DCDC2B PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.250e-21
Identity = 72/276 (26.09%), Postives = 128/276 (46.38%), Query Frame = 1
Query:  136 SVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTK---SNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKP 954
            S   K +++++NGD +FPG ++VV ++  P  E FL ++T ++     A+R + TP HG  + +L DL   G+YVA           +++   ++ LPH  K     S RL+   +     D    R  Q      + I+VF+NGD  +P   + +     +    ++K + ++V LQ    + ++ TL G  +   K++  G +YVA   + F+++ Y ++L       VPS  +  +   Q P  KS    QG+             E  ++KP
Sbjct:    5 SPAAKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQ-APLAVRALYTPCHGHPVTNLADLKNRGQYVA---------AGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGR--QLPAGAPSYIHVFRNGDLVSPPFSLKLSQAASQDWETVLKLLTEKVKLQSGA-VCKLCTLEGLPLSAGKELVTGHYYVAVGEDEFKDLPYLELL-------VPSP-SLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKP 259          
BLAST of Doublecortin domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9D1B8|DCD2C_MOUSE (Doublecortin domain-containing protein 2C OS=Mus musculus OX=10090 GN=Dcdc2c PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.692e-19
Identity = 68/225 (30.22%), Postives = 122/225 (54.22%), Query Frame = 1
Query:  112 KNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLR-LANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEY 783
            + P    ++   K IL+++NGDQ++ G++ V +++   N+E  LE +T+ +    G +R + TP  G  +  L+ L T GKYVA  + E  K ++Y     ++ +P    S   +LK ++ + + DI K+ SR      T S  I VF NG  F P IKV+I        + ++  I ++V       +R+++T++G ++  +K++++  FYVAA  E F++I Y
Sbjct:    4 RGPYALVDTTPAKTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFG-VRRLYTPTRGHPVLGLDALQTGGKYVAAGR-ERFKKLDY-----IHIVPRKP-SKMRKLKEIKPVVHCDI-KVPSRWQIQSRT-SRYINVFTNGRLFIPPIKVIIPKFSLSDWNSVLAMIGEKVFPLGG--VRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKSIPY 216          
BLAST of Doublecortin domain-containing protein 2 vs. TrEMBL
Match: A0A4E0RKY8 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000661 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.322e-55
Identity = 194/637 (30.46%), Postives = 296/637 (46.47%), Query Frame = 1
Query:  154 ILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKA----INVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKS-DKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPK------NIK--PKNTEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQ-NKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRLK--FNKPE-IKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILK------SQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSL----------------------KVRD--KAAQRIQAGFRGYQTRR 1923
            +++ KNGD Y  G R+ +N  ++ +W+  +E+I   L     A+R +     G+ I     L  N +YVA+ +GE  K  NY KA    +N   +P    SN    K  R   + + +   RI ++L  K   I V++NGD FTPAI+VV++      + V +K I+D V+L  N+PIR+++TL G++IR  + I++ + YVA  +E      YGQ L             +I   +  P P+S +++S+    + P     +S E  K   KNS   S        + AA +IQA +RG+  RK   +           HTV+I +      NI   P+ TEPHE    P    ++++   +  Q + Q  Q ++P+  +S       +           + AA KIQAGFRGY+TR+ L+     PE ++QS +S            +E  SD N    AA +IQA FRGY TR+ L+      S +               Q   R +  ++ + E + KAA IIQA FRGYQTR  L +  P  + +E     G    P N+   +  E+A   IQA +RG+  R +L                      +  D  +AA +IQA FR Y+TRR
Sbjct:   26 VIVHKNGDIYNRGHRITINLTHSKSWDSIMEEIRSHLGAYYPALRFLIDNECGSIIVRKSQLGPNKRYVAVPRGEEPKFFNYAKAEQNTLNPRRVP---TSNELFEKYWRKHAKLMLRQPGRICEDLRRKPKTIMVYRNGDSFTPAIRVVLRSSHLTDLDVTLKTIQDFVILMDNKPIRKLFTLEGKLIRRPEQIKDKQTYVATGSESLSLCLYGQNL------------RRIDKTHAQPGPRSINRQSKPRHKKFPVRMDNKSGEQHKPSVKNSTGPS------PVDAAAARIQAGYRGYHFRKTHPEL---------THTVHIARQHQDAPNIHNNPRATEPHEL--TPSTAATRIQAGYRGYQTRKQMHQHDEPKATQSTPHGCNQSQTLPP------DVAAAKIQAGFRGYRTRRELREHHEHPETVQQSNLSN----------LNEIRSDPNY---AATRIQATFRGYQTRRALQEHNSNPSNMKYPLRSRNCNSCSTTQSHTRCHH-DERDPEEVNKAATIIQAGFRGYQTRKHLHS--PHTSTHESHPTGG----PVNK---ENAEQAATRIQAAYRGFSTRKNLHETGPTTGGNMDTNRSITTPTTRYSDPSEAATKIQATFRRYRTRR 601          
BLAST of Doublecortin domain-containing protein 2 vs. TrEMBL
Match: A0A267H8Q0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016684g1 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.445e-43
Identity = 135/441 (30.61%), Postives = 228/441 (51.70%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTR-IKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTK-----------------SNSFRLKPLR--LANRDIDKIESRITQNL---YTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVP-KKHTVYIPKNIKPKNTE--PHEQDKNPKINYSKVKKEEKEIQA------KPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRL 1374
            K + +F+NGD + P K+ V+N++   +W+ FLE +T S+NP  GA+R++ TP  G R I  L+     G YVAL++GE  K + Y     V +   H +                 SN   L+P+   + N+ +  ++ R    +    ++S  I V++NGD FTPAI V+++  EQ  M V+++A+E+RV+L  N  IR+++ ++G  IR  +++++ K YVA  +EPF +  YGQ LP+I  G+   +++ IK+L+Q  +P+    S+ S  +   D++ Q+  +T     NSE     K +        +IQA+ RGF+TRK +   K    PV  +   V    N KPK  +  P E+ +      S VK  E   QA      +P + +N   N + +    +     K  +++++  AA  IQA    Y+TR+++
Sbjct:   40 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYVPEAEVGANGSHAETKGSGASPTASPRKPMGSNRVVLEPILPVVHNKKLMSVQPRFGAKMDVISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKA-ERKSTIKYLSQPITPEKHS-SRKSKQDSQRDQAQQNPRAT-----NSEGGGATKAEKAKAAG--QIQASIRGFETRK-VAAEKRTGGPVTIRPELVNSKANAKPKGAKASPEEKAQAAGTIQSSVKGFEARKQAASKVAQRPIEVKNDAANSKKQKQQQQPQKQQKPMSEEEK-AAAKSIQASVNSYKTRKQV 469          
BLAST of Doublecortin domain-containing protein 2 vs. TrEMBL
Match: A0A267EGS0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018380g1 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.650e-43
Identity = 134/441 (30.39%), Postives = 225/441 (51.02%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTR-IKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTK-----------------SNSFRLKPLR--LANRDIDKIESRITQNL---YTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPV---PKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQA------KPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRL 1374
            K + +F+NGD + P K+ V+N++   +W+ FLE +T S+NP  GA+R++ TP  G R I  L+     G YVAL++GE  K + Y     V +   H +                 SN   L+P+   + N+ +  ++ R    +    ++S  I V++NGD FTPAI V+++  EQ  M V+++A+E+RV+L  N  IR+++ ++G  IR  +++++ K YVA  +EPF +  YGQ LP+I  G+   +++ IK+L+Q  +P+    S+ S  +   D++ Q+  +T     NSE     K +        +IQA+ RGF+TRK +   K    PV   PK          K     P E+ +      S VK  E   QA      +P + +N P N + +    +     K  +++++  AA  IQA    Y+TR+++
Sbjct:   40 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYVPEAEVGANGSHAETKGSGASPTASPRKPMGSNRVVLEPILPVVHNKKLMSVQPRFGAKMDVISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKA-ERKSTIKYLSQPITPEKHS-SRKSKQDSQRDQAQQNPRAT-----NSEGGEATKAEKAKAAG--QIQASIRGFETRK-VAAEKRTGGPVTIRPKPANSKANAKPKAAKASPEEKAQAAGTIQSSVKGFEARKQAASKVAQRPIELKNDPANSKKQKQQQQPQKQQKPMSEEEK-AAAKSIQASVNSYKTRKQV 469          
BLAST of Doublecortin domain-containing protein 2 vs. TrEMBL
Match: A0A1I8IEM1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 2.863e-43
Identity = 149/500 (29.80%), Postives = 251/500 (50.20%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTR-IKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTK-----------------SNSFRLKPLR--LANRDIDKIESRITQNL---YTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPV---PKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQA------KPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQN--PKKSQPESLTSEKESDYN-----IKDKAAAKIQAGFRGYHTR 1530
            K + +F+NGD + P K+ V+N++   +W+ FLE +T S+NP  GA+R++ TP  G R I  L+     G YVAL++GE  K + Y     V +   H +                 SN   L+P+   + N+ +  ++ R    +    ++S  I V++NGD FTPAI V+++  EQ  M V+++A+E+RV+L  N  IR+++ ++G  IR  +++++ K YVA  +EPF +  YGQ LP+I  G+   +++ IK+L+Q  +P+    S+ S  +   D++ Q+  +T     NSE     K +        +IQA+ RGF+TRK +   K    PV   PK          K     P E+ +      S VK  E   QA      +P + +N   N + +    +     K  +++++  AA  IQA    Y+TR+++  N      S ++ +  P + Q    T+ +   Y+     +  +AA KIQA +RGY +R
Sbjct:  414 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYVPEAEVGANGSHAETKGSGASPTASPRKPMGSNRVLLEPILPVVHNKKLMSVQPRFGAKMDVISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKA-ERKSTIKYLSQPITPEKHS-SRKSKQDSQRDQAQQNPRAT-----NSEGGGATKAEKAKAAG--QIQASIRGFETRK-VAAEKRTGGPVTIRPKPANSKANAKPKAAKASPEEKAQAAGTIQSSVKGFEARKQAASKVAQRPIELKNDAANSKKQKQQQQPQKQQKPMSEEEK-AAAKSIQASVNSYKTRKQVLSN----SNSPVTSHAGPGQQQHNHATTYRAEQYDGYEDPMYHQAATKIQATYRGYRSR 898          
BLAST of Doublecortin domain-containing protein 2 vs. TrEMBL
Match: A0A267GFD5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018380g2 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.192e-42
Identity = 133/441 (30.16%), Postives = 224/441 (50.79%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTR-IKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTK-----------------SNSFRLKPLR--LANRDIDKIESRITQNL---YTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPV---PKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQA------KPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRL 1374
            K + +F+NGD + P K+ V+N++   +W+ FLE +T S+NP  GA+R++ TP  G R I  L+     G YVAL++GE  K + Y     V +   H +                 SN   L+P+   + N+ +  ++ R    +    ++S  I V++NGD FTPAI V+++  EQ  M V+++A+E+RV+L  N  IR+++ ++G  IR  +++++ K YVA  +EPF +  YGQ LP+I  G+   +++ IK+L+Q  +P+    S+ S  +   D++ Q+  +T     NSE     K +        +IQA+ RGF+TRK +   K    PV   PK          K     P E+ +      S VK  E   QA      +P + +N   N + +    +     K  +++++  AA  IQA    Y+TR+++
Sbjct:   40 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYVPEAEVGANGSHAETKGSGASPTASPRKPMGSNRVLLEPILPVVHNKKLMSVQPRFGAKMDVISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKA-ERKSTIKYLSQPITPEKHS-SRKSKQDSQRDQAQQNPRAT-----NSEGGGATKAEKAKAAG--QIQASIRGFETRK-VAAEKRTGGPVTIRPKPANSKANAKPKAAKASPEEKAQAAGTIQSSVKGFEARKQAASKVAQRPIELKNDAANSKKQKQQQQPQKQQKPMSEEEK-AAAKSIQASVNSYKTRKQV 469          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000050955.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:19696740:19722139:-1 gene:ENSAMXG00000037587.1 transcript:ENSAMXT00000050955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 1.898e-23
Identity = 68/223 (30.49%), Postives = 117/223 (52.47%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDI-DKIESRITQNLYTKSNI-----IYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLP 798
            K+IL+++NGD ++PGK+ V+N++ T  +E FL  +T+ +    GA+R + TP  G RI+SLE  S   +YVA +  E LK I+Y           H   N    +P R+ N+ I   + S+I      + NI     I VF NGD   P  ++++          ++  + ++V L+ +  + R++TL+G  +    +++N ++YVA   E F +  Y Q +P
Sbjct:   17 KSILVYRNGDAFYPGKKFVINQRQTATFESFLGSVTRGIEAPFGAVRHIYTPREGHRIRSLEQFSHGERYVA-AGAERLKNIDY----------LHITPN----RPQRMKNKQIRPVVHSKIIVPARWRKNIDEPCTINVFANGDILVPPARILLPKYTLNSWESVLAMVTEKVHLR-SGAVHRLFTLDGTPLLGTAELKNNQYYVAVGMEKFRHKPYVQNIP 223          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Cavefish
Match: dcdc2b (doublecortin domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-051113-124])

HSP 1 Score: 103.219 bits (256), Expect = 4.362e-23
Identity = 64/217 (29.49%), Postives = 117/217 (53.92%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL 795
            VK++++++NGD +F G++ +VN++     E FL D+T S+     AIR + TP HG R+  L+ L    +YVA +  E  K I+Y              S   +  P+++ +R     + R    + T   II VF+NGD  + A++ +I     K++  ++  I ++ +L+    +RR+ TL+G  +  A+++E+G+ YVA   E F+ + Y ++L
Sbjct:   13 VKSVMVYRNGDPFFTGRKFIVNQRQISTMEAFLNDVTVSIGA-PLAIRTLYTPRHGHRVPDLDHLQQGAQYVA-AGFERFKKIDY-------------FSVGLKRAPVKVLSRPNVSAKWR---KVITLPCIINVFRNGDILSSAMRFIIPRNMLKNLEQILSLISEKAMLRTG-AVRRLCTLDGVTVASAEELESGQCYVAVGTERFKKLPYVELL 210          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000055346.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:19700301:19722115:-1 gene:ENSAMXG00000037587.1 transcript:ENSAMXT00000055346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 3.451e-19
Identity = 60/217 (27.65%), Postives = 110/217 (50.69%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLP 798
            K+IL+++NGD ++PGK+ V+N++ T  +E FL  +T+ +    GA+R + TP  G RI+SLE  S   +YVA +  E LK I                     ++P+ + ++ I  + +R  +N+     I  VF NGD   P  ++++          ++  + ++V L+       ++TL+G  +    +++N ++YVA   E F +  Y Q +P
Sbjct:    9 KSILVYRNGDAFYPGKKFVINQRQTATFESFLGSVTRGIEAPFGAVRHIYTPREGHRIRSLEQFSHGERYVA-AGAERLKNI---------------------IRPV-VHSKII--VPARWRKNIDEPCTI--VFANGDILVPPARILLPKYTLNSWESVLAMVTEKVHLRSG--AVHLFTLDGTPLLGTAELKNNQYYVAVGMEKFRHKPYVQNIP 196          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000039996.1 (doublecortin domain containing 2 [Source:NCBI gene;Acc:103026450])

HSP 1 Score: 91.2781 bits (225), Expect = 7.230e-19
Identity = 61/222 (27.48%), Postives = 115/222 (51.80%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKP-----LRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL 795
            VK+IL+++NG+     +RVV+++K   + E  L +++       G  R + TP  G R+ +L+D+   G YVA    E+ K I+Y +  N N     T+SN   LKP     + ++ R +  I    T         I++  NGD   PA+++++  +       +++ + +++ L++   +R +YT +G  +   K++ENG+FYVA   + F+ + Y  +L
Sbjct:   14 VKSILVYRNGEHGRGPRRVVLHEKRVSSLEGLLRELS-------GGTRRLHTP-QGHRVGALQDIQHRGAYVAAGT-ETFKKIDYLQIGNRNK--QTTQSNGV-LKPVPQNRINVSARFLKPINEPCT---------IFIVANGDVLNPAVRLLVHSRLLGQFERILEMVTEKMGLRVLGGVRSLYTFDGISVMDGKELENGQFYVAVGRDKFKRLPYADLL 214          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000036226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:19209457:19235971:1 gene:ENSAMXG00000030872.1 transcript:ENSAMXT00000036226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 7.749e-13
Identity = 123/491 (25.05%), Postives = 198/491 (40.33%), Query Frame = 1
Query:  943 KVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVY----------IPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQA--KPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKV-PRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGY--QTRRILXXXXXXXXXXXXXXXXXXXR--------------IQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEF-VMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKS----------LSPEEQAQERNDAAAKIQAAFRGHVYR 2295
            K+  K   +R    QK     AA  +QAA+RG + RKE +K +E    +   + +Y          +   +  +    H + K  +  + K++     +QA  +  +T+ +  N+ S                     AAT IQ  +  Y+ R+  KF      +  +    +K +    + ++   Y  K  AA  IQA FRG   R+  + Q+                                 KAA+ IQA  R ++T+   Q  +   KT   R + N   +E     K K +  A + +QA FRG + R++LK + KAA  IQ+ +R +  QTR +  +      +       AA++              +QA FRG + R     +E   Q  AA  IQA FR ++ R ++  M+V SA  IQ  FR+Y   K+  E+ ++  KS           S      + + AA  IQAA R H +R
Sbjct:  279 KLLAKQQRQRYCSMQK-----AAITLQAAYRGMRVRKEAQKRQEAATVLQAWYRMYRVKMAFQAMRLAAVLVQRRYRCHLERKEARERFVKLRHSAIVVQAVFRGNRTRREIGNLHS---------------------AATVIQRKYLAYKERK--KFLSV---RDTVVHCQQKWRAVLASRQQLKAYLAKRSAAIAIQAAFRGMKVRR--RVQIE-------------------------------RKAAITIQAHVRMHKTKVYYQRLLWATKTVQRRYRANQMMKEEMKSLKQKRM--ATVVLQAAFRGMKARHTLKQKHKAAIVIQSAYRAHCAQTRYLCMRYAAVAIQQRYRATLAARKQREHFLQLRCASISLQACFRGQRAR-----REIGLQHQAAKVIQASFRSHRERTKYQAMRV-SAMIIQRHFRAYIVAKDNRERYLSLRKSAILIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHR 697          

HSP 2 Score: 56.6102 bits (135), Expect = 1.254e-7
Identity = 67/251 (26.69%), Postives = 111/251 (44.22%), Query Frame = 1
Query: 1642 AMEKAAVIIQASFRGYQTR-----HTLQNKVPRKTNNEREKQN-------------GKNQEPTNENKDKE----IEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKS-------LSPEEQAQ---ERNDAAAKIQAAFRGHVYRR 2298
            +M+KAA+ +QA++RG Q R       L  K+ ++     +++N             G+ +      + ++    ++KA IT+QA +RG R+R   + R +AA  +QA +R Y+ +   +                 +R +A  R  K R            ++AI +QA FRG +TR+E      +A  IQ  + +YK RK+      T           L+  +Q +    +  AA  IQAAFRG   RR
Sbjct:  218 SMQKAAITLQAAYRGMQARKRIAEMQLAAKIIQRKYRAYKQRNEYCALKQVTIVIQGRYRAKLLAKQQRQRYCSMQKAAITLQAAYRGMRVRKEAQKRQEAATVLQAWYRMYRVKMAFQAMRLAAVLVQRRYRCHLERKEARERFVKLR------------HSAIVVQAVFRGNRTRREIGNLHSAATVIQRKYLAYKERKKFLSVRDTVVHCQQKWRAVLASRQQLKAYLAKRSAAIAIQAAFRGMKVRR 456          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007117.1 (pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-1 gene:ENSPMAG00000006438.1 transcript:ENSPMAT00000007117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 2.813e-6
Identity = 44/191 (23.04%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLN-----PRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGE 702
             K +  ++NGD+YF G    V+     +++  LED+T++L      P+   +R + T     R+ +L++L     YV  S  E  + ++Y K +N N    + KS+  + +    ++R     ESR     + +  ++ V ++G +   A+++++  +       ++  I D + L     ++R+YTL+G+
Sbjct:   56 AKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQ--GVRAIYTCDGSRRMLTLDELVEGESYVCASN-EPYRRLDYTKTLNPN-WSVNIKSSGGKAQSAAGSSRYTAGSESRD----FIRPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLTDITDAIKLDTG-VVKRLYTLDGK 237          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO46255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ95])

HSP 1 Score: 104.76 bits (260), Expect = 6.227e-24
Identity = 80/270 (29.63%), Postives = 136/270 (50.37%), Query Frame = 1
Query:  154 ILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKP-----LRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEP-FENIEYGQVLPVIRGGRVPSKRN-KIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVEST 942
            + ++KNG+  FPGK+VVVN +   N +  L+ IT+ +  +  A R ++TP  G +I  LE +   G+YV     E+ K +NY +       P  T      + P     L+++ R   + ++    N+      I+V+KNGD  T ++KV +  +E K M  +   I ++V LQ    +R +YT++GE ++   ++ N   YVAA +E  F+ + Y     +    RVP+K + K K L++  +P   K S G  N + +DR   S   +
Sbjct:    6 VTIYKNGEPKFPGKKVVVNPRQVRNMDACLDKITREMKLKTAA-RSLKTPTGGHKIDKLEKIEPGGQYVVCGL-EAFKRLNYMEIKPEGMRP--TPRKEIEITPVKHSRLQMSGRARKRADAEKGNNMG-----IFVYKNGDALTSSVKVHLSDRELKSMDKVCDFITNKVHLQTG-AVRILYTMDGECVKDPSELSNSAKYVAAGHEKRFKRVAYNDSSVLSPRSRVPTKTHFKAKNLSKT-TPNRTKPSHGRKNSDRSDRKMSSTTGS 264          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO47258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RME3])

HSP 1 Score: 57.7658 bits (138), Expect = 1.798e-10
Identity = 31/86 (36.05%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  136 SVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKII 393
            +VL   I ++KNGD +  GK +V+N +Y   ++ FL++ T+     + A+R + TP     IKS+++L   GKYVA+ + E+ K I
Sbjct:    6 AVLATRITIYKNGDPFSKGKDIVINHRYYRTFDTFLDNATRYAKCSD-AVRKIVTPQGRHHIKSVDELQNGGKYVAIGR-EAFKKI 89          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO35044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMM4])

HSP 1 Score: 55.4546 bits (132), Expect = 6.433e-10
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1321 AATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNI---KDKAAAKIQAGFRGYHTRQILK 1542
            AAT+IQA FRGYQTR RL+    E K++  S +PKK     ++ E+   Y++   + KAA  IQAG+RGY +R+ +K
Sbjct:    1 AATQIQAHFRGYQTRARLQEGSGESKKAG-SDSPKK-----VSGEQRKAYSVSGEQQKAATAIQAGYRGYRSRKKVK 71          

HSP 2 Score: 45.8246 bits (107), Expect = 1.683e-6
Identity = 31/80 (38.75%), Postives = 39/80 (48.75%), Query Frame = 1
Query: 1654 AAVIIQASFRGYQTRHTLQ----------NKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLK 1863
            AA  IQA FRGYQTR  LQ          +  P+K + E+ K           +   E +KA   IQAG+RGYR R  +K
Sbjct:    1 AATQIQAHFRGYQTRARLQEGSGESKKAGSDSPKKVSGEQRKAY---------SVSGEQQKAATAIQAGYRGYRSRKKVK 71          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO26163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCQ2])

HSP 1 Score: 51.6026 bits (122), Expect = 2.124e-8
Identity = 26/69 (37.68%), Postives = 42/69 (60.87%), Query Frame = 1
Query:  154 ILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYV 360
            + ++KNG+  FPGK+VVVN +   N +  L+ IT+ +  +  A R ++TP  G +I  LE +   G+YV
Sbjct:    6 VTIYKNGEPKFPGKKVVVNPRQVRNMDACLDKITREMKLKTAA-RSLKTPTGGHKIDKLEKIEPGGQYV 73          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Medaka
Match: DCDC2 (doublecortin domain-containing protein 2 [Source:NCBI gene;Acc:101158630])

HSP 1 Score: 102.834 bits (255), Expect = 6.958e-23
Identity = 67/234 (28.63%), Postives = 122/234 (52.14%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINY-----DKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL---PVIRGGRV 819
            +VKNI +F+NGD Y+  +R+VVN+K   N+E  L ++T  +    GA+R + TP  G ++  +E L +  +YVA  + E  K ++Y      K   + +L   TK     L P R++      + +R  + +  +   I+V  NGD   PA++++I  +       +++ I +++ L++   +R +YT  G  +   + +E+G+ YVA   E F+ + Y  +L   P  RG R+
Sbjct:   13 VVKNIFMFRNGDPYYEARRIVVNEKRVCNFETLLREVTGGIQAPFGAVRTIYTPRGGHKVDCMESLHSGEQYVAAGR-ERFKRLDYVQIGTRKKRMMQTLTTPTKP----LPPNRIS------VSARFLKPI-KEPCPIFVVANGDILNPAMRLLIHQRMLGQFDRILEMITEKMGLRVLGGVRSLYTCEGLQVTDGEKLESGQLYVAVGRERFKKLLYSDLLFSKP--RGARI 232          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Medaka
Match: dcdc2b (doublecortin domain-containing protein 2 [Source:NCBI gene;Acc:101170886])

HSP 1 Score: 97.0561 bits (240), Expect = 5.337e-21
Identity = 62/219 (28.31%), Postives = 109/219 (49.77%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFR--LKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL 795
            VK++++++NGD +  G+R VVN++     E FL ++T+S+     A+R + TP  G R+  L+DL T  +YVA +  E  K ++Y  A  V   P   +    +   KP   A            +       II+VF+NGD     ++ +I    ++ +  ++  I ++V L+    +RR+ +L G  +  A ++E G  YVA   E F+ + Y  +L
Sbjct:   14 VKSVVVYRNGDPFHTGRRFVVNQRQVATMEAFLNEVTRSIRA-PLAVRTLYTPKQGHRVTDLQDLQTGAQYVA-AGSERFKKLDYLNA-GVKKQPASREETQVKGVQKPHVTAK----------WREFVPAPCIIHVFRNGDLLCAPLRFLIPRSMRQDLEQILCVISEKVNLRTG-AVRRLCSLEGMTVSSAGELETGHCYVAVGTERFKKLPYEALL 218          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000034154.1 (RP1, axonemal microtubule associated [Source:NCBI gene;Acc:101163696])

HSP 1 Score: 57.3806 bits (137), Expect = 6.670e-8
Identity = 65/229 (28.38%), Postives = 104/229 (45.41%), Query Frame = 1
Query:  139 VLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTP--YHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLP--HHTKSNS--------FRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRV--LLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEY 783
            ++ K +  +K+GD  F G R+V+N +    +E  L+ ++K + P    +R++ TP   HG  I +LED   +GK    S    +K IN   A+    LP  +H +  S         RL P R  NR  + I  R  + L        VF+NGD   P+++  + L   K  +   ++I D +  L+Q +  + ++YT +G   R    I      VA   EPF    Y
Sbjct:   33 IISKRVCFYKSGDPQFNGLRIVINNRTFKTFEALLDSLSKKV-PLPFGVRNITTPRGVHG--IHTLEDFE-DGKSYICSDSRKVKPINL--ALARKKLPPWYHARPVSSRRQTVQQARLFPGRGINRQ-EAIAVRTPKKL-------VVFRNGD---PSVRHTVVL--HKKTTPSYESILDYISELMQFH--VVKLYTPDG---RRVSLIMCSGTVVAVGREPFRPAVY 237          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Medaka
Match: dclk1a (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101167140])

HSP 1 Score: 56.225 bits (134), Expect = 7.490e-8
Identity = 53/213 (24.88%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  145 VKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPY--HGT-RIKSLEDLSTNGKYVALSKGESLKIINYDKAINVN-SLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGK-FYVAASNEPF 768
             K +  ++NGD+YF G    ++      ++  L D+T+SL+      + VRT Y   G+ +I S++ L   G YV  S  E+ K ++Y K +N N S+     S S R  P  L++     ++ R  ++ + +  ++ V ++G +   A+++++  +       ++  I D + L  +  +++IYTL G+++   +D    +  +VA   E F
Sbjct:   49 AKKVRFYRNGDRYFNGIVYAISADRFRTFDALLADLTRSLSDNVNLPQGVRTIYALDGSKKISSVDQLVEGGSYVC-SSTEAYKKLDYTKNVNPNWSVNVKASSTSVR-GPASLSSSKASALDGRENKD-FIRPKLVTVVRSGVKPRKAVRILLNKKTAHSYEQVLTDITDAIKLD-SGVVKKIYTLEGKLVSCLQDFFGDEDIFVACGPEKF 257          
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Medaka
Match: dclk1b (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101155370])

HSP 1 Score: 56.225 bits (134), Expect = 1.291e-7
Identity = 47/207 (22.71%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  148 KNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPY---HGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDI--ENGKFYVAA 753
            K I  ++NGD+YF G    ++ +   + +  L D+T+ L+      + VRT Y     T+I S++ L     YV  S  E  K ++Y K +N N       + S R  P   +N+     E+R +++ + +  ++ + ++G +   A+++++  +       ++  I D + L  +  ++R+YT++G+++   +D   E+  F+   
Sbjct:   52 KKIRFYRNGDRYFKGIVYAISSERFGSLDALLADLTRCLSDNVNLPQGVRTIYTIDGVTKIASMDQLVEGESYVCASI-EPFKKLDYTKNVNPNWSLGAKTAASVRDPPFLCSNK-AGSPETRESKD-FIRPKLVTIVRSGVKPRKAVRILLNKKTAHSFEQVMTDITDAIKLD-SGVVKRLYTVDGKMVTCLQDFFGEDDIFFACG 254          
BLAST of Doublecortin domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000038137.1 (SMESG000038137.1)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 555/564 (98.40%), Postives = 559/564 (99.11%), Query Frame = 1
Query:  616 MSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS 2307
            MSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENN+PV KKHTVYIPK+IKPKNTE HEQDKNPKINYSKVKKEEKEIQAKPQKTQNK RNVESKTTNPKNTNPNKTNADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSPKPYKAPEKKNEKKQEPKRVNETNDNNN+AME AAVIIQASFRGYQTRHTLQNKVPRKTNNE EKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILKQNNQKKQENDNNKEEAAKRIQAGFRGFKTRKEIKNKEK+NQENAAIKIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS
Sbjct:    1 MSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNKPVSKKHTVYIPKSIKPKNTEHHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKSRNVESKTTNPKNTNPNKTNADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSPKPYKAPEKKNEKKQEPKRVNETNDNNNKAMETAAVIIQASFRGYQTRHTLQNKVPRKTNNEPEKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILKQNNQKKQENDNNKEEAAKRIQAGFRGFKTRKEIKNKEKENQENAAIKIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS 564          
BLAST of Doublecortin domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000040481.1 (SMESG000040481.1)

HSP 1 Score: 412.149 bits (1058), Expect = 6.871e-139
Identity = 207/208 (99.52%), Postives = 207/208 (99.52%), Query Frame = 1
Query:  616 MSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNK 1239
            MSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTE HEQDKNPKINYSKVKKEEKEIQAKPQKTQNK
Sbjct:    1 MSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTKVKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEHHEQDKNPKINYSKVKKEEKEIQAKPQKTQNK 208          
BLAST of Doublecortin domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000040480.1 (SMESG000040480.1)

HSP 1 Score: 365.155 bits (936), Expect = 3.919e-121
Identity = 221/221 (100.00%), Postives = 221/221 (100.00%), Query Frame = 1
Query: 1645 MEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILXXXXXXXXXXXXXXXXXXXRIQAGFRGFKTRXXXXXXXXXXXXXXXXXIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS 2307
            MEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILKQNNQKKQENDNNKEEAAKRIQAGFRGFKTRKEIKNKEKKNQENAAIKIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS
Sbjct:    1 MEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILKQNNQKKQENDNNKEEAAKRIQAGFRGFKTRKEIKNKEKKNQENAAIKIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRRDHS 221          

HSP 2 Score: 97.8265 bits (242), Expect = 1.170e-22
Identity = 88/256 (34.38%), Postives = 121/256 (47.27%), Query Frame = 1
Query: 1318 KAATKIQAGFRGYQTRQRLKFNKP-EIKQSKISQNPKKSQPESLTSEKE------------------SDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRR------ILXXXXXXXXXXXXXXXXXXXRIQAGFRG 2010
            KAA  IQA FRGYQTR  L+   P +    +  QN K  +P +   +KE                  +   ++DKAA +IQAGFRGY TR+ILK                      +  + NDNN    E+AA  IQA FRG++TR  ++NK  +   N                       A I IQAGFRGY+ R    ++ K+A++IQAGFR Y+TR+      + K  +   +E    + +AA +IQA FRG
Sbjct:    3 KAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSLKVRDKAAQRIQAGFRGYQTRRILKQ-------------------NNQKKQENDNNK---EEAAKRIQAGFRGFKTRKEIKNKEKKNQEN-----------------------AAIKIQAGFRGYKTRKEFVMKVKSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRG 213          

HSP 3 Score: 75.0998 bits (183), Expect = 6.845e-15
Identity = 98/325 (30.15%), Postives = 135/325 (41.54%), Query Frame = 1
Query: 1000 EIAATKIQAAFRGFQTRKEIEKAKENNEPVPKKHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPRNVESXXXXXXXXXXXXXXADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKSQVSXXXXXXXXXXXXXXXXXXRVNETNDNNNEAMEKAAVIIQASFRGYQTRHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYRIRNSL-----------------KVRDKAAQRIQAGFRGYQTRR 1923
            E AA  IQA+FRG+QTR  ++        VP+K      K    KN EP  ++K+ +I  + +      IQA  +    + RN                 +   R+KAA +IQAGFRGYQTR+ LK            QN +K Q        E+D N K++AA +IQAGFRG+ TR+ +K++                              +  E AA+ IQA FRGY+TR     KV                            K+   IQAGFR Y+ R  +                 + R+ AA +IQA FRG+  RR
Sbjct:    2 EKAAVIIQASFRGYQTRHTLQ------NKVPRKTNNEREKQ-NGKNQEPTNENKDKEIEKAVI-----TIQAGFRGY--RIRN-----------------SLKVRDKAAQRIQAGFRGYQTRRILK------------QNNQKKQ--------ENDNN-KEEAAKRIQAGFRGFKTRKEIKNKEK----------------------------KNQENAAIKIQAGFRGYKTRKEFVMKV----------------------------KSAEKIQAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYRR 218          
BLAST of Doublecortin domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000040482.1 (SMESG000040482.1)

HSP 1 Score: 253.447 bits (646), Expect = 1.680e-79
Identity = 138/143 (96.50%), Postives = 142/143 (99.30%), Query Frame = 1
Query:   46 MTTARVXXXXXXXXXXXXXXXXKNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRL 474
            MTTARVNNENYYEDENEN HENKNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPH+TKSNSFRLKP+++
Sbjct:    1 MTTARVNNENYYEDENENAHENKNPDNTNESVLVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNSLPHNTKSNSFRLKPVKI 143          
BLAST of Doublecortin domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000059704.1 (SMESG000059704.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.920e-47
Identity = 95/274 (34.67%), Postives = 157/274 (57.30%), Query Frame = 1
Query:  142 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINYDKAINVNS---------LPHHTKSNSFRLKPLRLANRDIDKIESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIEDRVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVLPVIRGGRVPSKRNKIKFLNQMPSP---KSDKRSQGSSNEEPTDRSTQ 927
             VKN+ + +NGD +   +R V NKK    W+ FLED+T +LNPR G IR + TP  G++I++ +++  N  YVAL+ GE L++I Y + +             LP    S +  + P  +  R   ++  RI   +  +   I +F+NGD +T AI V++K  E K M +++K + ++V+L  + PIRR++T++GE I     +E+ K Y+A  +EPF    YGQ LP I  G  P K+ +I++LN + +P   K  K+++  SN+  T +S++
Sbjct:   42 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEASSV-PSTVQRR--FQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG--PKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSR 310          
The following BLAST results are available for this feature:
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC23.284e-2925.14doublecortin domain containing 2 [Source:HGNC Symb... [more]
DCDC2B6.768e-2226.09doublecortin domain containing 2B [Source:HGNC Sym... [more]
DCDC2C6.633e-1927.08doublecortin domain containing 2C [Source:HGNC Sym... [more]
ASPM1.017e-825.21abnormal spindle microtubule assembly [Source:HGNC... [more]
DCDC21.295e-735.82doublecortin domain containing 2 [Source:HGNC Symb... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpi-11.297e-937.35pep chromosome:WBcel235:II:13959239:13962417:-1 ge... [more]
rpi-11.400e-937.35pep chromosome:WBcel235:II:13959239:13962417:-1 ge... [more]
C06C3.33.339e-934.78pep chromosome:WBcel235:II:9369178:9372485:-1 gene... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG146872.905e-1438.60gene:FBgn0037835 transcript:FBtr0082280[more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcdc2b5.619e-2530.41doublecortin domain containing 2B [Source:ZFIN;Acc... [more]
si:dkey-25g12.43.203e-2128.13si:dkey-25g12.4 [Source:ZFIN;Acc:ZDB-GENE-160113-7... [more]
dcdc2b3.916e-1430.38doublecortin domain containing 2B [Source:ZFIN;Acc... [more]
aspm3.570e-1123.10abnormal spindle microtubule assembly [Source:ZFIN... [more]
rp1l1a3.543e-926.85rp1 like 1a [Source:ZFIN;Acc:ZDB-GENE-120711-1][more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC25.562e-2527.19doublecortin domain containing 2 [Source:NCBI gene... [more]
DCDC2B5.085e-1824.30doublecortin domain containing 2B [Source:NCBI gen... [more]
lrp82.433e-1021.40LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
lrp82.981e-1021.40LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
lrp83.272e-1021.40LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dcdc2a1.182e-2824.65doublecortin domain containing 2a [Source:MGI Symb... [more]
Dcdc2a1.531e-2725.86doublecortin domain containing 2a [Source:MGI Symb... [more]
Dcdc2c2.729e-2030.22doublecortin domain containing 2C [Source:MGI Symb... [more]
Dcdc2c3.135e-2030.22doublecortin domain containing 2C [Source:MGI Symb... [more]
Dcdc2b1.019e-1625.34doublecortin domain containing 2b [Source:MGI Symb... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UHG0|DCDC2_HUMAN1.577e-2825.14Doublecortin domain-containing protein 2 OS=Homo s... [more]
sp|D3ZR10|DCDC2_RAT3.398e-2824.30Doublecortin domain-containing protein 2 OS=Rattus... [more]
sp|Q5DU00|DCDC2_MOUSE8.978e-2824.65Doublecortin domain-containing protein 2 OS=Mus mu... [more]
sp|A2VCK2|DCD2B_HUMAN3.250e-2126.09Doublecortin domain-containing protein 2B OS=Homo ... [more]
sp|Q9D1B8|DCD2C_MOUSE1.692e-1930.22Doublecortin domain-containing protein 2C OS=Mus m... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RKY81.322e-5530.46Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A267H8Q01.445e-4330.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EGS02.650e-4330.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IEM12.863e-4329.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GFD52.192e-4230.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050955.11.898e-2330.49pep primary_assembly:Astyanax_mexicanus-2.0:9:1969... [more]
dcdc2b4.362e-2329.49doublecortin domain containing 2B [Source:ZFIN;Acc... [more]
ENSAMXT00000055346.13.451e-1927.65pep primary_assembly:Astyanax_mexicanus-2.0:9:1970... [more]
ENSAMXT00000039996.17.230e-1927.48doublecortin domain containing 2 [Source:NCBI gene... [more]
ENSAMXT00000036226.17.749e-1325.05pep primary_assembly:Astyanax_mexicanus-2.0:5:1920... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007117.12.813e-623.04pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO462556.227e-2429.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472581.798e-1036.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350446.433e-1045.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261632.124e-837.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC26.958e-2328.63doublecortin domain-containing protein 2 [Source:N... [more]
dcdc2b5.337e-2128.31doublecortin domain-containing protein 2 [Source:N... [more]
ENSORLT00000034154.16.670e-828.38RP1, axonemal microtubule associated [Source:NCBI ... [more]
dclk1a7.490e-824.88serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
dclk1b1.291e-722.71serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
back to top
BLAST of Doublecortin domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038137.10.000e+098.40SMESG000038137.1[more]
SMESG000040481.16.871e-13999.52SMESG000040481.1[more]
SMESG000040480.13.919e-121100.00SMESG000040480.1[more]
SMESG000040482.11.680e-7996.50SMESG000040482.1[more]
SMESG000059704.11.920e-4734.67SMESG000059704.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002064 ID=SMED30002064|Name=Doublecortin domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2532bp
TTGAAATAATTTTAAACTCGCAATATTTCATGAATAAAATTTAAAATGAC
AACTGCTAGAGTTAACAACGAAAATTATTACGAAGATGAAAATGAAAATA
CTCACGAAAATAAAAATCCTGACAATACAAATGAAAGCGTATTGGTAAAA
AATATTTTACTTTTTAAAAATGGAGATCAATATTTTCCGGGCAAACGAGT
TGTTGTCAATAAGAAATATACTCCAAATTGGGAATGCTTTCTAGAAGACA
TAACTAAAAGCCTAAATCCCAGAAATGGTGCAATACGAGACGTTAGAACA
CCTTATCATGGTACCAGAATAAAGAGTCTCGAAGATTTATCAACGAATGG
AAAATATGTTGCTCTTTCAAAAGGGGAAAGTTTGAAAATAATCAATTATG
ATAAAGCCATCAACGTAAATAGTCTTCCTCACCATACCAAATCAAATTCC
TTTCGTTTGAAACCGCTGCGTTTGGCAAATCGTGATATAGATAAAATTGA
AAGTAGAATTACACAAAATCTCTACACGAAAAGTAACATAATCTATGTAT
TTAAAAATGGCGATCGATTTACGCCAGCCATTAAAGTGGTCATAAAATTA
CAAGAACAAAAGCATATGAGCGTTTTAGTGAAAGCCATTGAAGACAGAGT
TTTGCTGCAAATAAACAGACCAATTAGACGAATTTATACTTTGAATGGAG
AAATAATCAGATATGCCAAAGATATTGAGAATGGGAAGTTTTATGTTGCC
GCATCGAATGAGCCTTTTGAAAATATTGAATATGGTCAAGTCTTGCCAGT
GATCAGAGGTGGAAGAGTTCCATCAAAACGAAATAAAATCAAGTTTCTAA
ATCAGATGCCATCTCCGAAAAGCGATAAACGTTCACAAGGATCCAGTAAT
GAAGAACCAACAGATAGATCAACACAGTCAGTTGAATCGACTAAAGTCAA
ACCAAAAAATTCGGAAAAGCGATCATTAAAAAAACAAAAAAATGATAATG
AAATTGCTGCTACTAAAATTCAAGCTGCTTTTAGAGGATTCCAAACAAGA
AAAGAAATAGAAAAAGCAAAAGAAAATAATGAACCAGTTCCTAAAAAGCA
CACTGTCTATATTCCTAAAAACATTAAACCTAAAAATACTGAACCTCATG
AACAAGATAAAAACCCAAAAATAAATTACAGTAAAGTAAAGAAAGAAGAA
AAAGAAATTCAAGCAAAACCACAAAAAACTCAAAATAAACCTAGAAATGT
TGAATCTAAAACAACCAATCCAAAAAATACCAATCCAAATAAAACAAATG
CCGATGATAAGCGGAATAAAGCAGCAACGAAAATTCAAGCAGGTTTTCGA
GGTTATCAAACTAGACAACGTTTGAAATTCAATAAGCCTGAGATTAAACA
ATCTAAAATCTCCCAAAATCCAAAGAAATCTCAACCAGAATCATTAACAT
CCGAAAAGGAGTCTGATTATAATATTAAAGATAAAGCTGCTGCGAAAATT
CAAGCCGGTTTCCGTGGTTATCACACTCGTCAAATTTTAAAAAGTCAAGT
TTCACCAAAACCATATAAAGCACCGGAGAAGAAAAATGAAAAGAAGCAAG
AACCAAAACGAGTAAATGAGACTAATGATAATAACAATGAAGCAATGGAA
AAAGCTGCTGTAATTATTCAAGCAAGTTTTAGAGGTTATCAAACTCGCCA
TACTTTACAAAATAAAGTTCCACGAAAAACAAACAATGAACGTGAGAAAC
AAAATGGAAAAAACCAAGAACCAACAAATGAAAATAAAGACAAAGAAATA
GAAAAAGCCGTCATAACTATTCAGGCTGGTTTTAGAGGTTATAGAATAAG
AAACAGTTTAAAGGTAAGAGATAAAGCTGCTCAAAGAATCCAAGCAGGTT
TCAGGGGTTATCAAACTAGAAGAATTCTCAAGCAAAATAACCAAAAAAAA
CAAGAAAATGATAATAATAAAGAAGAAGCTGCCAAACGAATACAAGCAGG
ATTCAGAGGTTTTAAAACTCGAAAAGAAATTAAAAACAAAGAGAAGAAAA
ACCAAGAAAATGCTGCGATTAAAATCCAAGCTGGATTTAGAGGCTATAAA
ACAAGAAAAGAATTCGTGATGAAAGTAAAGTCAGCCGAAAAAATTCAAGC
TGGATTCAGAAGTTACAAAACCAGAAAGGAAATATCAGAGAAACCAGTTA
CAAAACCAAAGTCTTTGTCACCGGAAGAGCAAGCTCAAGAAAGGAATGAT
GCTGCAGCAAAAATTCAAGCGGCCTTTAGAGGACATGTTTATAGAAGAGA
CCACAGTTAAATTATAAAAACAGATTCAGATTTTGTTATTTACTAATTTT
ATGCACCTATCAGAAAATTTGTAAAATTCTACTTCCAAACGATAAATTAG
AACCAGAAATTTTAATAGTATTTATCGGTGAAATATTTCAGAAAATTAAT
TTATTTTTCATGTGTAAAAATATTTCCTACTTTCTTGTTGAGAACTTTTG
AATTCATGGTTAAAATGCACCTCAGAATTTTT
back to top

protein sequence of SMED30002064-orf-1

>SMED30002064-orf-1 ID=SMED30002064-orf-1|Name=SMED30002064-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=755bp
MTTARVNNENYYEDENENTHENKNPDNTNESVLVKNILLFKNGDQYFPGK
RVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLST
NGKYVALSKGESLKIINYDKAINVNSLPHHTKSNSFRLKPLRLANRDIDK
IESRITQNLYTKSNIIYVFKNGDRFTPAIKVVIKLQEQKHMSVLVKAIED
RVLLQINRPIRRIYTLNGEIIRYAKDIENGKFYVAASNEPFENIEYGQVL
PVIRGGRVPSKRNKIKFLNQMPSPKSDKRSQGSSNEEPTDRSTQSVESTK
VKPKNSEKRSLKKQKNDNEIAATKIQAAFRGFQTRKEIEKAKENNEPVPK
KHTVYIPKNIKPKNTEPHEQDKNPKINYSKVKKEEKEIQAKPQKTQNKPR
NVESKTTNPKNTNPNKTNADDKRNKAATKIQAGFRGYQTRQRLKFNKPEI
KQSKISQNPKKSQPESLTSEKESDYNIKDKAAAKIQAGFRGYHTRQILKS
QVSPKPYKAPEKKNEKKQEPKRVNETNDNNNEAMEKAAVIIQASFRGYQT
RHTLQNKVPRKTNNEREKQNGKNQEPTNENKDKEIEKAVITIQAGFRGYR
IRNSLKVRDKAAQRIQAGFRGYQTRRILKQNNQKKQENDNNKEEAAKRIQ
AGFRGFKTRKEIKNKEKKNQENAAIKIQAGFRGYKTRKEFVMKVKSAEKI
QAGFRSYKTRKEISEKPVTKPKSLSPEEQAQERNDAAAKIQAAFRGHVYR
RDHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000048IQ_motif_EF-hand-BS
IPR003533Doublecortin_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007605sensory perception of sound
GO:0030111regulation of Wnt signaling pathway
GO:1902017regulation of cilium assembly
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005929cilium