Cytochrome P450 4B1

Overview
NameCytochrome P450 4B1
Smed IDSMED30002049
Length (bp)1810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 4B1 (SMED30002049) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 4B1 (SMED30002049) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 4B1 (SMED30002049) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 4B1 (SMED30002049) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002049

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002049SMESG000051521.1 dd_Smed_v4_9158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002049SMESG000051521.1 dd_Smed_v4_9158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002049SMESG000051521.1 dd_Smed_v4_9158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002049SMESG000051521.1 dd_Smed_v6_9158_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30002049SMESG000051741.1 SMESG000051521.1 SMESG000047635.1 SMESG000040065.1 SMESG000021628.1 Contig40722newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002049SMESG000051741.1 SMESG000051521.1 SMESG000047635.1 SMESG000040065.1 SMESG000021628.1 Contig40722uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30002049SMESG000051521.1 dd_Smed_v4_9158_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30002049SMESG000051521.1 PL06015A1G04_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 4B1 vs. Ensembl Human
Match: TTC29 (tetratricopeptide repeat domain 29 [Source:HGNC Symbol;Acc:HGNC:29936])

HSP 1 Score: 219.935 bits (559), Expect = 7.150e-64
Identity = 138/453 (30.46%), Postives = 244/453 (53.86%), Query Frame = 3
Query:  165 WNYLHGKMHSLIDVVQPSTGMSANVDFRHKDELIPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            W  LH    S +  + P       +    + +L PC + + P      ++ + +D +    L  +   L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL  L   L+ AED  R + F+ ++++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L+N    E  Q I  L +A + A+EG  K +E + SY LGLA+   ++ + A+  L  Y  IS  ++DD +      A+AKV +SQ +  E IKYL++F + A  + Q     +A   LGD+YN  G + KAS  F ++F  +        +DE ++ +G+++ + +  T + ++  A   ++  L++WK+
Sbjct:   16 WKSLHSSSESEMTTLPPLPMTRPKLTALARQKL-PCSSRKIPRS----QLIKEKD-DIDHYLEVNFKGLSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYFNN-SEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLEN---KEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTYCKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQSLDLVRASTMLGDIYNEKGYYNKASECFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESADLTSLNYLLSWKE 458          
BLAST of Cytochrome P450 4B1 vs. Ensembl Human
Match: TTC29 (tetratricopeptide repeat domain 29 [Source:HGNC Symbol;Acc:HGNC:29936])

HSP 1 Score: 217.238 bits (552), Expect = 3.182e-63
Identity = 127/385 (32.99%), Postives = 220/385 (57.14%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL  L   L+ AED  R + F+ ++++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L+N    E  Q I  L +A + A+EG  K +E + SY LGLA+   ++ + A+  L  Y  IS  ++DD +      A+AKV +SQ +  E IKYL++F + A  + Q     +A   LGD+YN  G + KAS  F ++F  +        +DE ++ +G+++ + +  T + ++  A   ++  L++WK+
Sbjct:   52 LSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYFNN-SEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLEN---KEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTYCKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQSLDLVRASTMLGDIYNEKGYYNKASECFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESADLTSLNYLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. Ensembl Human
Match: TTC29 (tetratricopeptide repeat domain 29 [Source:HGNC Symbol;Acc:HGNC:29936])

HSP 1 Score: 217.238 bits (552), Expect = 4.137e-63
Identity = 127/385 (32.99%), Postives = 220/385 (57.14%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL  L   L+ AED  R + F+ ++++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L+N    E  Q I  L +A + A+EG  K +E + SY LGLA+   ++ + A+  L  Y  IS  ++DD +      A+AKV +SQ +  E IKYL++F + A  + Q     +A   LGD+YN  G + KAS  F ++F  +        +DE ++ +G+++ + +  T + ++  A   ++  L++WK+
Sbjct:   52 LSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYFNN-SEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLEN---KEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTYCKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQSLDLVRASTMLGDIYNEKGYYNKASECFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESADLTSLNYLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. Ensembl Human
Match: TTC29 (tetratricopeptide repeat domain 29 [Source:HGNC Symbol;Acc:HGNC:29936])

HSP 1 Score: 161.77 bits (408), Expect = 9.570e-44
Identity = 97/278 (34.89%), Postives = 162/278 (58.27%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFR 1202
            L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL  L   L+ AED  R + F+ ++++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L+   N E  Q I  L +A + A+EG  K +E + SY LGLA+   ++ + A+  L  Y  IS  ++DD +      A+AKV +
Sbjct:   52 LSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYFNN-SEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLE---NKEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTYCKISTDLDDDLSLGRGYEAIAKVLQ 325          
BLAST of Cytochrome P450 4B1 vs. Ensembl Human
Match: TTC29 (tetratricopeptide repeat domain 29 [Source:HGNC Symbol;Acc:HGNC:29936])

HSP 1 Score: 149.828 bits (377), Expect = 6.161e-40
Identity = 89/253 (35.18%), Postives = 149/253 (58.89%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQY 1127
            L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL  L   L+ AED  R + F+ ++++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L+   N E  Q I  L +A + A+EG  K +E + SY LGLA+   ++ + A+  L  Y
Sbjct:   52 LSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYFNN-SEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLE---NKEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTY 300          
BLAST of Cytochrome P450 4B1 vs. Ensembl Zebrafish
Match: ttc29 (tetratricopeptide repeat domain 29 [Source:ZFIN;Acc:ZDB-GENE-100922-181])

HSP 1 Score: 150.214 bits (378), Expect = 2.846e-39
Identity = 104/384 (27.08%), Postives = 187/384 (48.70%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWK 1520
            +T+ EI+       QN+C+ ML  G+  +F ELF L+ + ++E ++           P+     KL  L+  L+ AE   R + +   Y ++  +A FF    EDKW+  HFL+     +++++ D   + AEA   +G A  +  + E A  +    Y L+  + W++ N  +    +CE L  +   M++  L + +  E A K+S  R+A   A+E G + LEG+ +Y+LGLAYQ      +A+ +L  Y  I+  + D ++   A  A+AK   S+ K  E I+  E++ E  + S   +   +A   LG +      + +A  YF R+F +       R + EA++  G+++  +   TF  ++ +   Q +  L+ WK
Sbjct:   45 MTETEIAQIGKPLRQNICVEMLRDGFPHSFKELFALLQRWDEEDDD-----------PL-----KLQTLQLHLTRAEAAERSEKYDEAYENHMLMARFF---TEDKWMKHHFLELALRSARKVIMDSGKREAEARSLVGQAYLEKGDLELAQEHLEVFYQLTAGRTWQDSNGRMQHSRSCEELQTVYTLMAQRSLQD-QQYEQAIKMS--RKAYTIAKESGDRALEGEAAYRLGLAYQSTGDQKIAMKFLSSYMEIALTLEDTDSLGRAHEAMAKCLESEGKITEAIELWEKYVETCKSSKHDQNLERAYMNLGHILKSQKRYGEARVYFERAFELVCLEGCPRRVQEAQVYVGITRALS---TFPAYMKLIQDQNLDALLAWK 403          
BLAST of Cytochrome P450 4B1 vs. Ensembl Zebrafish
Match: ttc29 (tetratricopeptide repeat domain 29 [Source:ZFIN;Acc:ZDB-GENE-100922-181])

HSP 1 Score: 143.28 bits (360), Expect = 1.005e-36
Identity = 106/393 (26.97%), Postives = 185/393 (47.07%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAIN---------YLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWK 1520
            +T+ EI+       QN+C+ ML  G+  +F ELF L+ + +    EA  D              KL  L+  L+ AE   R   +   Y ++  LA FF    EDKW+  HFL+     +++++ D   + AEA   +G A  +  + E A  +    Y L+  + W++ N  +    +CE L  +   M++  L + +  E A K+S  R+A   A+E G + LEG+ +Y+LGLAYQ      +A+          +L  Y  I+  + D ++   A  A+AK   S+ K  E I+  E++ E  + S Q +   +A  +LG +      + +A  YF R+  ++      R + EA++  G+++  +   TF  ++ +   Q +  L+ WK
Sbjct:   45 MTETEIAQIGKPLRQNICVEMLRDGFPHSFKELFALLQRWD----EADDDP------------HKLQTLQLHLTRAEAAERAGKYDEAYENHMLLARFF---TEDKWMKHHFLELALRSARKVIMDSGKREAEARSLVGQAYLEKGDLELAQEHLEVFYQLTAGRTWQDSNGRMQHSRSCEELQTVYTLMAQRSLQD-QQYEQAIKMS--RKAYTIAKESGDRALEGEAAYRLGLAYQSTGDQKIAMKVCSDSLILFFLSSYMEIALTLEDTDSLGRAHEAMAKCLESEGKITEAIELWEKYVETCKSSKQDQNLERAYMSLGHILKSQKRYGEARVYFERALELACLEGCPRRVQEAQVYVGITRALS---TFPAYMKLIQDQNLDALLAWK 412          
BLAST of Cytochrome P450 4B1 vs. Ensembl Zebrafish
Match: ttc29 (tetratricopeptide repeat domain 29 [Source:ZFIN;Acc:ZDB-GENE-100922-181])

HSP 1 Score: 142.124 bits (357), Expect = 2.726e-36
Identity = 103/395 (26.08%), Postives = 187/395 (47.34%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAI-----------NYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWK 1520
            +T+ EI+       QN+C+ ML  G+  +F ELF L+ + ++E ++           P+ +Q  +L L +     AE   R + +   Y ++  +A FF    EDKW+  HFL+     +++++ D   + AEA   +G A  +  + E A  +    Y L+  + W++ N  +    +CE L  +   M++  L + +  E A K+S  R+A   A+E G + LEG+ +Y+LGLAYQ      +A+            +L  Y  I+  + D ++   A  A+AK   S+ K  E I+  E++ E  + S   +   +A   LG +      + +A  YF R+F +       R + EA++  G+++  +   TF  ++ +   Q +  L+ WK
Sbjct:   45 MTETEIAQIGKPLRQNICVEMLRDGFPHSFKELFALLQRWDEEDDD-----------PLKLQTLQLHLTR-----AEAAERSEKYDEAYENHMLMARFF---TEDKWMKHHFLELALRSARKVIMDSGKREAEARSLVGQAYLEKGDLELAQEHLEVFYQLTAGRTWQDSNGRMQHSRSCEELQTVYTLMAQRSLQD-QQYEQAIKMS--RKAYTIAKESGDRALEGEAAYRLGLAYQSTGDQKIAMKVCSDSLICFRQFLSSYMEIALTLEDTDSLGRAHEAMAKCLESEGKITEAIELWEKYVETCKSSKHDQNLERAYMNLGHILKSQKRYGEARVYFERAFELVCLEGCPRRVQEAQVYVGITRALS---TFPAYMKLIQDQNLDALLAWK 414          
BLAST of Cytochrome P450 4B1 vs. Ensembl Xenopus
Match: ebf2 (EBF transcription factor 2 [Source:Xenbase;Acc:XB-GENE-971136])

HSP 1 Score: 226.098 bits (575), Expect = 2.218e-66
Identity = 135/413 (32.69%), Postives = 227/413 (54.96%), Query Frame = 3
Query:  351 RSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIVTVR 1589
            + +I  L+K E + YRNS   N+C+ ML KGYH++FSE++ ++ + +  R+ AGP S +W   P+  Q++KL  L+  L+ AE   R   ++ +Y +   LA +F+   +D WL  HF + C+  + +I  D   K AEA+  +G   E++ + E+A  ++ A Y L+  + WK+E        ACE+L  I    S+  L    N E  Q I  L +A D AREGG K LEG+ +Y+LGLA+     P  AI YL  Y  ISK + D+ +   A  A+AK   SQ K  E ++YLE F + A+ +   ++ ++    LGD++N  G ++KA  YFS+++  +   ++   I+EA++ +G+++ + +  T S+    A   +V  L+ WK +    +   G P    K+++++
Sbjct:   53 QKNIKELSKEETAIYRNSLKNNICIEMLRKGYHKSFSEVYTVIQRWDALRDAAGPGSAIWHQKPLEEQQEKLDQLQHFLTRAEAAQRAGYYEEVYENQLALAQYFQEVGDD-WLSYHFFECCFQTATKIKMDGGRKEAEAHSNIGSVEEEHGQLEKAAEHYEAFYHLTVGRIWKDETGRSHNSLACENLWRIYTLQSDKML---ANKECQQAIKTLIKAFDMAREGGNKKLEGEAAYRLGLAHISSGNPQTAITYLNTYMEISKMLEDNVSLGKAYKAMAKALESQGKILESVEYLENFIKIAKLNNLNQSLAETYSCLGDIFNTRGNYEKACQYFSKAYETALSLSELALIEEAQVQYGIAKAHEMMLTVSKLTDSADCASVGHLLTWKMN---RSDIFGDPAKPDKLISMQ 458          
BLAST of Cytochrome P450 4B1 vs. Ensembl Mouse
Match: Ttc29 (tetratricopeptide repeat domain 29 [Source:MGI Symbol;Acc:MGI:1920551])

HSP 1 Score: 213.001 bits (541), Expect = 7.827e-62
Identity = 134/420 (31.90%), Postives = 233/420 (55.48%), Query Frame = 3
Query:  264 IPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            +PC + + P     IK    E  +  + L  +   L+K E++ +RNS+ +++C+ ML  G+H++F+ELF L+++ +K RE A   S+ W   P+  Q DKL      L+ AE   R   ++ +Y++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA  ++GL  E+  E  +A  ++ A + L+  + WK+    LL + ACE L      +S+  L+N K+ + A KI  L +A + AREG  +++EG+ SY LGLA+    + + A+  L +Y  IS +++DD     A  A+AK  +SQ +  E I YLE+F   A  +LQ     +AC  LGD+YN  G++ KAS YF ++F  +     +  +DE ++ +G+++ + +      ++  A    +  L++WK+
Sbjct:   22 LPCSSKKIP-RAQLIK----EKEDIDYYLEQNFKGLSKEEVAAHRNSYKKSICVDMLRDGFHKSFTELFALMEQWDKLREAAKAQSLFWQQRPLEDQPDKLDNFYHYLTRAEAAERKGYYEEVYNNLYALACYFDN-SEDKWVRNHFYERCFNIAQLIKADGGKKEAEAESHMGLLFEEEGELLKAAEHYEAFHELTHGRLWKDGTGQLLNLVACESLVRTYRLLSDRMLEN-KDYKQAIKI--LIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALTVLNRYSEISTSLDDDHGLGRAYEAIAKALQSQGETTEAINYLEKFVTIARNNLQSLDMIRACTMLGDIYNEKGQYSKASEYFQQAFSTAMELMKTALMDETKVHYGIARAHQMMLAMKGYIESADSNGLNCLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. Ensembl Mouse
Match: Ttc29 (tetratricopeptide repeat domain 29 [Source:MGI Symbol;Acc:MGI:1920551])

HSP 1 Score: 213.001 bits (541), Expect = 7.827e-62
Identity = 134/420 (31.90%), Postives = 233/420 (55.48%), Query Frame = 3
Query:  264 IPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            +PC + + P     IK    E  +  + L  +   L+K E++ +RNS+ +++C+ ML  G+H++F+ELF L+++ +K RE A   S+ W   P+  Q DKL      L+ AE   R   ++ +Y++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA  ++GL  E+  E  +A  ++ A + L+  + WK+    LL + ACE L      +S+  L+N K+ + A KI  L +A + AREG  +++EG+ SY LGLA+    + + A+  L +Y  IS +++DD     A  A+AK  +SQ +  E I YLE+F   A  +LQ     +AC  LGD+YN  G++ KAS YF ++F  +     +  +DE ++ +G+++ + +      ++  A    +  L++WK+
Sbjct:   22 LPCSSKKIP-RAQLIK----EKEDIDYYLEQNFKGLSKEEVAAHRNSYKKSICVDMLRDGFHKSFTELFALMEQWDKLREAAKAQSLFWQQRPLEDQPDKLDNFYHYLTRAEAAERKGYYEEVYNNLYALACYFDN-SEDKWVRNHFYERCFNIAQLIKADGGKKEAEAESHMGLLFEEEGELLKAAEHYEAFHELTHGRLWKDGTGQLLNLVACESLVRTYRLLSDRMLEN-KDYKQAIKI--LIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALTVLNRYSEISTSLDDDHGLGRAYEAIAKALQSQGETTEAINYLEKFVTIARNNLQSLDMIRACTMLGDIYNEKGQYSKASEYFQQAFSTAMELMKTALMDETKVHYGIARAHQMMLAMKGYIESADSNGLNCLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. UniProt/SwissProt
Match: sp|Q4R6M4|TTC29_MACFA (Tetratricopeptide repeat protein 29 OS=Macaca fascicularis OX=9541 GN=TTC29 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 5.587e-66
Identity = 130/385 (33.77%), Postives = 220/385 (57.14%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL      L+ AED  R   F+ +Y++ + LA +F + PEDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L   +N E  Q I  L +A + A+EG  K +EG+ SY LGLA+   ++ + A+  L  Y  IS  ++DD +   A  A+AKV +SQ    E IKYL++F + A  + Q     +A   LGD+YN  G + KAS  F ++F  +        +DE ++ +G+++ + +  T + ++  A   ++  L++WK+
Sbjct:   52 LSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMEQWDALREAARVRSLFWLQKPLEEQPDKLDYFYHYLTRAEDAERKKSFEDVYNNLYALACYFNN-PEDKWVRNHFYERCFKIAQLIKIDGGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKML---QNKEYKQAIKILIKASEIAKEGSDKKMEGEASYYLGLAHLAAEEYETALTVLDTYCKISTELDDDLSLGRAYEAIAKVLQSQGNTTEAIKYLKKFVKIARNNFQSLDFVRASTMLGDIYNEKGHYNKASQRFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESADLTSLNYLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. UniProt/SwissProt
Match: sp|Q32NR4|TTC29_XENLA (Tetratricopeptide repeat protein 29 OS=Xenopus laevis OX=8355 GN=ttc29 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.170e-65
Identity = 135/403 (33.50%), Postives = 220/403 (54.59%), Query Frame = 3
Query:  351 RSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKP 1559
            + +I  L+K E + YRNS  +N+C+ ML KGYH++FSE+F ++ +    R+ AGP S +W   P+  Q++ L  L+  L+ AE   R   ++ +Y +   LA +F+   +D+WL  HF + C+  + +I  D   K AEA+  LGLA E++ + E++  ++ A Y L+  + WK+E        ACE+L  I    S+  L+N    E  Q I  L +A D AREG  K LEG+ +Y+LGLA+     P +AI YL  Y  ISK + D+ +   A  A+AK   SQ K  E ++YLE F + A+ +    +  +    LGD++N  G ++KA  YFS ++  +   +D   I+E ++ + +S+ + +  T S     A   ++  L+ WK +  +  S+  KP
Sbjct:   53 QKNIKELSKEETAIYRNSLKKNICIEMLRKGYHKSFSEVFTVIQRWNALRDAAGPGSAIWHQKPLEEQQEILDQLQHFLTRAEAAQRAGYYEDVYKNQLALAQYFQEL-DDRWLSYHFFECCFQTATKIKSDGGRKEAEAHENLGLAEEEHGQLEKSAEHYEAFYHLTVGRIWKDETGRSHNSLACENLWRIYTLQSDKMLENR---ECQQAIKTLIKAFDMAREGDNKKLEGEAAYRLGLAHISSGNPQMAITYLNTYMEISKMLEDNVSLGKAYKAMAKALESQGKILESVEYLENFIKIAKLNNLSRSLIETYSCLGDIFNTRGNYEKACQYFSEAYETALSLSDLALIEETQVQYSISKAHKMMLTVSRLTDTADYASIGHLLAWKMNRSDIFSDPAKP 451          
BLAST of Cytochrome P450 4B1 vs. UniProt/SwissProt
Match: sp|Q8NA56|TTC29_HUMAN (Tetratricopeptide repeat protein 29 OS=Homo sapiens OX=9606 GN=TTC29 PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 1.987e-62
Identity = 127/385 (32.99%), Postives = 220/385 (57.14%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            L+K E++ YRNS+ +N+C+ ML  GYH++F+ELF L+++ +  RE A   S+ W   P+  Q DKL  L   L+ AED  R + F+ ++++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA+ ++GL  E++ +  EA  ++ A + L++ + WK+E    L + ACE L      +S+  L+N    E  Q I  L +A + A+EG  K +E + SY LGLA+   ++ + A+  L  Y  IS  ++DD +      A+AKV +SQ +  E IKYL++F + A  + Q     +A   LGD+YN  G + KAS  F ++F  +        +DE ++ +G+++ + +  T + ++  A   ++  L++WK+
Sbjct:   52 LSKEEVAAYRNSYKKNICVDMLRDGYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYFNN-SEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLEN---KEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTYCKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQSLDLVRASTMLGDIYNEKGYYNKASECFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESADLTSLNYLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. UniProt/SwissProt
Match: sp|Q6AYP3|TTC29_RAT (Tetratricopeptide repeat protein 29 OS=Rattus norvegicus OX=10116 GN=Ttc29 PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.821e-61
Identity = 131/420 (31.19%), Postives = 238/420 (56.67%), Query Frame = 3
Query:  264 IPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            +PC +   P      ++ + +D +  + L  +I  L+K E++ +RNS+ +++C+ ML  G+H++F+ELF L+++ +K RE A   S+ W   P+  Q DKL      L+ AE   R   ++ +Y++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA  ++GL  E+  E  +A  ++ A + L++ + WK+     L + ACE L      +S+  L   +N +  Q I  L +A + AREG  +++EG+ SY LGLA+    + + A++ L +Y  IS +++D+ +   A  A+AKV +SQ +  E IKYLE+F   A  + +     QAC  LGD+YN  G++ KAS YF ++F  +     +  +DE ++ +G+++ + +  T + ++  A   ++  L++WK+
Sbjct:   22 LPCSSKSIPR----AQLIKEKD-DIDYYLEQNIKGLSKEEVAAHRNSYKKSICVDMLRDGFHKSFTELFSLMEQWDKLREAAQARSLFWLQRPLEDQPDKLDNFYHYLTKAEAAERKGYYEEVYNNLYALACYFDN-SEDKWVRNHFYERCFKIAQLIKVDGGKKEAEAEAHMGLLYEEEGELLKAAEHYEAFHELTQGRLWKDATGQFLNLIACESLVRTYRLLSDRML---QNRDYKQAIKILIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALSVLDRYSEISTSLDDELSLGRAYEAMAKVLQSQGEMTEAIKYLEKFVVIARNNFKSLDVIQACTMLGDIYNEKGQYNKASDYFQQAFSTAMEVTKTTLMDETKVHYGIARAHQMMLTMNGYIESADMNSLNCLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. UniProt/SwissProt
Match: sp|Q80VM3|TTC29_MOUSE (Tetratricopeptide repeat protein 29 OS=Mus musculus OX=10090 GN=Ttc29 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.952e-60
Identity = 133/420 (31.67%), Postives = 232/420 (55.24%), Query Frame = 3
Query:  264 IPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKK 1523
            +PC + + P     IK    E  +  + L  +   L+K E++ +RNS+ +++C+ ML  G+H++F+ELF L+++ +K  E A   S+ W   P+  Q DKL      L+ AE   R   ++ +Y++ + LA +F +  EDKW+ +HF + C+ +++ I  D   K AEA  ++GL  E+  E  +A  ++ A + L+  + WK+    LL + ACE L      +S+  L+N K+ + A KI  L +A + AREG  +++EG+ SY LGLA+    + + A+  L +Y  IS +++DD     A  A+AK  +SQ +  E I YLE+F   A  +LQ     +AC  LGD+YN  G++ KAS YF ++F  +     +  +DE ++ +G+++ + +      ++  A    +  L++WK+
Sbjct:   22 LPCSSKKIP-RAQLIK----EKEDIDYYLEQNFKGLSKEEVAAHRNSYKKSICVDMLRDGFHKSFTELFALMEQWDKLPEAAKAQSLFWQQRPLEDQPDKLDNFYHYLTRAEAAERKGYYEEVYNNLYALACYFDN-SEDKWVRNHFYERCFNIAQLIKADGGKKEAEAESHMGLLFEEEGELLKAAEHYEAFHELTHGRLWKDGTGQLLNLVACESLVRTYRLLSDRMLEN-KDYKQAIKI--LIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALTVLNRYSEISTSLDDDHGLGRAYEAIAKALQSQGETTEAINYLEKFVTIARNNLQSLDMIRACTMLGDIYNEKGQYSKASEYFQQAFSTAMELMKTALMDETKVHYGIARAHQMMLAMKGYIESADSNGLNCLLSWKE 432          
BLAST of Cytochrome P450 4B1 vs. TrEMBL
Match: A0A267GPY0 (TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030719g1 PE=4 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 9.978e-97
Identity = 164/452 (36.28%), Postives = 258/452 (57.08%), Query Frame = 3
Query:  261 LIPCPAGRPPTHLDPIKIFRGEDAETVWK----LRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQ-PWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIVTVRSRFP 1601
            ++P P G PP HL P+K  R    ET  +     R ++PYLT V+ ++YRN F++ LC  +L+ G+HR F+E+ HL+ +Q ++RE AGP+S+LW ++P+  Q +KL  L   L AAE+  R  D    Y +Y  LA +F+  P DKWL DH+   C      +  D   K AEA+Y  G+A+E+    EEA  +F   Y  ++ Q  W   +   L   ACE LA + +S S+   D     E A+++  L++A   A+E G   LE +C++ LG  +  +DKPD A+++  ++Y ++  ++D E   +AC ALA  +  Q K E  +KYLEEFA+  E   Q    S+ACR LG  +N  GEF++A+ YFS++F ++R   D   I   R+ +G+SQ  +    ++E +  A+ Q+ + L+ WK+  K +  ++ KP+AD+   T+ SR P
Sbjct:   13 VVPDPTGPPPKHLKPLKGARRGKEETKKQEQQTFREELPYLTPVQTAEYRNPFFETLCTSILTDGFHRTFTEMLHLIKQQRRDREVAGPESMLWQITPLEEQPEKLKNLSRYLMAAENSERKGDHLAAYEAYLYLAHYFEEEPNDKWLSDHYYDRCLRSGPLVQGDGGRKLAEAHYNKGMAMERGGRLEEAMTHFAVFYDRTRGQDAWVQRDGKGLHRVACEALARVHISRSDQLPD-----EAAREL--LQKAHSIAKESGNTFLEARCAHHLGNVFDRIDKPDTALHFYKEFYQLASKLDDPEQLGLACEALATAYEKQGKAETSVKYLEEFAKVTE-GKQDRLFSRACRGLGAAFNKQGEFQRAADYFSKAFSVARTLQDKEDIYLTRMQYGISQAFSFLSPYTEQLRAATPQSTRNLLTWKEVRKND--DLKKPLADRPPETLASRRP 454          
BLAST of Cytochrome P450 4B1 vs. TrEMBL
Match: A0A267GGF2 (TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030719g2 PE=4 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 1.090e-96
Identity = 164/452 (36.28%), Postives = 258/452 (57.08%), Query Frame = 3
Query:  261 LIPCPAGRPPTHLDPIKIFRGEDAETVWK----LRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQ-PWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIVTVRSRFP 1601
            ++P P G PP HL P+K  R    ET  +     R ++PYLT V+ ++YRN F++ LC  +L+ G+HR F+E+ HL+ +Q ++RE AGP+S+LW ++P+  Q +KL  L   L AAE+  R  D    Y +Y  LA +F+  P DKWL DH+   C      +  D   K AEA+Y  G+A+E+    EEA  +F   Y  ++ Q  W   +   L   ACE LA + +S S+   D     E A+++  L++A   A+E G   LE +C++ LG  +  +DKPD A+++  ++Y ++  ++D E   +AC ALA  +  Q K E  +KYLEEFA+  E   Q    S+ACR LG  +N  GEF++A+ YFS++F ++R   D   I   R+ +G+SQ  +    ++E +  A+ Q+ + L+ WK+  K +  ++ KP+AD+   T+ SR P
Sbjct:   12 VVPDPTGPPPKHLKPLKGARRGKEETKKQEQQTFREELPYLTPVQTAEYRNPFFETLCTSILTDGFHRTFTEMLHLIKQQRRDREVAGPESMLWQITPLEEQPEKLKNLSRYLMAAENSERKGDHLAAYEAYLYLAHYFEEEPNDKWLSDHYYDRCLRSGPLVQGDGGRKLAEAHYNKGMAMERGGRLEEAMTHFAVFYDRTRGQDAWVQRDGKGLHRVACEALARVHISRSDQLPD-----EAAREL--LQKAHSIAKESGNTFLEARCAHHLGNVFDRIDKPDTALHFYKEFYQLASKLDDPEQLGLACEALATAYEKQGKAETSVKYLEEFAKVTE-GKQDRLFSRACRGLGAAFNKQGEFQRAADYFSKAFSVARTLQDKEDIYLTRMQYGISQAFSFLSPYTEQLRAATPQSTRNLLTWKEVRKND--DLKKPLADRPPETLASRRP 453          
BLAST of Cytochrome P450 4B1 vs. TrEMBL
Match: A0A1I8H7Z5 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.426e-96
Identity = 164/452 (36.28%), Postives = 258/452 (57.08%), Query Frame = 3
Query:  261 LIPCPAGRPPTHLDPIKIFRGEDAETVWK----LRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQ-PWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIVTVRSRFP 1601
            ++P P G PP HL P+K  R    ET  +     R ++PYLT V+ ++YRN F++ LC  +L+ G+HR F+E+ HL+ +Q ++RE AGP+S+LW ++P+  Q +KL  L   L AAE+  R  D    Y +Y  LA +F+  P DKWL DH+   C      +  D   K AEA+Y  G+A+E+    EEA  +F   Y  ++ Q  W   +   L   ACE LA + +S S+   D     E A+++  L++A   A+E G   LE +C++ LG  +  +DKPD A+++  ++Y ++  ++D E   +AC ALA  +  Q K E  +KYLEEFA+  E   Q    S+ACR LG  +N  GEF++A+ YFS++F ++R   D   I   R+ +G+SQ  +    ++E +  A+ Q+ + L+ WK+  K +  ++ KP+AD+   T+ SR P
Sbjct:   18 VVPDPTGPPPKHLKPLKGARRGKEETKKQEQQTFREELPYLTPVQTAEYRNPFFETLCTSILTDGFHRTFTEMLHLIKQQRRDREVAGPESMLWQITPLEEQPEKLKNLSRYLMAAENSERKGDHLAAYEAYLYLAHYFEEEPNDKWLSDHYYDRCLRSGPLVQGDGGRKLAEAHYNKGMAMERGGRLEEAMTHFAVFYDRTRGQDAWVQRDGKGLHRVACEALARVHISRSDQLPD-----EAAREL--LQKAHSIAKESGNTFLEARCAHHLGNVFDRIDKPDTALHFYKEFYQLASKLDDPEQLGLACEALATAYEKQGKAETSVKYLEEFAKVTE-GKQDRLFSRACRGLGAAFNKQGEFQRAADYFSKAFSVARTLQDKEDIYLTRMQYGISQAFSFLSPYTEQLRAATPQSTRNLLTWKEVRKND--DLKKPLADRPPETLASRRP 459          
BLAST of Cytochrome P450 4B1 vs. TrEMBL
Match: A0A1I8HJL6 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.804e-96
Identity = 164/452 (36.28%), Postives = 258/452 (57.08%), Query Frame = 3
Query:  261 LIPCPAGRPPTHLDPIKIFRGEDAETVWK----LRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQ-PWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIVTVRSRFP 1601
            ++P P G PP HL P+K  R    ET  +     R ++PYLT V+ ++YRN F++ LC  +L+ G+HR F+E+ HL+ +Q ++RE AGP+S+LW ++P+  Q +KL  L   L AAE+  R  D    Y +Y  LA +F+  P DKWL DH+   C      +  D   K AEA+Y  G+A+E+    EEA  +F   Y  ++ Q  W   +   L   ACE LA + +S S+   D     E A+++  L++A   A+E G   LE +C++ LG  +  +DKPD A+++  ++Y ++  ++D E   +AC ALA  +  Q K E  +KYLEEFA+  E   Q    S+ACR LG  +N  GEF++A+ YFS++F ++R   D   I   R+ +G+SQ  +    ++E +  A+ Q+ + L+ WK+  K +  ++ KP+AD+   T+ SR P
Sbjct:   18 VVPDPTGPPPKHLKPLKGARRGKEETKKQEQQTFREELPYLTPVQTAEYRNPFFETLCTSILTDGFHRTFTEMLHLIKQQRRDREVAGPESMLWQITPLEEQPEKLKNLSRYLMAAENSERKGDHLAAYEAYLYLAHYFEEEPNDKWLSDHYYDRCLRSGPLVQGDGGRKLAEAHYNKGMAMERGGRLEEAMTHFAVFYDRTRGQDAWVQRDGKGLHRVACEALARVHISRSDQLPD-----EAAREL--LQKAHSIAKESGNTFLEARCAHHLGNVFDRIDKPDTALHFYKEFYQLASKLDDPEQLGLACEALATAYEKQGKAETSVKYLEEFAKVTE-GKQDRLFSRACRGLGAAFNKQGEFQRAADYFSKAFSVARTLQDKEDIYLTRMQYGISQAFSFLSPYTEQLRAATPQSTRNLLTWKEVRKND--DLKKPLADRPPETLASRRP 459          
BLAST of Cytochrome P450 4B1 vs. TrEMBL
Match: C3YS16 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_121105 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 3.275e-84
Identity = 162/448 (36.16%), Postives = 247/448 (55.13%), Query Frame = 3
Query:  192 SLIDVVQPSTGMSANVDFRHKDELIPCPAGRPP-THLDPIKIFRG-EDAETVWK---LRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWK 1520
            + +  + P+ G+        +  +   P GR P   L P+K  +G +D + + K   LR   P L K+E + YRNS+  NLCL ML +G+H++F+ELF L+ K++ EREEAGPDS+LW    +  Q +KL  +K  L+  E   R+ + + +YH  ++LA +F+S   D WL DHF + C   S  +  D   K AEAN  +GLA E+  EY+ A  +F   + L+  + WK+ +   L   +C+HL+ I  +++    D  K  +    I YL +A + A+EGG    EG  SY+LG AY+     + AI YL  Y  I KA  DD  F  AC A+AK + SQ K EE I+YLE F + AER+ Q  A   AC  LG +YN LG++  A  YF +++  +R  N+   +  AR+ +GVS  ++    ++ H+    +  ++R+I WK
Sbjct:    2 ATLPAISPNQGIYMGGASIPQRRMPSPPKGRAPKPTLKPVKRVQGTKDRDMLMKQQNLRVQQPELDKLETARYRNSYKHNLCLEMLREGFHKSFTELFQLMKKRKDEREEAGPDSLLWQEPLLEDQPEKLDQIKHYLTRGEAARRMGNMEEVYHCQYQLAKYFQSTG-DTWLSDHFFQACLQTSLSVRGDGRRKEAEANCNIGLAYEERGEYDRAAQHFVEFHELASGRNWKDASGKTLEASSCDHLSRIYTTIA----DQMKAQDPQGAIQYLAKAFEMAKEGGDSYKEGLASYRLGKAYESSADSETAILYLNGYLEICKANGDDMGFGQACEAIAKSYESQGKIEESIQYLEAFVDVAERTHQDTALVNACSCLGVIYNSLGKYGHACQYFGKAYETARELNNPGMMAAARVQYGVSNAHHRLEDYAGHLQTPMRYQMERMIEWK 444          
BLAST of Cytochrome P450 4B1 vs. Ensembl Cavefish
Match: ENSAMXT00000042628.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:8493061:8497726:-1 gene:ENSAMXG00000031053.1 transcript:ENSAMXT00000042628.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 2.503e-14
Identity = 59/208 (28.37%), Postives = 96/208 (46.15%), Query Frame = 3
Query:  369 LTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKIS 992
            L+KV+ + Y   F+ NLC+ ML +G+H +F + F L+ +    R             P+  Q  KL +L++ L+ AE   R   ++ +   Y  LA FF S   D+WL + F    +  S +I  D   + AEA  +LG    +  E ++A  ++     L   QPW++E          E L  I   +SE  L N +N   A+ ++
Sbjct:   10 LSKVK-TIYDTFFFTNLCVSMLQEGFHLSFEKFFSLLKRSRASR------------LPLEDQHHKLEMLREHLTRAEGAERAGQYEVVCDGYSALAGFF-SGSGDEWLQEFFFHLGFFSSCRIKSDGGRREAEARAHLGHLHLKRGELDQALEHYGKYQCLVAGQPWRDEGGRSYQSRGEEGLCRIYFLLSEKHLQNNENQRAAEILT 203          
BLAST of Cytochrome P450 4B1 vs. Ensembl Nematostella
Match: EDO47081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN65])

HSP 1 Score: 204.912 bits (520), Expect = 2.907e-60
Identity = 121/376 (32.18%), Postives = 202/376 (53.72%), Query Frame = 3
Query:  393 YRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWK 1520
            YRN++  NLCL ML  G+H++F ELF+L+ +Q +E+E  GPDS L +   +    DKL  LK  L+ AE   R      +Y S   LA +F+    D WL DHF   C   S +I  D   K +EAN  +GL++E+  +  +A  YF + Y L+K + W+ ++   L   +CE+L  +  ++S++  +     ++   I YL +A + A+E G    EG   Y+LG AY+ V  P+ A+ Y   Y    + + DD     AC ALA+ +  Q      +KYLE F E A+R+ Q     +AC +LG +YN  G++  +   F R++ I++  ++    ++ARI  G++ G+ +   ++  +   +K  + R++++K
Sbjct:    2 YRNTYEHNLCLDMLRDGFHQSFCELFNLMRQQREEQERLGPDSGLANQVLLEEDADKLDQLKYHLTTAEAAKRRGKMDHVYSSLLALAQYFEQ-SGDAWLSDHFYSSCLKTSLKIRGDGRRKESEANCNVGLSLEKKGDLHKAAEYFESFYNLTKGRIWQMDSGENLHSMSCENLRRVYTAISDLVTEE----DVRAGIGYLLKAYEMAKESGDTRQEGLAGYRLGAAYESVGDPETALLYHNGYLEKCQQLQDDVGMGRACQALARAYEIQGDVGSAMKYLEMFVELADRAKQLPEQQKACFSLGSMYNSQGKYLDSVRMFQRAYEIAQDLHNPVITEQARIQLGIASGHVVLSGYASCMNDVNKPNIIRILDFK 372          
BLAST of Cytochrome P450 4B1 vs. Ensembl Nematostella
Match: EDO28760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5K1])

HSP 1 Score: 51.2174 bits (121), Expect = 1.289e-6
Identity = 49/231 (21.21%), Postives = 99/231 (42.86%), Query Frame = 3
Query:  741 DDENLKHAEANYYLGLAIEQNKEYEEAFLYF-HALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFG 1430
            DD+     +A+  +G   +Q  +YEEA  ++  AL    K    + + K  L I                  D     E A  I + +EAL   ++      +GK    +G  + +  K + AI +  +   + +  +DD+    A   + K    Q KYEE I + +E     +++   +   +A   +G+ ++  G++++A G++  +  + + T+D +   +A +L G
Sbjct:  306 DDQG--QGKAHLLIGTTHDQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLLIGNTH--------------DQQGKYEEA--IGHYKEALRLYQKTSDDQGQGKAHLLIGNTHDQQGKYEEAIGHYKEALRLYQKTSDDQGQGKANLLIGKTHYQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLLIGNTHDQQGKYEEARGHYKEALRLYQKTSDDQGQGKAHLLIG 518          

HSP 2 Score: 50.447 bits (119), Expect = 2.247e-6
Identity = 57/281 (20.28%), Postives = 120/281 (42.70%), Query Frame = 3
Query:  603 YYRIDDFKGMYHSYFRLAVFFKSYPEDKW--LVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYF-HALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVS 1436
            Y +  D +G   ++  L +    Y + K+   + H+ K    + ++  DD+     EA+  +G    Q  +YEEA  ++  AL    K    + + K  L I                   + +  +  + I + +EAL   ++      +GK    +G  + +  K + AI +  +   + +  +DD+    A   + K    Q KYEE I + +E     +++   +   +A   +GD++   G++++A G++  +  + + T+D +   EA +L G +
Sbjct:  781 YQKTSDDQGQGKAH--LLIGNTHYQQGKYEEAIGHY-KEALRLYQKTSDDQG--QGEAHLLIGNTHYQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLLIGNT----------------HNQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLLIGNTHYQQGKYEEAIGHSKEALRLYQKTSDDQGQGEAHLLIGKTHYQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLLIGDIHYQQGKYEEAIGHYKEALRLYQKTSDDQGQGEAHLLIGKT 1040          

HSP 3 Score: 49.2914 bits (116), Expect = 4.303e-6
Identity = 52/247 (21.05%), Postives = 104/247 (42.11%), Query Frame = 3
Query:  693 VDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYF-HALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFG 1430
            + H+ K    + ++  DD+     +AN  +G    Q  +YEEA  ++  AL    K    + + K  L I                  D     E A+   + +EAL   ++      +GK    +G  + +  K + AI +  +   + +  +DD+    A   + K    Q KYEE   + +E     +++   +   +A   +G+ +N  G++++A G++  +  + + T+D +   EA +L G
Sbjct:  411 IGHY-KEALRLYQKTSDDQG--QGKANLLIGKTHYQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLLIGNTH--------------DQQGKYEEAR--GHYKEALRLYQKTSDDQGQGKAHLLIGNTHDQQGKYEEAIGHYKEALRLYQKTSDDQGQGEAHLLIGKTHYQQGKYEEARGHYKEALRLYQKTSDDQGQGKAHLLIGNTHNQQGKYEEARGHYKEALRLYQKTSDDQGQGEAHLLIG 638          
BLAST of Cytochrome P450 4B1 vs. Ensembl Nematostella
Match: EDO28725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5N6])

HSP 1 Score: 49.2914 bits (116), Expect = 5.243e-6
Identity = 49/229 (21.40%), Postives = 94/229 (41.05%), Query Frame = 3
Query:  756 KHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGI-SRGTNDSRTIDEARILFGVSQ 1439
            K A+    +GL  +    YEEA  Y+     + +    ++E             A +RL++  +      N E A K  Y ++AL      G ++ +    + +G+  Q +   + A+ Y  Q   + +   ++       H +  V +S   YEE +KY ++  +  ER+  +   +     +G V   LG +++A  YF ++  +  R  N+S        + GV Q
Sbjct:  226 KQADVRQNIGLVQDSLGNYEEAMKYYQQALQVFERTGNESEQ------------AGVRLNIGGV-QQRLGNYEEAMK--YYQQALQVFERTGNESEQAGVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESKQADVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESDQADVRLNIGGVQQRLGNYEEAMKYFQQALQVFERTGNESDQAGVRMNIGGVQQ 439          
BLAST of Cytochrome P450 4B1 vs. Ensembl Nematostella
Match: EDO30759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZW2])

HSP 1 Score: 48.1358 bits (113), Expect = 6.451e-6
Identity = 55/220 (25.00%), Postives = 94/220 (42.73%), Query Frame = 3
Query:  750 NLKHAEANYYLGLAIEQ---------NKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISR 1382
            N+ HA+  +Y G + +Q         N   E A  ++ A  T+ K+   +          AC +L N     +   L NF   ++A  I +  E L  ARE   K+ E +    LG A+  + + ++A  Y  +   IS+ + D      AC++L   F   ++Y+E + Y     E A+    +    +AC +LG+ +  LG    A  Y  +   IS+
Sbjct:  133 NVYHAKGKHY-GRSFDQDPGDFPDEVNSSLERAVEFYEANLTIVKHLGDRAAQG-----RACGNLGN-----THYLLGNF---DLA--IMFHEERLAIAREFNDKSAERRACSNLGNAHVFLGEFEIASEYYKRTLQISRELGDRAIEAQACYSLGNTFTLLREYKEAVAYHIRHLEIAQELGDRVGEGRACWSLGNAHTALGNHDVALEYAQKHLEISK 336          
BLAST of Cytochrome P450 4B1 vs. Ensembl Nematostella
Match: EDO42047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Q6])

HSP 1 Score: 48.9062 bits (115), Expect = 6.671e-6
Identity = 49/221 (22.17%), Postives = 92/221 (41.63%), Query Frame = 3
Query:  780 LGLAIEQNKEYEEAFLYFH-ALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQ 1439
            +G+  E    YEEA  Y+  AL    +     NE+K           A +R ++  +  ++  N E A K  Y ++AL      G +N +    + +G+    +   + A+ Y  Q   + +   ++ N  I    +  V  S   YEE +KY ++  +  ER+  +   +   + +G V   LG +++A  Y+ ++  +   T +       R   GV Q
Sbjct:  164 IGVVQESLGNYEEAMKYYQQALQVFERT---GNESK----------QAGVRQNIG-VVQESLGNYEEAMK--YYQQALQVFERTGNENNQAIVRHNIGVVQNSLGNYEEAMKYYQQALQVFERTGNESNQAIVRQNIGVVQVSLGNYEEAMKYYQQALQVFERTGNESKQAGVRQNIGVVQESLGNYEEAMKYYQQALQVFERTGNESNQAIVRQNIGVVQ 368          
BLAST of Cytochrome P450 4B1 vs. Planmine SMEST
Match: SMESG000051521.1 (SMESG000051521.1)

HSP 1 Score: 978.008 bits (2527), Expect = 0.000e+0
Identity = 469/473 (99.15%), Postives = 471/473 (99.58%), Query Frame = 3
Query:  225 MSANVDFRHKDELIPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIVTVRSRFPERNIFDHIGAYPKL 1643
            MSANVDFRHKDELIPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYR+DDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKK LEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIAC+ALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKI TVRSRFPERNIFDHIGAYPKL
Sbjct:    1 MSANVDFRHKDELIPCPAGRPPTHLDPIKIFRGEDAETVWKLRSDIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRMDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKKLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACNALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGKPIADKKIATVRSRFPERNIFDHIGAYPKL 473          
BLAST of Cytochrome P450 4B1 vs. Planmine SMEST
Match: SMESG000059971.1 (SMESG000059971.1)

HSP 1 Score: 204.912 bits (520), Expect = 4.943e-59
Identity = 122/426 (28.64%), Postives = 225/426 (52.82%), Query Frame = 3
Query:  330 AETVWKLRSDIP---YLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREEAGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLAVFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNKEYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLDNFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVAINYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAECAERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTIDEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEI-GKPIADKKIVTVRSR 1595
            A  +  L+ + P    LT  EIS YR   ++ +   ML KGYHR+FS LF++  ++E++R+  GPDS  W++  I     KL  +K+ L   ED  R+DD+  +  +   L   F  + ED W+V  F+      S ++  D     A AN   G+  E+N  Y  A  +   +++++  Q WK+ N + +     EHL+ + L ++        + +  Q ++YL++A + +RE   K +E  C  +LG+ +++++  D+AI Y    + ++  IND     +A  A+++ +  Q    E I+Y+E+F E  E++     ++++CR LG++YN   ++  A+  FS S+ I+         +E +IL GV++GNN+N   + H+   +++ V RL++++   ++ + EI  + I  K IV+  +R
Sbjct:   50 ARRIQNLKVNCPGGGPLTTWEISKYRQPKFEIILREMLLKGYHRSFSTLFNINLERERKRQVEGPDSTRWNLQSIR-DHPKLDQIKEYLCMIEDALRLDDYPTLLIATGFLITTFGEFEEDAWIVQQFVDTELECSSKVSLDHGYMKALANLTAGINAEKNYNYILAAEHLSRVFSMAYAQNWKDANGVPIMKVCSEHLSQVYLHLA----CEVSHTKPPQMLTYLKQAHEISREADLKTVEAMCCLELGIVFEKLNNLDMAIAYYRALFEVTHNINDQYRLGLASEAISRCYEKQNNRLEAIRYMEKFVEINEKACDWNEYARSCRVLGEMYNRFEDYANANLAFSNSYQITYCLRVPHEFNETKILKGVAEGNNINKYVTNHIVTNTREPVTRLMHFRIHDEKASPEIFAEQITQKNIVSFSNR 470          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 4B1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC297.150e-6430.46tetratricopeptide repeat domain 29 [Source:HGNC Sy... [more]
TTC293.182e-6332.99tetratricopeptide repeat domain 29 [Source:HGNC Sy... [more]
TTC294.137e-6332.99tetratricopeptide repeat domain 29 [Source:HGNC Sy... [more]
TTC299.570e-4434.89tetratricopeptide repeat domain 29 [Source:HGNC Sy... [more]
TTC296.161e-4035.18tetratricopeptide repeat domain 29 [Source:HGNC Sy... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc292.846e-3927.08tetratricopeptide repeat domain 29 [Source:ZFIN;Ac... [more]
ttc291.005e-3626.97tetratricopeptide repeat domain 29 [Source:ZFIN;Ac... [more]
ttc292.726e-3626.08tetratricopeptide repeat domain 29 [Source:ZFIN;Ac... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ebf22.218e-6632.69EBF transcription factor 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ttc297.827e-6231.90tetratricopeptide repeat domain 29 [Source:MGI Sym... [more]
Ttc297.827e-6231.90tetratricopeptide repeat domain 29 [Source:MGI Sym... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R6M4|TTC29_MACFA5.587e-6633.77Tetratricopeptide repeat protein 29 OS=Macaca fasc... [more]
sp|Q32NR4|TTC29_XENLA4.170e-6533.50Tetratricopeptide repeat protein 29 OS=Xenopus lae... [more]
sp|Q8NA56|TTC29_HUMAN1.987e-6232.99Tetratricopeptide repeat protein 29 OS=Homo sapien... [more]
sp|Q6AYP3|TTC29_RAT2.821e-6131.19Tetratricopeptide repeat protein 29 OS=Rattus norv... [more]
sp|Q80VM3|TTC29_MOUSE8.952e-6031.67Tetratricopeptide repeat protein 29 OS=Mus musculu... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GPY09.978e-9736.28TPR_REGION domain-containing protein (Fragment) OS... [more]
A0A267GGF21.090e-9636.28TPR_REGION domain-containing protein (Fragment) OS... [more]
A0A1I8H7Z51.426e-9636.28TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A1I8HJL61.804e-9636.28TPR_REGION domain-containing protein OS=Macrostomu... [more]
C3YS163.275e-8436.16Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000042628.12.503e-1428.37pep primary_assembly:Astyanax_mexicanus-2.0:15:849... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470812.907e-6032.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287601.289e-621.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287255.243e-621.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307596.451e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420476.671e-622.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 4B1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 4B1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000051521.10.000e+099.15SMESG000051521.1[more]
SMESG000059971.14.943e-5928.64SMESG000059971.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002049 ID=SMED30002049|Name=Cytochrome P450 4B1|organism=Schmidtea mediterranea sexual|type=transcript|length=1810bp
CATAGATATAATCTATCGATATATTTTTATATATTCTGTTATAATATGAG
CCAAAAATGAATCGGGACCATTATACGATGGATCATTTTGAAGTGCTATT
GGGCAGTAACAACAATGCCCAAATGCTCGGCACTCACCATCCACATTTTG
ATCACTATGGATCATGGAATTACTTACATGGCAAAATGCATTCATTAATT
GATGTTGTTCAGCCTTCTACTGGAATGAGTGCCAATGTCGATTTTCGACA
CAAAGATGAGCTGATTCCTTGCCCAGCTGGACGTCCTCCGACTCATTTGG
ATCCAATCAAAATATTCAGAGGCGAAGATGCCGAAACAGTTTGGAAATTA
AGATCAGATATTCCCTATCTAACCAAAGTGGAAATTAGCGATTATCGCAA
CTCTTTCTATCAGAATTTATGTCTTTGCATGCTTTCAAAAGGTTACCATC
GGGCATTTTCAGAACTTTTTCATTTAGTGGATAAACAAGAGAAAGAGCGC
GAAGAAGCAGGTCCAGATTCCATATTATGGAGCATGTCTCCAATATCGAT
GCAAGAAGACAAATTGACATTGCTCAAAGATTGCCTCAGTGCCGCGGAGG
ATTATTATAGAATAGATGATTTCAAAGGAATGTACCATAGCTATTTTCGA
TTAGCAGTCTTCTTTAAGAGCTACCCTGAAGACAAATGGCTTGTTGATCA
CTTCTTGAAGTATTGCTGGACCGTATCAAAGCAAATCCTCGACGACGAGA
ATCTAAAACACGCCGAAGCGAATTATTATCTTGGCCTGGCGATCGAACAA
AACAAGGAGTATGAAGAGGCTTTTCTATATTTCCACGCGCTTTATACACT
ATCCAAAAACCAACCTTGGAAAAATGAGAACAAGATTTTACTTTTCATTG
AGGCCTGTGAACATCTGGCCAACATCCGATTATCAATGTCGGAAATTTTT
TTAGATAATTTCAAAAATATAGAAATGGCTCAGAAAATAAGCTATCTAAG
AGAAGCACTTGATTATGCTAGAGAAGGAGGAAAGAAGAATTTAGAAGGTA
AATGTAGTTACAAGCTAGGATTAGCTTATCAAGAGGTTGATAAACCGGAT
GTAGCGATAAATTATCTAATGCAATATTATAATATTTCAAAAGCTATTAA
TGACGATGAAAATTTCTGCATCGCATGCCATGCTTTAGCAAAGGTCTTTC
GAAGTCAAAAAAAATATGAAGAATGCATCAAATATCTTGAAGAATTCGCA
GAATGTGCCGAAAGATCCCTACAAAAAGAAGCTCACAGTCAAGCATGTCG
TGCACTTGGCGACGTTTACAATCATTTGGGAGAATTCAAGAAAGCATCTG
GATATTTCTCACGAAGCTTTGGTATTTCAAGAGGCACCAATGACAGCAGA
ACTATAGACGAAGCCCGAATACTGTTCGGCGTGTCCCAAGGTAACAACCT
CAACTGTACATTCTCAGAACATGTTTATGTCGCTTCAAAGCAAGCGGTGC
AACGTTTAATCAATTGGAAAAAAGACTGTAAAGAAGAAACATCAGAAATT
GGTAAACCAATTGCCGATAAAAAAATCGTAACAGTCCGATCAAGATTCCC
AGAAAGAAACATATTTGATCACATTGGAGCCTATCCGAAGTTATAAGAAG
ATTGAACATTGTCTCTACATTATACATGTGTGATATGGTGATTTGTCCAT
TTATCAACTAGTTGATAAATGCCATTTTGATCTTGGCCTGTTGAAAATAT
AGTAAATTAATATGTGCCTGTTTGATAGTAGTAAAATTAAATTAAATACA
TAGTTTTGTG
back to top

protein sequence of SMED30002049-orf-1

>SMED30002049-orf-1 ID=SMED30002049-orf-1|Name=SMED30002049-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MNRDHYTMDHFEVLLGSNNNAQMLGTHHPHFDHYGSWNYLHGKMHSLIDV
VQPSTGMSANVDFRHKDELIPCPAGRPPTHLDPIKIFRGEDAETVWKLRS
DIPYLTKVEISDYRNSFYQNLCLCMLSKGYHRAFSELFHLVDKQEKEREE
AGPDSILWSMSPISMQEDKLTLLKDCLSAAEDYYRIDDFKGMYHSYFRLA
VFFKSYPEDKWLVDHFLKYCWTVSKQILDDENLKHAEANYYLGLAIEQNK
EYEEAFLYFHALYTLSKNQPWKNENKILLFIEACEHLANIRLSMSEIFLD
NFKNIEMAQKISYLREALDYAREGGKKNLEGKCSYKLGLAYQEVDKPDVA
INYLMQYYNISKAINDDENFCIACHALAKVFRSQKKYEECIKYLEEFAEC
AERSLQKEAHSQACRALGDVYNHLGEFKKASGYFSRSFGISRGTNDSRTI
DEARILFGVSQGNNLNCTFSEHVYVASKQAVQRLINWKKDCKEETSEIGK
PIADKKIVTVRSRFPERNIFDHIGAYPKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 236..269
e-value: 67.0
score: 7.7
coord: 411..444
e-value: 16.0
score: 13.2
coord: 371..404
e-value: 16.0
score: 13.2
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 411..444
score: 7.405
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 236..269
score: 8.113
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 174..467
e-value: 6.4E-27
score: 96.0
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 311..446
NoneNo IPR availablePANTHERPTHR46630FAMILY NOT NAMEDcoord: 94..493