Histone-lysine N-methyltransferase

Overview
NameHistone-lysine N-methyltransferase
Smed IDSMED30002047
Length (bp)7494
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase (SMED30002047) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30002047) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase (SMED30002047) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30002047) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002047

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002047SMESG000064113.1 SmedASXL_015485SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30002047SMESG000064115.1 trr-1smed_ncbi_20200123PMID:30194301
Mihaylova et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30002047SMESG000064115.1 trr-1smed_ncbi_20200123PMID:30194301
Mihaylova et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30002047SMESG000064115.1 trr-1smed_ncbi_20200123PMID:30194301
Mihaylova et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002047SMESG000064115.1 KC262345smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30002047SMESG000064115.1 KC262345smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30002047SMESG000064115.1 KC262345smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 424.861 bits (1091), Expect = 2.029e-121
Identity = 223/526 (42.40%), Postives = 319/526 (60.65%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPH-LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+      +    W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +P    S +  +        +  +G++  N  ++ K  + SK  QYRK+K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I S+R+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 1015 DYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRPHTLNSTSTSKSF-----QSTVTGEL--NAPYS-KQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 1524          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2D (lysine methyltransferase 2D [Source:HGNC Symbol;Acc:HGNC:7133])

HSP 1 Score: 427.557 bits (1098), Expect = 2.563e-119
Identity = 235/528 (44.51%), Postives = 321/528 (60.80%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L + CS C + GA   C   RC   YH  CA    C+FF D+ M C +H+ K  GP    L++  V RRVYI RDE  Q+A  I   ++    R+G LV  +IGQLLPHQ+   +FH+   +YP G+++ RI+WS R  N R  Y C I    +   P F +   ++ +E+  +  ++    W +I+  ++ +RK   +++ FPE++K E+L+GLT   VLR  ESLPG+ES  +Y F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+   N  ++ K  + SK  QYR+L+ E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARYINH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 5028 DMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIK--GPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSI--GENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEP--KILTHYKRPHTLNSTS-----MSKAYQSTFTGET--NTPYS-KQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 5537          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 419.853 bits (1078), Expect = 5.091e-117
Identity = 223/527 (42.31%), Postives = 321/527 (60.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPH-LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXX-XXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+      +    W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYRK+K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I S+R+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 4398 DYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 4911          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 419.853 bits (1078), Expect = 5.091e-117
Identity = 223/527 (42.31%), Postives = 321/527 (60.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPH-LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXX-XXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+      +    W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYRK+K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I S+R+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 4398 DYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 4911          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 402.519 bits (1033), Expect = 3.926e-112
Identity = 209/496 (42.14%), Postives = 306/496 (61.69%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPH-LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEEL 7253
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  ++D + P+F +   ++  E+      +    W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +P    S +  +        +  +G++  N  ++ K  + SK  QYRK+K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I S+R+I+KGEE+
Sbjct: 1959 DYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI-EEKDGR-PVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRPHTLNSTSTSKSF-----QSTVTGEL--NAPYS-KQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEEV 2439          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 186.422 bits (472), Expect = 1.260e-46
Identity = 102/324 (31.48%), Postives = 164/324 (50.62%), Query Frame = 3
Query: 5766 VDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTTLNVDRRVYISRDEYSQVAGTINNED-QNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHK--VVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEP 6728
            +DKR C  C   GD      GRL+      W+H+NCALW   VFE Q G L NV  +   + ++ C  C +PGA + C+   C + YHV CA +    F  DR   C+ H+       +  L+  RR+Y+ RDE + +       D     +R+G+     IG + P Q+    FH  ++++P  ++  R+ WS +    R ++EC I+ DR+ + P+F V + ++     CY   + S+ W+ I  K+  LR+  +   +KFF   I  E L+GL E  + +  ESLPG +++  Y  +  +   ++E+PL  N+ G  R EP
Sbjct: 1899 LDKRICVFCGGIGDGETTRCGRLISLTEFYWVHVNCALWSAEVFENQTGGLTNVDRAVLRAAQTACDHCKRPGASVKCHKMNCGVNYHVLCAMQNNGFFIKDRTFICKQHEKVSNQAIVGRLDALRRIYVKRDENTMLTRLFELTDGPTLCMRLGAFTFYKIGSITPKQLK--RFHTKDYIFPNNYRITRLFWSPKSHRERMMFEC-IIEDRNNQ-PIFVVKSLED--PTICYKAVSASKAWQPIYEKVHQLREQQQGDSLKFFGSQICGETLFGLNENAITKITESLPGFDTIFTYQHRH-QNSPVLELPLAENLMGCARAEP 2215          

HSP 2 Score: 158.688 bits (400), Expect = 4.144e-38
Identity = 85/166 (51.20%), Postives = 108/166 (65.06%), Query Frame = 3
Query: 6855 NNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDF---EKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            N +T  S+    Y+K++ E K  V L RS+I G GLYA  D+  G  IIEY GE+IR+EV  +RE +Y ++ +G+YMFR+D   VIDAT AG  ARYINH CDPNC T++LD     +E  I+I +NR I   EELTY       +G  DKIPCLCGA NC +WMN
Sbjct: 2315 NAQTAFSA----YQKMRREWKDRVYLARSRIAGLGLYAKVDISMGDFIIEYKGEIIRSEVCEVREIRYVAQNRGVYMFRIDEEWVIDATMAGGPARYINHSCDPNCSTQILDAGSGAREKKIIITANRPISANEELTY-DYQFELEGTTDKIPCLCGAPNCVKWMN 2475          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: xpf-1 ((Xeroderma Pigmentosum group F) DNA repair gene homolog [Source:UniProtKB/TrEMBL;Acc:G5EBZ1])

HSP 1 Score: 146.362 bits (368), Expect = 7.751e-35
Identity = 98/307 (31.92%), Postives = 161/307 (52.44%), Query Frame = 3
Query: 1443 ESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILP-EMCYDVQKSI-YGTSSRIGGS---DNIV--------------ANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGN---NEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEK 2297
            E+ +++  T E   E+Y       L  L+    PR I+L+   L  +R+IE Y++    ++    + +Y++ Y+ S EE +YL ++ +E  +FE LI+ + +L++  E   D + +     S+R GG    D  V                +IVDMREF SELP++L+ KG+ +   TI +GDYIL+P+I +ERK+++D   SL +GR++ Q   M+ +Y  ++LLIE        SN K    +  G     E+S+     +I S    L    PK+R +W+ SP  + E F +LKL  PEP  ++
Sbjct:  549 EAELVVSTTRE--RERYT------LLKLLETKKPRAIVLYTMSLQTLRQIEIYRS----TNPNRSLHVYWLQYTESTEESRYLESINRETMSFELLIREQGTLLISREFNVDREDAPRLKISTRDGGGARRDGAVDPRDQMDPEEELERPKIIVDMREFNSELPTVLYTKGYNVVATTIEIGDYILSPNIAIERKALDDLTQSLQSGRVFKQIEQMLEHYDCTVLLIE--------SNRKFETKIVNGGPFQGELSRHC--REIRSIFCSLIWANPKMRCVWTISPTNSAEFFSELKLSAPEPDVDR 833          

HSP 2 Score: 135.961 bits (341), Expect = 1.476e-31
Identity = 105/395 (26.58%), Postives = 183/395 (46.33%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQ-----HSTSCQISXXXXXXXXXXXXXXXXSFIDSDELT-VENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNS-AKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIK-----EKSSTEESRKTLVIVGKE 1247
            LL+YE   +      S L +   G+G+E++    L L+    +L LV+N +  +  Y+V KLK+ +V  +P  I ++   K  +SIY  GG+ F SS++L+VD L  RIP   ++ I V+R H+   A Q++F LRL++E  P+G VKAF+D    LS+    L R++  L+++ V L PRFS  + + LN  +       +++       H T  +   + +            +   ++E+  V  A T L  R            IS + ++L++++  +R +  +    D  +    L  ++++   L   S W+   + N +      +    N   D++K  T        P KW   ++IL+ IK     +K    +S   LVI   E
Sbjct:   24 LLEYERATLAKTLPASVLFVVANGLGLERLFLEHLILFSDRRLLALVLNTNEHDESYFVSKLKEHNVECDPKVINSEVSIKDRQSIYLEGGVQFCSSRVLLVDLLQNRIPTDRIAAIFVYRAHQTLNAFQDSFILRLYREKKPDGTVKAFTDFPNSLSS-LGQLQRLVDRLYIRHVELMPRFSSIIESELNRYQLKTAIFSVDVPTPLRRVHRTIIEFIKVCVRDLRTCSTSGKQTDEQNEEMIHVPWAATRLEKR-----LHDRRGHISEKQQRLLNDVASLREILQLSENMDVATVLSRLQVLKNDRTVLEEHSGWLLSPSFNRIMEDLLTIAGVTNGKADYKKFAT--------PAKWTVLSEILREIKMLPVEKKDRGNDSPSVLVITSSE 404          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: xpf-1 ((Xeroderma Pigmentosum group F) DNA repair gene homolog [Source:UniProtKB/TrEMBL;Acc:G5EBZ1])

HSP 1 Score: 146.362 bits (368), Expect = 7.751e-35
Identity = 98/307 (31.92%), Postives = 161/307 (52.44%), Query Frame = 3
Query: 1443 ESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILP-EMCYDVQKSI-YGTSSRIGGS---DNIV--------------ANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGN---NEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEK 2297
            E+ +++  T E   E+Y       L  L+    PR I+L+   L  +R+IE Y++    ++    + +Y++ Y+ S EE +YL ++ +E  +FE LI+ + +L++  E   D + +     S+R GG    D  V                +IVDMREF SELP++L+ KG+ +   TI +GDYIL+P+I +ERK+++D   SL +GR++ Q   M+ +Y  ++LLIE        SN K    +  G     E+S+     +I S    L    PK+R +W+ SP  + E F +LKL  PEP  ++
Sbjct:  549 EAELVVSTTRE--RERYT------LLKLLETKKPRAIVLYTMSLQTLRQIEIYRS----TNPNRSLHVYWLQYTESTEESRYLESINRETMSFELLIREQGTLLISREFNVDREDAPRLKISTRDGGGARRDGAVDPRDQMDPEEELERPKIIVDMREFNSELPTVLYTKGYNVVATTIEIGDYILSPNIAIERKALDDLTQSLQSGRVFKQIEQMLEHYDCTVLLIE--------SNRKFETKIVNGGPFQGELSRHC--REIRSIFCSLIWANPKMRCVWTISPTNSAEFFSELKLSAPEPDVDR 833          

HSP 2 Score: 135.961 bits (341), Expect = 1.476e-31
Identity = 105/395 (26.58%), Postives = 183/395 (46.33%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQ-----HSTSCQISXXXXXXXXXXXXXXXXSFIDSDELT-VENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNS-AKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIK-----EKSSTEESRKTLVIVGKE 1247
            LL+YE   +      S L +   G+G+E++    L L+    +L LV+N +  +  Y+V KLK+ +V  +P  I ++   K  +SIY  GG+ F SS++L+VD L  RIP   ++ I V+R H+   A Q++F LRL++E  P+G VKAF+D    LS+    L R++  L+++ V L PRFS  + + LN  +       +++       H T  +   + +            +   ++E+  V  A T L  R            IS + ++L++++  +R +  +    D  +    L  ++++   L   S W+   + N +      +    N   D++K  T        P KW   ++IL+ IK     +K    +S   LVI   E
Sbjct:   24 LLEYERATLAKTLPASVLFVVANGLGLERLFLEHLILFSDRRLLALVLNTNEHDESYFVSKLKEHNVECDPKVINSEVSIKDRQSIYLEGGVQFCSSRVLLVDLLQNRIPTDRIAAIFVYRAHQTLNAFQDSFILRLYREKKPDGTVKAFTDFPNSLSS-LGQLQRLVDRLYIRHVELMPRFSSIIESELNRYQLKTAIFSVDVPTPLRRVHRTIIEFIKVCVRDLRTCSTSGKQTDEQNEEMIHVPWAATRLEKR-----LHDRRGHISEKQQRLLNDVASLREILQLSENMDVATVLSRLQVLKNDRTVLEEHSGWLLSPSFNRIMEDLLTIAGVTNGKADYKKFAT--------PAKWTVLSEILREIKMLPVEKKDRGNDSPSVLVITSSE 404          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 131.339 bits (329), Expect = 2.034e-30
Identity = 72/150 (48.00%), Postives = 97/150 (64.67%), Query Frame = 3
Query: 6897 KLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGI-YMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            +LKF  K  +   RS+I G+GLYA + +    MI+EY+G+ IR+ VA  REK YE +  G  Y+FR+D   VIDAT+ G+ AR+INH C PNC+ ++L  E E  IVI S   I+KGEE+TY         +DDKI CLCGA+ CR ++N
Sbjct:  594 QLKFRKKM-IKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITY---DYKFPIEDDKIDCLCGAKTCRGYLN 739          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 131.724 bits (330), Expect = 4.488e-30
Identity = 72/150 (48.00%), Postives = 97/150 (64.67%), Query Frame = 3
Query: 6897 KLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGI-YMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            +LKF  K  +   RS+I G+GLYA + +    MI+EY+G+ IR+ VA  REK YE +  G  Y+FR+D   VIDAT+ G+ AR+INH C PNC+ ++L  E E  IVI S   I+KGEE+TY         +DDKI CLCGA+ CR ++N
Sbjct: 1365 QLKFRKKM-IKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITY---DYKFPIEDDKIDCLCGAKTCRGYLN 1510          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trr (gene:FBgn0023518 transcript:FBtr0070362)

HSP 1 Score: 465.692 bits (1197), Expect = 4.596e-132
Identity = 244/550 (44.36%), Postives = 339/550 (61.64%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLG---------------------PHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVT---ATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFN-NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  C++ GD   +GP RLL FDVDKW+H+NCALW N V+E   GAL N   + +A L   CS+C +PGA I C+  RC   YH+PCA  + C+F+ +++++C +H     G                       L++L V RRV++ RDE  QVA  ++  + +  LR+G++  L++GQLLPHQ+ +  FH  +++YP G+K  R +W  R  N R  Y C I     +  P F++    A D+  E E + GS+ S  W++IL  I+ LRK HK ++ FP+HI  EDL+GLTEP ++R +ESLPG+E+L DY FK+G+  L+ E PL IN SG+ RTEP  +      KP   ++         +    A S  I   +    +K  + SK  QY+K+K E + NV L RSKIQG GLYAA+D+EK TMIIEY+GE+IR EV+ IREKQYESK +GIYMFRLD   V+DAT +G LARYINH C+PNC TE+++ +++  I+I + RKI +GEEL+Y       + +  KIPC CGA NCR+WMN
Sbjct: 1873 DTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQAGLSQACSACHQPGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGITMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRDENRQVATVMHYSELSNLLRVGNMTFLNVGQLLPHQLEA--FHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCK--PEFRIQVQDAGDKEPERE-FRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLL-EFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSC-----STQRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSY-DYKFDIEDESHKIPCACGAPNCRKWMN 2410          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trr (gene:FBgn0023518 transcript:FBtr0070363)

HSP 1 Score: 465.692 bits (1197), Expect = 4.813e-132
Identity = 244/550 (44.36%), Postives = 339/550 (61.64%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLG---------------------PHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVT---ATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFN-NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  C++ GD   +GP RLL FDVDKW+H+NCALW N V+E   GAL N   + +A L   CS+C +PGA I C+  RC   YH+PCA  + C+F+ +++++C +H     G                       L++L V RRV++ RDE  QVA  ++  + +  LR+G++  L++GQLLPHQ+ +  FH  +++YP G+K  R +W  R  N R  Y C I     +  P F++    A D+  E E + GS+ S  W++IL  I+ LRK HK ++ FP+HI  EDL+GLTEP ++R +ESLPG+E+L DY FK+G+  L+ E PL IN SG+ RTEP  +      KP   ++         +    A S  I   +    +K  + SK  QY+K+K E + NV L RSKIQG GLYAA+D+EK TMIIEY+GE+IR EV+ IREKQYESK +GIYMFRLD   V+DAT +G LARYINH C+PNC TE+++ +++  I+I + RKI +GEEL+Y       + +  KIPC CGA NCR+WMN
Sbjct: 1894 DTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQAGLSQACSACHQPGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGITMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRDENRQVATVMHYSELSNLLRVGNMTFLNVGQLLPHQLEA--FHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCK--PEFRIQVQDAGDKEPERE-FRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLL-EFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSC-----STQRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSY-DYKFDIEDESHKIPCACGAPNCRKWMN 2431          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: mei-9 (gene:FBgn0002707 transcript:FBtr0343574)

HSP 1 Score: 257.684 bits (657), Expect = 3.977e-70
Identity = 142/383 (37.08%), Postives = 227/383 (59.27%), Query Frame = 3
Query: 1506 NFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEM-------------CYDVQKSIYGTSSRIGGSDNIVAN-----VIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTI--NDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPT--ADGSLYSEENKLNEDVVDTILKIPGITWKN-HGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQS----KKELFLSVNLENNNKNF 2573
            +  L  ++ +  P  +++++  ++ +R++E ++A        D + +YF++++ ++EEQ YLT+LR+EK AFE++I +K+ +++P+               YD + +     SR  G     A      VIVDMREFRS+LP L+HK+G ++ PLTI +GDYIL P ICVERKS++D IGSL++GRLY+QC  M R+Y   ILLIEF        +    F L  G   +S+Q ++   DI+ KL LLT+HFPKLR++WS SPYAT +LF++LKLG+PEP  +      +D     E+   N  + D +L++PG+  +N HG+ L +  S   LL  ++ ++ E+++++  A  +Y  LH +    K E+  S  L   +K F
Sbjct:  570 SMALEHMLEQLQPHYVVMYNMNVTAIRQLEVFEARRRLPPA-DRMKVYFLIHARTVEEQAYLTSLRREKAAFEFIIDTKSKMVIPKYQDGKTDEAFLLLKTYDDEPTDENAKSRQAGGQAPQATKETPKVIVDMREFRSDLPCLIHKRGLEVLPLTITIGDYILTPDICVERKSISDLIGSLNSGRLYNQCVQMQRHYAKPILLIEF--------DQNKPFHL-QGKFMLSQQTSMANADIVQKLQLLTLHFPKLRLIWSPSPYATAQLFEELKLGKPEPDPQTAAALGSDEPTAGEQLHFNSGIYDFLLRLPGVHTRNIHGL-LRKGGSLRQLLLRSQKELEELLQSQESAKLLYDILHVAHLPEKDEVTGSTALLAASKQF 941          

HSP 2 Score: 234.958 bits (598), Expect = 1.137e-62
Identity = 153/417 (36.69%), Postives = 232/417 (55.64%), Query Frame = 3
Query:   96 NKMLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEP--VHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKR-----IKEKSSTEESRKTLVIVGKEVTALLLAK-LSITGAKNVLNESLR 1316
            N +LLDYE +M +D+     LL+  KG+  ++++ S LK Y     LVLVIN+S  E +YY  K+       EP  VH  A   T+  E +Y  GGL F+S++IL+VD L  RIP  L+SGI+V R H + E+CQEAFALRLF++ N  GFVKAFS +    + GYS ++R M NL VK +Y+WPRF  SV T L   K    E+ + I+Q+ TS Q  +L+I+  L+ E+K +N  +D + +TVEN +T  F + L+   + IW Q++ Q++ ++ ++K +R L    +  D VS +  +   RS   ALS  S W  L AA  +F  ++ R+F              E   E  PKW   TD+L +     ++    +E+  K L++     T   L + L+  G + +L ++L+
Sbjct:   43 NMVLLDYEKQMFLDLVEADGLLVCAKGLSYDRVVISILKAYSDSGNLVLVINSSDWEEQYYKSKI-------EPKYVHEVASTATE-RERVYLEGGLQFISTRILVVDLLKQRIPIELISGIIVLRAHTIIESCQEAFALRLFRQKNKTGFVKAFSSSPEAFTIGYSHVERTMRNLFVKHLYIWPRFHESVRTVLQPWKIQSIEMHVPISQNITSIQSHILEIMNFLVQEIKRINRTVDMEAVTVENCVTKSFHKILQAQLDCIWHQLNSQTKLIVADLKILRSLMISTMYHDAVSAYAFMKRYRSTEYALSN-SGWTLLDAAEQIFKLSRQRVFNGQQ----------EFEPEPCPKWQTLTDLLTKEIPGDMRRSRRSEQQPKVLILCQDARTCHQLKQYLTQGGPRFLLQQALQ 440          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: mei-9 (gene:FBgn0002707 transcript:FBtr0070656)

HSP 1 Score: 257.684 bits (657), Expect = 3.977e-70
Identity = 142/383 (37.08%), Postives = 227/383 (59.27%), Query Frame = 3
Query: 1506 NFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEM-------------CYDVQKSIYGTSSRIGGSDNIVAN-----VIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTI--NDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPT--ADGSLYSEENKLNEDVVDTILKIPGITWKN-HGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQS----KKELFLSVNLENNNKNF 2573
            +  L  ++ +  P  +++++  ++ +R++E ++A        D + +YF++++ ++EEQ YLT+LR+EK AFE++I +K+ +++P+               YD + +     SR  G     A      VIVDMREFRS+LP L+HK+G ++ PLTI +GDYIL P ICVERKS++D IGSL++GRLY+QC  M R+Y   ILLIEF        +    F L  G   +S+Q ++   DI+ KL LLT+HFPKLR++WS SPYAT +LF++LKLG+PEP  +      +D     E+   N  + D +L++PG+  +N HG+ L +  S   LL  ++ ++ E+++++  A  +Y  LH +    K E+  S  L   +K F
Sbjct:  570 SMALEHMLEQLQPHYVVMYNMNVTAIRQLEVFEARRRLPPA-DRMKVYFLIHARTVEEQAYLTSLRREKAAFEFIIDTKSKMVIPKYQDGKTDEAFLLLKTYDDEPTDENAKSRQAGGQAPQATKETPKVIVDMREFRSDLPCLIHKRGLEVLPLTITIGDYILTPDICVERKSISDLIGSLNSGRLYNQCVQMQRHYAKPILLIEF--------DQNKPFHL-QGKFMLSQQTSMANADIVQKLQLLTLHFPKLRLIWSPSPYATAQLFEELKLGKPEPDPQTAAALGSDEPTAGEQLHFNSGIYDFLLRLPGVHTRNIHGL-LRKGGSLRQLLLRSQKELEELLQSQESAKLLYDILHVAHLPEKDEVTGSTALLAASKQF 941          

HSP 2 Score: 234.958 bits (598), Expect = 1.137e-62
Identity = 153/417 (36.69%), Postives = 232/417 (55.64%), Query Frame = 3
Query:   96 NKMLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEP--VHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKR-----IKEKSSTEESRKTLVIVGKEVTALLLAK-LSITGAKNVLNESLR 1316
            N +LLDYE +M +D+     LL+  KG+  ++++ S LK Y     LVLVIN+S  E +YY  K+       EP  VH  A   T+  E +Y  GGL F+S++IL+VD L  RIP  L+SGI+V R H + E+CQEAFALRLF++ N  GFVKAFS +    + GYS ++R M NL VK +Y+WPRF  SV T L   K    E+ + I+Q+ TS Q  +L+I+  L+ E+K +N  +D + +TVEN +T  F + L+   + IW Q++ Q++ ++ ++K +R L    +  D VS +  +   RS   ALS  S W  L AA  +F  ++ R+F              E   E  PKW   TD+L +     ++    +E+  K L++     T   L + L+  G + +L ++L+
Sbjct:   43 NMVLLDYEKQMFLDLVEADGLLVCAKGLSYDRVVISILKAYSDSGNLVLVINSSDWEEQYYKSKI-------EPKYVHEVASTATE-RERVYLEGGLQFISTRILVVDLLKQRIPIELISGIIVLRAHTIIESCQEAFALRLFRQKNKTGFVKAFSSSPEAFTIGYSHVERTMRNLFVKHLYIWPRFHESVRTVLQPWKIQSIEMHVPISQNITSIQSHILEIMNFLVQEIKRINRTVDMEAVTVENCVTKSFHKILQAQLDCIWHQLNSQTKLIVADLKILRSLMISTMYHDAVSAYAFMKRYRSTEYALSN-SGWTLLDAAEQIFKLSRQRVFNGQQ----------EFEPEPCPKWQTLTDLLTKEIPGDMRRSRRSEQQPKVLILCQDARTCHQLKQYLTQGGPRFLLQQALQ 440          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082947)

HSP 1 Score: 149.058 bits (375), Expect = 4.218e-35
Identity = 72/152 (47.37%), Postives = 105/152 (69.08%), Query Frame = 3
Query: 6888 QYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            +YR LK   K  V + RS I G GLY  KD+E G M+IEY GELIR+ + + RE+ Y+S+  G YMF++D + V+DAT  G+ AR+INHCC+PNC+++++D     HI+I + R+I +GEELTY         +D+KIPC CG++ CR+++N
Sbjct: 3578 KYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTY---DYKFPFEDEKIPCSCGSKRCRKYLN 3726          

HSP 2 Score: 98.9821 bits (245), Expect = 6.681e-20
Identity = 64/204 (31.37%), Postives = 87/204 (42.65%), Query Frame = 3
Query: 5766 VDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQ------TKDLGPHLT---TLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSR 6350
            +D R C  C ++G+       RLL    D W+H NCA+W   VFE   G+L NV  +        C+ CG  GA + C    C   YH PCA+   C F  D++MYC  H         +  P +T      V R VY+  D   +       E       IGSL V  +G ++P    S        V P  F   R++WSS+
Sbjct: 1732 LDTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKL----IEPARVQFHIGSLEVRQLGAIVPRFSDS-----YEAVVPINFLCSRLYWSSK 1926          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2d (lysine (K)-specific methyltransferase 2D [Source:ZFIN;Acc:ZDB-GENE-060223-2])

HSP 1 Score: 438.728 bits (1127), Expect = 3.621e-123
Identity = 242/528 (45.83%), Postives = 326/528 (61.74%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            DKR C  CH  GD   +GP RLL  DVD W+H+NCALW   V+E Q GAL NV  +    L++ C+ C K GA   C   RC   YH  CA    C+FF D+ M C  H+ K  GP    L++  V RRVYI RDE  Q+A  +   D+    R+G L+  ++GQLLP Q+    FH+ + +YP G+++ RI+WS+RV N R  Y C I  ++D + PLF+V   +   E+  +  ST    W KI+ +++ LR    ++K F EH++ E++YGLT   V+R  ESLPG+ES  DY F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+I  N  ++ K  + SK  QYR+LK E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARY+NH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 2816 DKRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCAYCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHKLK--GPSEEELSSFAVFRRVYIERDEVKQIASILQRGDRIHLFRVGGLIFHAVGQLLPSQM--AVFHSPSAIYPVGYEATRIYWSTRVPNRRCRYRCRI-SEQDGR-PLFEVRVLEHGYEDLHFRDSTPDGIWAKIVHQVAKLRDEAAMLKLFTEHVRGEEMYGLTVHAVMRITESLPGVESCQDYTFRYGRHPLM-ELPLMINPTGCARSEP--KILTHCKRPHTLNSTS-----MSKAYQSTFTGEI--NTPYS-KQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 3325          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 417.927 bits (1073), Expect = 1.016e-116
Identity = 225/537 (41.90%), Postives = 311/537 (57.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKD--------LGPH--LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFN--NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L   C+ C + GA   C+  RCT  YH  CA +  C FF D+ M C LH+ +         LG    L    V RRVY+ RDE  Q+A  I   ++    R+GSLV+ ++GQLLP Q+ +  FH++  ++P G+++ RI+WS R  N R  Y C I  + +   P F +   ++  ++    GS+    W K+L  ++  R     ++ FP ++K EDL+GLT   V R +ESLPG+E+   Y F++G+  L+ ++PL IN SG  R+EP  K   HI +P          H L + +    S   P  I     +K  + SK  QYR++  E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IR+EVAN +EK YE++ +G+YMFR+D   VIDAT  G  ARYINH C PNC TE++  E+   I+I SNR+I++GEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 3170 DMRRCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLSVRCAYCQQTGATSGCHRLRCTNAYHFTCALKAQCTFFKDKTMLCHLHRPRGTSLIGGGLLGTEHELRCFAVFRRVYVQRDESRQIASIIQRGEREHTFRVGSLVLHAVGQLLPQQMLA--FHSMTAIFPVGYEASRIYWSMRHGNRRCHYVCSI--NENDGSPEFVIRVVEQGYDDLILTGSSPKGVWDKVLEPVAERRNETGFLRLFPVYLKGEDLFGLTVSAVTRIVESLPGVEACERYTFRYGRNPLM-QLPLAINPSGCARSEP--KACTHIKRP----------HTLTSTSKALQSPGNPAEIGVPPYSKHFVHSKSAQYRRMNAEWKSNVYLARSRIQGLGLYAARDIEKYTMVIEYIGTIIRSEVANRKEKMYEAQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCITEVVALERGHKIIISSNRRIQRGEELCY-DYKFDLEDDQHKIPCHCGAVNCRKWMN 3688          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 417.927 bits (1073), Expect = 1.080e-116
Identity = 225/537 (41.90%), Postives = 311/537 (57.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKD--------LGPH--LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFN--NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L   C+ C + GA   C+  RCT  YH  CA +  C FF D+ M C LH+ +         LG    L    V RRVY+ RDE  Q+A  I   ++    R+GSLV+ ++GQLLP Q+ +  FH++  ++P G+++ RI+WS R  N R  Y C I  + +   P F +   ++  ++    GS+    W K+L  ++  R     ++ FP ++K EDL+GLT   V R +ESLPG+E+   Y F++G+  L+ ++PL IN SG  R+EP  K   HI +P          H L + +    S   P  I     +K  + SK  QYR++  E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IR+EVAN +EK YE++ +G+YMFR+D   VIDAT  G  ARYINH C PNC TE++  E+   I+I SNR+I++GEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 3204 DMRRCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLSVRCAYCQQTGATSGCHRLRCTNAYHFTCALKAQCTFFKDKTMLCHLHRPRGTSLIGGGLLGTEHELRCFAVFRRVYVQRDESRQIASIIQRGEREHTFRVGSLVLHAVGQLLPQQMLA--FHSMTAIFPVGYEASRIYWSMRHGNRRCHYVCSI--NENDGSPEFVIRVVEQGYDDLILTGSSPKGVWDKVLEPVAERRNETGFLRLFPVYLKGEDLFGLTVSAVTRIVESLPGVEACERYTFRYGRNPLM-QLPLAINPSGCARSEP--KACTHIKRP----------HTLTSTSKALQSPGNPAEIGVPPYSKHFVHSKSAQYRRMNAEWKSNVYLARSRIQGLGLYAARDIEKYTMVIEYIGTIIRSEVANRKEKMYEAQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCITEVVALERGHKIIISSNRRIQRGEELCY-DYKFDLEDDQHKIPCHCGAVNCRKWMN 3722          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 411.764 bits (1057), Expect = 1.158e-114
Identity = 224/537 (41.71%), Postives = 311/537 (57.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKD--------LGPH--LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFN--NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L   C+ C + GA   C+  RCT  YH  CA +  C FF D+ M C LH+ +         LG    L    V RRVY+ RDE  Q+A  I   ++    R+GSLV+ ++GQLLP Q+ +  FH++  ++P G+++ RI+WS R  N R  Y C I  + +   P F +   ++  ++    GS+    W K+L  ++  R     ++ FP ++K EDL+GLT   V R +ESLPG+E+   Y F++G+  L+ ++PL IN SG  R+EP  K   HI +  +        H L + +    S   P  I     +K  + SK  QYR++  E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IR+EVAN +EK YE++ +G+YMFR+D   VIDAT  G  ARYINH C PNC TE++  E+   I+I SNR+I++GEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 4424 DMRRCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLSVRCAYCQQTGATSGCHRLRCTNAYHFTCALKAQCTFFKDKTMLCHLHRPRGTSLIGGGLLGTEHELRCFAVFRRVYVQRDESRQIASIIQRGEREHTFRVGSLVLHAVGQLLPQQMLA--FHSMTAIFPVGYEASRIYWSMRHGNRRCHYVCSI--NENDGSPEFVIRVVEQGYDDLILTGSSPKGVWDKVLEPVAERRNETGFLRLFPVYLKGEDLFGLTVSAVTRIVESLPGVEACERYTFRYGRNPLM-QLPLAINPSGCARSEP--KACTHIKRFVLRP------HTLTSTSKALQSPGNPAEIGVPPYSKHFVHSKSAQYRRMNAEWKSNVYLARSRIQGLGLYAARDIEKYTMVIEYIGTIIRSEVANRKEKMYEAQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCITEVVALERGHKIIISSNRRIQRGEELCY-DYKFDLEDDQHKIPCHCGAVNCRKWMN 4946          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2cb (lysine (K)-specific methyltransferase 2Cb [Source:ZFIN;Acc:ZDB-GENE-070705-340])

HSP 1 Score: 364.385 bits (934), Expect = 3.148e-100
Identity = 207/575 (36.00%), Postives = 317/575 (55.13%), Query Frame = 3
Query: 5646 KYSVFHSNPIPEPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP--------HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQS-PNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            K+++  + P   P S+    E + K+L+   +  L      D+R C  C + GD   +GP RLL  D+D W+H+NCALW + V+E Q GAL NV  + +     +C+ C + GA   C+  RC   YH  CA + GC FF D+ M C  H+ +  G          L   +V RRVY+ RDE  Q+A  +   ++    R+GSL+  ++GQL P  + +  FH+   ++P G+++ R++WS R    R  Y C +  +  +    F +   ++  E+     ++    W+K+L  ++  R    +++ FP ++K EDL+GLT   V R  ESLPG+E+ + Y F++G+  L+V +PL +N SGS R+E  ++ Y    +  I  S P   R +  +  A + S         ++K  + SK  QYR+L  + K NV L  S+IQG GL+AA+ +EK TM+IEY+G+++R EVA  RE  Y++K +  YMF +D   VIDAT +G  ARYINH C PNC  E++ FE+   I+I +  +IE+GEEL Y            KIPC CGA  CR+W+N
Sbjct: 4324 KWTIDIAMPKVAPQSSESELEERLKQLTTSLRPCLT---IRDQRRCCFCQQIGDGMTDGPARLLNLDLDTWVHLNCALWSSEVYETQAGALINVGLARQRGQTVVCAFCQRLGATSGCHRLRCLNIYHFTCALQAGCTFFKDKTMLCHQHRPRGAGAAAGLHVEHQLRCFSVFRRVYVQRDELRQLAAAVQQPERGHTFRVGSLLFHAMGQLPPALMPT--FHSSTAIFPPGYEATRLYWSMRHGQKRCRYVCSV--EEHEGRAEFSIRVIEQGYEDLVLTDTSAKGVWEKVLGPVAERRAETGMLRLFPIYLKGEDLFGLTISAVTRIAESLPGVEACSRYRFRYGRNPLLV-LPLSMNSSGSARSE--LQTYPQHERVKILSSWPRISRCIQNSTVAASASS--------HSKHFVHSKSSQYRRLASDWKSNVYLAHSRIQGLGLFAARAIEKQTMVIEYMGDILRTEVAMRRELLYKAKNRPAYMFCIDSERVIDATNSGSPARYINHSCSPNCVAEVVTFERGYKIIISAACRIERGEELCY-DYKLTPVNDQSKIPCHCGAAKCRKWIN 4879          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ERCC4 (excision repair cross-complementation group 4 [Source:NCBI gene;Acc:100145552])

HSP 1 Score: 500.745 bits (1288), Expect = 1.370e-152
Identity = 311/897 (34.67%), Postives = 496/897 (55.30%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLF---------KNANVDW-RKITTASELNIEIPPKWNAFTDILKRIKEKSSTEES----RKTLVIVGKEVTALLLAKLSITGAKNVL----NESLRKH-------LNXXXXXXXXXXXXXXXXXLPEETEEFQGIVKENNC---------FIVEESNIIIHYTSEGCS-EKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISI-------YFMMYSNSIEEQKYLTTLRKEKE----------------------------AFEYLIKSKASLILPE-------MCYDVQKSIYGT-----SSRIGG--SDNIVANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLP--TADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKE 2531
            LL++EN++ +D+++   L+I+ +G+GI++I+ +FLKLYC    LVLV+N +  E +Y +D+L+ + V+H P  IT +  T     +Y +GG++F++S+IL+VD+L  RIP  L++GI+V++ HK+ E+CQEAF LRL+++ N  GF+KAF+DN +    G+  ++RVM NL VK++YLWPRF +SV + L+  KP + E+ + +T    + Q S+LDI+   L ELK  N  ++ ++L++ENAI   FD+T+R Y +P+W Q+  +++ L+ ++K +R L   L + D V+F  +L+S++++  A    S W+ L ++  +F  A+ R++         K+   D   K     EL +E  PKW A +++LK I++++   E+     + L+    + T   L +    GA+ +L    N++  K        +  + A   K       ++LP++ +E +   K+NN             EE + +     E  S E     P ++   L    D    IL +P L+ +  ++       CSD   +  +       Y ++Y + +   + L   R  K+                            AFE LI+ KAS+++PE          D+Q+ +  T     + + GG   +N+   +IVDMREFRSELPSL+H++G  IEP+T+ VGDYIL P ICVERKSV+D IGSL+NGRLY+QC SM RYY   +LLIEF        +    FSL +  N I +++++NDI SK+ LLT+HFP+LRILW  SPYAT ELF++LK  RP+P        TAD     E  K N    D +LK+PG+  KN    +  + S  +L   + + + EI+ N N A Q+Y F+  S  E
Sbjct:   17 LLEHENQVFLDLFHEDGLVITARGLGIDRILQNFLKLYCDPGNLVLVLNTNTAEEEYLIDQLRSEGVTHLPRIITNEVATGERYDVYTQGGVLFVTSRILVVDFLTDRIPANLITGILVYKAHKIIESCQEAFILRLYRQKNKQGFIKAFTDNPVAFHTGFCQVERVMRNLFVKKLYLWPRFHVSVNSFLDKHKPEVVELHVSMTPAMLAIQSSILDIMNACLKELKRYNPALEVEDLSLENAIGKAFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQYDCVTFLNLLESMKASEKAFGQNSGWLFLDSSTSMFVHARARVYHVPDSKAIKKSKQSDSNEKQDGKKELVLENNPKWEALSEVLKEIEQENKNSEALGGPGRVLICASDDRTCAQLREYIAVGAEALLERLYNKTFGKDEKASEVWMKRRKAITAKGSNKSMKTSLPKKPKEGKSKQKKNNTKTELTLTQMIGKEEEDEVGKDDVESVSQESSFEEPKYEDLQLNLPSDSYYGILKEP-LTVIHPLQG------CSDSYGLTRVLHEIEPRYVVLYDSELSFVRQLEIYRASKQKPLRVYFLIYGGSTEEQRYLTSLRKEKEAFEQLIREKASMVIPEERDGRDDTNLDLQRDVTSTFDSADTRKAGGQVQNNVQQTIIVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPDICVERKSVSDLIGSLNNGRLYTQCVSMCRYYKRPVLLIEF--------DPNKPFSL-VSKNSIHQEISVNDITSKIALLTLHFPRLRILWCPSPYATAELFEELKQNRPQPDSATAMAITADSESLPESEKYNPGPQDFLLKMPGVNAKNCRAIMKHVTSIAELTTLSLEKLTEILGNSNNAKQLYEFMRTSYTE 897          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ERCC4 (excision repair cross-complementation group 4 [Source:NCBI gene;Acc:100145552])

HSP 1 Score: 499.59 bits (1285), Expect = 2.645e-152
Identity = 311/897 (34.67%), Postives = 496/897 (55.30%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLF---------KNANVDW-RKITTASELNIEIPPKWNAFTDILKRIKEKSSTEES----RKTLVIVGKEVTALLLAKLSITGAKNVL----NESLRKH-------LNXXXXXXXXXXXXXXXXXLPEETEEFQGIVKENNC---------FIVEESNIIIHYTSEGCS-EKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISI-------YFMMYSNSIEEQKYLTTLRKEKE----------------------------AFEYLIKSKASLILPE-------MCYDVQKSIYGT-----SSRIGG--SDNIVANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLP--TADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKE 2531
            LL++EN++ +D+++   L+I+ +G+GI++I+ +FLKLYC    LVLV+N +  E +Y +D+L+ + V+H P  IT +  T     +Y +GG++F++S+IL+VD+L  RIP  L++GI+V++ HK+ E+CQEAF LRL+++ N  GF+KAF+DN +    G+  ++RVM NL VK++YLWPRF +SV + L+  KP + E+ + +T    + Q S+LDI+   L ELK  N  ++ ++L++ENAI   FD+T+R Y +P+W Q+  +++ L+ ++K +R L   L + D V+F  +L+S++++  A    S W+ L ++  +F  A+ R++         K+   D   K     EL +E  PKW A +++LK I++++   E+     + L+    + T   L +    GA+ +L    N++  K        +  + A   K       ++LP++ +E +   K+NN             EE + +     E  S E     P ++   L    D    IL +P L+ +  ++       CSD   +  +       Y ++Y + +   + L   R  K+                            AFE LI+ KAS+++PE          D+Q+ +  T     + + GG   +N+   +IVDMREFRSELPSL+H++G  IEP+T+ VGDYIL P ICVERKSV+D IGSL+NGRLY+QC SM RYY   +LLIEF        +    FSL +  N I +++++NDI SK+ LLT+HFP+LRILW  SPYAT ELF++LK  RP+P        TAD     E  K N    D +LK+PG+  KN    +  + S  +L   + + + EI+ N N A Q+Y F+  S  E
Sbjct:   16 LLEHENQVFLDLFHEDGLVITARGLGIDRILQNFLKLYCDPGNLVLVLNTNTAEEEYLIDQLRSEGVTHLPRIITNEVATGERYDVYTQGGVLFVTSRILVVDFLTDRIPANLITGILVYKAHKIIESCQEAFILRLYRQKNKQGFIKAFTDNPVAFHTGFCQVERVMRNLFVKKLYLWPRFHVSVNSFLDKHKPEVVELHVSMTPAMLAIQSSILDIMNACLKELKRYNPALEVEDLSLENAIGKAFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQYDCVTFLNLLESMKASEKAFGQNSGWLFLDSSTSMFVHARARVYHVPDSKAIKKSKQSDSNEKQDGKKELVLENNPKWEALSEVLKEIEQENKNSEALGGPGRVLICASDDRTCAQLREYIAVGAEALLERLYNKTFGKDEKASEVWMKRRKAITAKGSNKSMKTSLPKKPKEGKSKQKKNNTKTELTLTQMIGKEEEDEVGKDDVESVSQESSFEEPKYEDLQLNLPSDSYYGILKEP-LTVIHPLQG------CSDSYGLTRVLHEIEPRYVVLYDSELSFVRQLEIYRASKQKPLRVYFLIYGGSTEEQRYLTSLRKEKEAFEQLIREKASMVIPEERDGRDDTNLDLQRDVTSTFDSADTRKAGGQVQNNVQQTIIVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPDICVERKSVSDLIGSLNNGRLYTQCVSMCRYYKRPVLLIEF--------DPNKPFSL-VSKNSIHQEISVNDITSKIALLTLHFPRLRILWCPSPYATAELFEELKQNRPQPDSATAMAITADSESLPESEKYNPGPQDFLLKMPGVNAKNCRAIMKHVTSIAELTTLSLEKLTEILGNSNNAKQLYEFMRTSYTE 896          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ERCC4 (excision repair cross-complementation group 4 [Source:NCBI gene;Acc:100145552])

HSP 1 Score: 499.975 bits (1286), Expect = 4.304e-152
Identity = 311/897 (34.67%), Postives = 496/897 (55.30%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLF---------KNANVDW-RKITTASELNIEIPPKWNAFTDILKRIKEKSSTEES----RKTLVIVGKEVTALLLAKLSITGAKNVL----NESLRKH-------LNXXXXXXXXXXXXXXXXXLPEETEEFQGIVKENNC---------FIVEESNIIIHYTSEGCS-EKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISI-------YFMMYSNSIEEQKYLTTLRKEKE----------------------------AFEYLIKSKASLILPE-------MCYDVQKSIYGT-----SSRIGG--SDNIVANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLP--TADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKE 2531
            LL++EN++ +D+++   L+I+ +G+GI++I+ +FLKLYC    LVLV+N +  E +Y +D+L+ + V+H P  IT +  T     +Y +GG++F++S+IL+VD+L  RIP  L++GI+V++ HK+ E+CQEAF LRL+++ N  GF+KAF+DN +    G+  ++RVM NL VK++YLWPRF +SV + L+  KP + E+ + +T    + Q S+LDI+   L ELK  N  ++ ++L++ENAI   FD+T+R Y +P+W Q+  +++ L+ ++K +R L   L + D V+F  +L+S++++  A    S W+ L ++  +F  A+ R++         K+   D   K     EL +E  PKW A +++LK I++++   E+     + L+    + T   L +    GA+ +L    N++  K        +  + A   K       ++LP++ +E +   K+NN             EE + +     E  S E     P ++   L    D    IL +P L+ +  ++       CSD   +  +       Y ++Y + +   + L   R  K+                            AFE LI+ KAS+++PE          D+Q+ +  T     + + GG   +N+   +IVDMREFRSELPSL+H++G  IEP+T+ VGDYIL P ICVERKSV+D IGSL+NGRLY+QC SM RYY   +LLIEF        +    FSL +  N I +++++NDI SK+ LLT+HFP+LRILW  SPYAT ELF++LK  RP+P        TAD     E  K N    D +LK+PG+  KN    +  + S  +L   + + + EI+ N N A Q+Y F+  S  E
Sbjct:   39 LLEHENQVFLDLFHEDGLVITARGLGIDRILQNFLKLYCDPGNLVLVLNTNTAEEEYLIDQLRSEGVTHLPRIITNEVATGERYDVYTQGGVLFVTSRILVVDFLTDRIPANLITGILVYKAHKIIESCQEAFILRLYRQKNKQGFIKAFTDNPVAFHTGFCQVERVMRNLFVKKLYLWPRFHVSVNSFLDKHKPEVVELHVSMTPAMLAIQSSILDIMNACLKELKRYNPALEVEDLSLENAIGKAFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQYDCVTFLNLLESMKASEKAFGQNSGWLFLDSSTSMFVHARARVYHVPDSKAIKKSKQSDSNEKQDGKKELVLENNPKWEALSEVLKEIEQENKNSEALGGPGRVLICASDDRTCAQLREYIAVGAEALLERLYNKTFGKDEKASEVWMKRRKAITAKGSNKSMKTSLPKKPKEGKSKQKKNNTKTELTLTQMIGKEEEDEVGKDDVESVSQESSFEEPKYEDLQLNLPSDSYYGILKEP-LTVIHPLQG------CSDSYGLTRVLHEIEPRYVVLYDSELSFVRQLEIYRASKQKPLRVYFLIYGGSTEEQRYLTSLRKEKEAFEQLIREKASMVIPEERDGRDDTNLDLQRDVTSTFDSADTRKAGGQVQNNVQQTIIVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPDICVERKSVSDLIGSLNNGRLYTQCVSMCRYYKRPVLLIEF--------DPNKPFSL-VSKNSIHQEISVNDITSKIALLTLHFPRLRILWCPSPYATAELFEELKQNRPQPDSATAMAITADSESLPESEKYNPGPQDFLLKMPGVNAKNCRAIMKHVTSIAELTTLSLEKLTEILGNSNNAKQLYEFMRTSYTE 919          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ERCC4 (excision repair cross-complementation group 4 [Source:NCBI gene;Acc:100145552])

HSP 1 Score: 496.508 bits (1277), Expect = 6.201e-151
Identity = 308/891 (34.57%), Postives = 494/891 (55.44%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTAS----------ELNIEIPPKWNAFTDILKRIKEKSSTEES----RKTLVIVGKEVTALLLAKLSITGAKNVL----NESLRKH-------LNXXXXXXXXXXXXXXXXXLPEETEEFQGIVKENNC---------FIVEESNIIIHYTSEGCS-EKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISI-------YFMMYSNSIEEQKYLTTLRKEKE----------------------------AFEYLIKSKASLILPE-------MCYDVQKSIYGT-----SSRIGG--SDNIVANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLP--TADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFL 2513
            LL++EN++ +D+++   L+I+ +G+GI++I+ +FLKLYC    LVLV+N +  E +Y +D+L+ + V+H P  IT +  T     +Y +GG++F++S+IL+VD+L  RIP  L++GI+V++ HK+ E+CQEAF LRL+++ N  GF+KAF+DN +    G+  ++RVM NL VK++YLWPRF +SV + L+  KP + E+ + +T    + Q S+LDI+   L ELK  N  ++ ++L++ENAI   FD+T+R Y +P+W Q+  +++ L+ ++K +R L   L + D V+F  +L+S++++  A    S W+ L ++  +F  A+ R++   +    K +  S          EL +E  PKW A +++LK I++++   E+     + L+    + T   L +    GA+ +L    N++  K        +  + A   K       ++LP++ +E +   K+NN             EE + +     E  S E     P ++   L    D    IL +P L+ +  ++       CSD   +  +       Y ++Y + +   + L   R  K+                            AFE LI+ KAS+++PE          D+Q+ +  T     + + GG   +N+   +IVDMREFRSELPSL+H++G  IEP+T+ VGDYIL P ICVERKSV+D IGSL+NGRLY+QC SM RYY   +LLIEF        +    FSL +  N I +++++NDI SK+ LLT+HFP+LRILW  SPYAT ELF++LK  RP+P        TAD     E  K N    D +LK+PG+  KN    +  + S  +L   + + + EI+ N N A Q+Y F+
Sbjct:   37 LLEHENQVFLDLFHEDGLVITARGLGIDRILQNFLKLYCDPGNLVLVLNTNTAEEEYLIDQLRSEGVTHLPRIITNEVATGERYDVYTQGGVLFVTSRILVVDFLTDRIPANLITGILVYKAHKIIESCQEAFILRLYRQKNKQGFIKAFTDNPVAFHTGFCQVERVMRNLFVKKLYLWPRFHVSVNSFLDKHKPEVVELHVSMTPAMLAIQSSILDIMNACLKELKRYNPALEVEDLSLENAIGKAFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQYDCVTFLNLLESMKASEKAFGQNSGWLFLDSSTSMFVHARARVYHVPDSKAIKKSKQSDSNEKQDGKKELVLENNPKWEALSEVLKEIEQENKNSEALGGPGRVLICASDDRTCAQLREYIAVGAEALLERLYNKTFGKDEKASEVWMKRRKAITAKGSNKSMKTSLPKKPKEGKSKQKKNNTKTELTLTQMIGKEEEDEVGKDDVESVSQESSFEEPKYEDLQLNLPSDSYYGILKEP-LTVIHPLQG------CSDSYGLTRVLHEIEPRYVVLYDSELSFVRQLEIYRASKQKPLRVYFLIYGGSTEEQRYLTSLRKEKEAFEQLIREKASMVIPEERDGRDDTNLDLQRDVTSTFDSADTRKAGGQVQNNVQQTIIVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPDICVERKSVSDLIGSLNNGRLYTQCVSMCRYYKRPVLLIEF--------DPNKPFSL-VSKNSIHQEISVNDITSKIALLTLHFPRLRILWCPSPYATAELFEELKQNRPQPDSATAMAITADSESLPESEKYNPGPQDFLLKMPGVNAKNCRAIMKHVTSIAELTTLSLEKLTEILGNSNNAKQLYEFI 911          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: rab9b (RAB9B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-491211])

HSP 1 Score: 441.039 bits (1133), Expect = 1.495e-123
Identity = 236/527 (44.78%), Postives = 321/527 (60.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPH-LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXX-XXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +G  RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K L    LT   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+   NFH+   ++P GF++ R++WS R  N R  Y C I  + +  +PLF V   +   E      S+    W KIL  ++N RK  ++++ FP  +K EDLYGLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL IN SGS R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYRK+K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FEK   I+I SNR+I+KGEEL+Y       +    KIPC CGA NCR+WMN
Sbjct: 4014 DYRKCCFCHEEGDGLTDGSARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCGFCHKTGATSSCHRLRCTNIYHFTCAIKAQCMFFKDKTMLCTMHKPKGLHEQELTYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHAIGQLLPQQMQ--NFHSATALFPVGFEASRLYWSMRYANRRCRYLCSI--EENDGLPLFVVRVIEPGHEELVLMDSSLKGVWDKILEPVANCRKGSEILRLFPVFLKGEDLYGLTASAVTRIAESLPGVEACENYTFRYGRNPLM-ELPLAINPSGSARSEP--KMNSHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNEHVIDATLTGGPARYINHSCAPNCVAEVVTFEKGHRIIISSNRRIQKGEELSY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 4527          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 429.869 bits (1104), Expect = 4.236e-122
Identity = 224/526 (42.59%), Postives = 321/526 (61.03%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDL-GPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+     S+  + W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +P    S +  +        +  +G++  N  ++ K  + SK  QYR++K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I SNR+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 1239 DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRPHTLNSTSTSKSF-----QSTVTGEL--NAPYS-KQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 1748          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 426.017 bits (1094), Expect = 6.320e-122
Identity = 224/527 (42.50%), Postives = 323/527 (61.29%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDL-GPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHL-LXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+     S+  + W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYR++K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I SNR+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 1011 DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 1524          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2d (lysine (K)-specific methyltransferase 2D [Source:MGI Symbol;Acc:MGI:2682319])

HSP 1 Score: 428.328 bits (1100), Expect = 9.930e-120
Identity = 235/528 (44.51%), Postives = 321/528 (60.80%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L + CS C + GA   C   RC   YH  CA    C+FF D+ M C +H+ K  GP    L++  V RRVYI RDE  Q+A  I   ++    R+G LV  +IGQLLPHQ+   +FH+   +YP G+++ RI+WS R  N R  Y C I    +   P F +   ++ +E+  +  ++    W +I+  ++ +RK   +++ FPE++K E+L+GLT   VLR  ESLPG+ES  +Y F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+   N  ++ K  + SK  QYR+L+ E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARYINH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 5079 DNRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPVHKIK--GPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSI--SENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEP--KILTHYKRPHTLNSTS-----MSKAYQSTFTGET--NTPYS-KQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 5588          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2d (lysine (K)-specific methyltransferase 2D [Source:MGI Symbol;Acc:MGI:2682319])

HSP 1 Score: 428.328 bits (1100), Expect = 1.137e-119
Identity = 235/528 (44.51%), Postives = 321/528 (60.80%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L + CS C + GA   C   RC   YH  CA    C+FF D+ M C +H+ K  GP    L++  V RRVYI RDE  Q+A  I   ++    R+G LV  +IGQLLPHQ+   +FH+   +YP G+++ RI+WS R  N R  Y C I    +   P F +   ++ +E+  +  ++    W +I+  ++ +RK   +++ FPE++K E+L+GLT   VLR  ESLPG+ES  +Y F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+   N  ++ K  + SK  QYR+L+ E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARYINH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 5079 DNRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPVHKIK--GPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSI--SENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEP--KILTHYKRPHTLNSTS-----MSKAYQSTFTGET--NTPYS-KQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 5588          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 425.246 bits (1092), Expect = 8.564e-119
Identity = 224/527 (42.50%), Postives = 323/527 (61.29%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDL-GPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXX-XXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+     S+  + W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYR++K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I SNR+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 4391 DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 4904          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q8IRW8|TRR_DROME (Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2)

HSP 1 Score: 465.692 bits (1197), Expect = 4.824e-131
Identity = 244/550 (44.36%), Postives = 339/550 (61.64%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLG---------------------PHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVT---ATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFN-NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  C++ GD   +GP RLL FDVDKW+H+NCALW N V+E   GAL N   + +A L   CS+C +PGA I C+  RC   YH+PCA  + C+F+ +++++C +H     G                       L++L V RRV++ RDE  QVA  ++  + +  LR+G++  L++GQLLPHQ+ +  FH  +++YP G+K  R +W  R  N R  Y C I     +  P F++    A D+  E E + GS+ S  W++IL  I+ LRK HK ++ FP+HI  EDL+GLTEP ++R +ESLPG+E+L DY FK+G+  L+ E PL IN SG+ RTEP  +      KP   ++         +    A S  I   +    +K  + SK  QY+K+K E + NV L RSKIQG GLYAA+D+EK TMIIEY+GE+IR EV+ IREKQYESK +GIYMFRLD   V+DAT +G LARYINH C+PNC TE+++ +++  I+I + RKI +GEEL+Y       + +  KIPC CGA NCR+WMN
Sbjct: 1894 DTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQAGLSQACSACHQPGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGITMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRDENRQVATVMHYSELSNLLRVGNMTFLNVGQLLPHQLEA--FHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCK--PEFRIQVQDAGDKEPERE-FRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLL-EFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSC-----STQRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSY-DYKFDIEDESHKIPCACGAPNCRKWMN 2431          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q6PDK2|KMT2D_MOUSE (Histone-lysine N-methyltransferase 2D OS=Mus musculus OX=10090 GN=Kmt2d PE=1 SV=2)

HSP 1 Score: 428.328 bits (1100), Expect = 6.946e-119
Identity = 235/528 (44.51%), Postives = 321/528 (60.80%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L + CS C + GA   C   RC   YH  CA    C+FF D+ M C +H+ K  GP    L++  V RRVYI RDE  Q+A  I   ++    R+G LV  +IGQLLPHQ+   +FH+   +YP G+++ RI+WS R  N R  Y C I    +   P F +   ++ +E+  +  ++    W +I+  ++ +RK   +++ FPE++K E+L+GLT   VLR  ESLPG+ES  +Y F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+   N  ++ K  + SK  QYR+L+ E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARYINH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 5079 DNRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPVHKIK--GPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSI--SENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEP--KILTHYKRPHTLNSTS-----MSKAYQSTFTGET--NTPYS-KQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 5588          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|O14686|KMT2D_HUMAN (Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2)

HSP 1 Score: 427.557 bits (1098), Expect = 1.231e-118
Identity = 235/528 (44.51%), Postives = 321/528 (60.80%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L + CS C + GA   C   RC   YH  CA    C+FF D+ M C +H+ K  GP    L++  V RRVYI RDE  Q+A  I   ++    R+G LV  +IGQLLPHQ+   +FH+   +YP G+++ RI+WS R  N R  Y C I    +   P F +   ++ +E+  +  ++    W +I+  ++ +RK   +++ FPE++K E+L+GLT   VLR  ESLPG+ES  +Y F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+   N  ++ K  + SK  QYR+L+ E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARYINH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 5028 DMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIK--GPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSI--GENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEP--KILTHYKRPHTLNSTS-----MSKAYQSTFTGET--NTPYS-KQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 5537          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q8BRH4|KMT2C_MOUSE (Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2)

HSP 1 Score: 425.246 bits (1092), Expect = 5.990e-118
Identity = 224/527 (42.50%), Postives = 323/527 (61.29%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDL-GPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXX-XXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+     S+  + W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYR++K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I SNR+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 4390 DCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 4903          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q8NEZ4|KMT2C_HUMAN (Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3)

HSP 1 Score: 419.853 bits (1078), Expect = 2.445e-116
Identity = 223/527 (42.31%), Postives = 321/527 (60.91%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPH-LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXX-XXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            D R C  CH  GD   +GP RLL  D+D W+H+NCALW   V+E Q GAL NV  +    L+  C  C K GA   C+  RCT  YH  CA +  C+FF D+ M C +H+ K +    L+   V RRVY+ RDE  Q+A  +   +++   R+GSL+  +IGQLLP Q+ +  FH+   ++P G+++ R++WS+R  N R  Y C I  +     P+F +   ++  E+      +    W KIL  ++ +RK  ++++ FP ++K EDL+GLT   V R  ESLPG+E+  +Y F++G+  L+ E+PL +N +G  R+EP  K+  H+ +  +   P+ L     + +  +  +G++  N  ++ K  + SK  QYRK+K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FE+   I+I S+R+I+KGEEL Y       +    KIPC CGA NCR+WMN
Sbjct: 4398 DYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI--EEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEP--KMSAHVKRFVLR--PHTLNSTSTSKSFQSTVTGEL--NAPYS-KQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCY-DYKFDFEDDQHKIPCHCGAVNCRKWMN 4911          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A5J4N5Y3 (Histone-lysine N-methyltransferase MLL3 OS=Paragonimus westermani OX=34504 GN=DEA37_0013034 PE=4 SV=1)

HSP 1 Score: 585.489 bits (1508), Expect = 1.138e-170
Identity = 418/1209 (34.57%), Postives = 608/1209 (50.29%), Query Frame = 3
Query: 4071 NNKRRNSSVAKSTSKKQKLSNE-------------------PIYHDKLNNPLQRCQQNMVKVLGQPNFRKLVHEPRIKNNLTVLAPLG----CKQRSTQCSDIVQLQDNCVKYKRMPFAMPQINPINLGVNRCSENSFILQNINVSIPECGLL---SAHESDDIDCLIAPSP------------------SNNELDYLSVFN-CDPISSPTVNLSAGPNLEML---------HPPNRNQSPQLSVFHCPNKDYLKFDHADXXXXXXXXXXXXXXRKPDSQSLLRPTGISRVQISHKYSSVSTAAE-PIPENTLIDSETGEIVSKPVNDQTRSSNNKPREKLLMTFTINP--PDDVEKTVRNITDVLGIDYNSVEFKETTRGGEIAIDKDSMVSNSIPREICERY--------------------------------NTSVYKMEXXXXXXXXXXXKPFDNLIS------IDKSTELPLYSEKVYKSTALL-NKPCLK--CSNCDKLIPDQ-------KLMYSNNNMLCDRIKYRDLCFCDEACQQEYXXXXXXXXXXXXXXXXXXXXIKDQCIYVGDDICD----ASVIVQGXXXXXXXXXXRLGALINDKLLKKKAAIGPSVKSSPQKIHKGSKYSVFHSNPIP---EPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP-HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLY--RHIHKPAIHQSPNFLRHLLXXXXXXXX---SGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
             +K+R++S    TSK++K S                     P+ H   ++   R  Q  ++ L   + + LV  P +K    VL P G     +   ++  + + L    +KY R   ++P       G +    +SFI++++  + P CG L   S   S      + PSP                  S  E + LS FN     +S  V  S  P L  +          P     +P L +FH PN   +               +     KP S ++L   G S  + S    SV    E    ++ L+DSETGE++    N +   + ++  +KL + FTI+P     + + +R IT++LG++ +SV ++ T  G  I +D+    S S+ R++  R                                 ++ + + E   +I++S++ +P + +I+      I    E   Y E+     +LL NK  +   C  CDK++P         + + +   +        +  FC E C +E+                       +       +CD      V++Q    +  +  KRL   +   +   K     +V S   K  +G ++  F  + +P     TS + +SES+   L  +S S LR    +D R+C+LC   GD PEN  GRLL  +V++WLHINCALWC  V+E   G+LNNV    + S+++ C+ CG+ GAG+ CY PRCT  YHV CA   GC+FF DR MYC  HQ ++  P  L +L V+RRVYI+RDE +QV   I+ +D+   +RIG++ +  +GQLLPHQI SG+FH   ++YP GF+S RI+WS RV   R+ Y CEI+    +  PLF+VTA D  MENE      C+  W+ IL+KI  LR+   +++ F +H+K EDLYGL+EPH++RA+ESLPG++ L DY F FG+M+LI EMPL IN SG  R EP ++ Y  R  H      +P   R  L     +A    SG   +     +K   SS+ QQYR+LK E   NV+L RS+IQG GL+AA+DLE  TM+IEY+GELIR E+AN REK YE+  +GIYMFRL+  TVIDAT  G LARYINH C PNCFTE ++F   SHIVII+NR I+KGEEL Y       +    KIPCLC A NCR+WMN
Sbjct:  574 GSKKRSNSTTTGTSKRRKTSASTSALSSMTVAGSVGLNKTIPVDHSASSH---RIAQECLEKLKINDIKSLVSAPVLKPYSVVLPPAGGSDFIESGQSEEDEQLMLARKALKYVRGAMSLPMSKCFISGNSSEQMDSFIVRHLQSTAP-CGPLIRGSNRHSIPTTPAVCPSPEPLSFENHMMALFSSIHKSPKEENKLSNFNNVKQHASAAVGSSFAPKLLPIFSEATSTSEKPDPERSTPPLPLFHMPNPKLV-------CEPVRLLDNDRVQSKPISTNILD-LGSSPTKTSGSEYSVCKCDEFEGNKSPLVDSETGEVLG---NRRPSPAVHQTSDKLRIAFTISPSMAGGIPRIIRRITELLGVEQDSVCYQVTRSGALITVDQKQAQSESLVRDLESRLREHFTSLSLRFEAVSLQNPPLLQPVDTLAIQLDSVLRQPEQPIDISHSVSKQPAEGVIAVKAESQISNGVEFTRYLEEPVSIVSLLANKHTVTRPCQYCDKMVPPDTGYRRCLEDLATLTGLTTKSENTEEYIFCSEDCMREFVRRCSSLDPLTYPGHETNGFSSTESRLSSTLVCDLPSAVPVVLQNCPLRGMKNLKRLQFGLQHAVAGHKRRWS-AVGSLKHKRWRGCRWRPFSPDFLPSNTRVTSNNGLSESEVLSLLSESSSRLRDPASMDSRSCALCDVKGDAPENSVGRLLPLNVNQWLHINCALWCYEVYETIGGSLNNVDSWIKKSMETNCTHCGRVGAGLPCYNPRCTFIYHVSCAVSIGCMFFTDRGMYCPQHQPREAHPMQLPSLVVNRRVYIARDENTQVGSVIHEDDRTSVVRIGTVCLHRVGQLLPHQIESGHFHTRRYIYPVGFRSTRIYWSMRVPRCRARYICEIMEANGR--PLFRVTAIDRGMENESVEHEACAGAWQPILSKIEVLREQSALIRLFSQHLKGEDLYGLSEPHIVRAVESLPGVDCLRDYVFNFGRMELIPEMPLAINPSGCARAEPKMQTYVKRSAHNSHSSSAPTGFRTALPGLRRSAQPNLSGVTANEC---SKQYQSSRSQQYRRLKSEVSCNVILGRSRIQGLGLFAARDLEPQTMVIEYIGELIRQELANKREKYYEAHNRGIYMFRLNDDTVIDATVCGGLARYINHSCQPNCFTEYVNFGDHSHIVIITNRHIDKGEELGY-DYNFDLEDGGSKIPCLCRAPNCRKWMN 1760          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A3R7GXD1 (Histone-lysine N-methyltransferase 2C OS=Clonorchis sinensis OX=79923 GN=KMT2C PE=4 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 4.281e-168
Identity = 372/997 (37.31%), Postives = 528/997 (52.96%), Query Frame = 3
Query: 4608 PPNRNQSPQLSVFHCPNKDYLKFDHADXXXXXXXXXXXXXXRKPDSQSLLRPTGISRVQISHKYSSVSTAAEPI--PENT------LIDSETGEIVS----KPVNDQTRSSNNKPREKLLMTFTINPP--DDVEKTVRNITDVLGIDYNSVEFKETTRGGEIAIDKDSMVSNSIPR----EICERY---------------NTSVYK-----MEXXXXXXXXXXXKP-------FDNLISID----KSTELPLYSEKVYKSTALL---NKPCLKCSNCDKLIPDQKLMYSNNNMLCDRIKY-----------RDLCFCDEACQQEYXXXXXXXXXXXX------XXXXXXXXIKDQ--CIYVGDDICDASVIVQGXXXXXXXXXXR--LGALINDKLLKKK--AAIGPSVKSSPQKIHKGSKYSVFHSNPIPE--PTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP-HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLY-------RHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            P     +P L +FH PN   L +DHA   S        ++T + ++         SR   +  Y+S S     +  P NT      LIDSETGEIV+    +P  +   S      +KL +TFTINP     + K V+ I ++LG++ +SV ++ T  G +I +D+    S  + R    ++ E +               +++++      +E     N+  T +P         NL+ +D     ++E   YSE+     +LL   N     C NCD L+      YS +    D I              D  FC + C   ++        +         + T    + D      V D      V++Q S+ K  + S+R   G  I     K++  +A+  + K    +  + S++ +F    +P   P  +  +  S     S      LR     D R C+LC   GD  ENG GRLL  ++DKWLH+NCALWC  V+E   G+LN+V    + ++++ C+ CG  GAG+ CY PRCT  YHV CA   GC+FF DR MYC  HQ ++  P  L +L V+RRVYI+RDE ++V G I+ ED+   +RIGS+ + ++GQLLPHQI SG FH   ++YP GF + RI+WS R  + R+ Y CEI  D     P F++TA D+ +E+      +C+  W+ IL++I  +R+ + +V+ FP+HIK E+LYGL+EPH++RA+ESLPG++ L DY F FG+M+LI EMPL IN SG  RTEP ++ Y        H   P       F R +       + S   P +    +K   SS+ QQYR+LK E   NV+L RS+IQG GL+AA++LE  TM+IEY+GELIR E+AN REK YE+  +GIYMFRL+  TVIDAT  G LARYINH C PNCF E L+F   SHIVII+NR IEKGEEL Y       +    KIPCLC + NCR+WMN
Sbjct:  788 PDPERSTPPLPLFHMPNP-RLVYDHARSGSTDRDGVEFNTTAQSET---------SRSNSTFIYNSPSREPNDVKPPVNTAPGTGPLIDSETGEIVAGHRFRPPAESMHS------DKLHITFTINPSMTGGIPKIVQRIAELLGVEQDSVSYQVTRSGAQITLDQKQSQSEGLMRNLESQLREHFTPLSLHVETASVRPTDSNIHSDLQTVVEREELSNHPGTARPELKQNVDTSNLLKLDGPCITNSEWARYSEEPVSVVSLLANKNGVSKPCQNCDTLVSP----YSGHRKTLDDIAALTGLTTRTDTNGDFIFCSKDCMLAFAHSISVRRLSLESPIACPTSATTTGSVSDSRPQTLVCDLFSTVPVVLQSSLPKLGKSSRRHLTGVHIVASGHKRRQVSAVHGTAK---HRRWRDSRWRIFSPEFVPTTTPAPSDKLITSGPITFSRDDGPCLRPPPSADPRRCTLCGTKGDASENGLGRLLPMNIDKWLHVNCALWCYEVYETVGGSLNDVDIWIKKAMETNCTHCGHLGAGLPCYNPRCTFSYHVSCAIAIGCMFFTDRGMYCPQHQPRETHPMQLPSLLVNRRVYITRDENAEVGGVIHEEDRTKIVRIGSVCLHNVGQLLPHQIESGYFHTRRYIYPVGFHTTRIYWSMRRPHRRARYVCEI--DEADGRPSFRITALDDGLEDVTVVSDSCTGAWQVILSRIEGMRRENHMVQLFPKHIKGEELYGLSEPHIVRAVESLPGMDGLRDYVFNFGRMELIAEMPLAINPSGCARTEPKMQTYVKRSFLSSHKLTPTTSSPVGFRRSV-----HPSLSISTPSDY---SKQYQSSRSQQYRRLKGEASSNVILGRSRIQGLGLFAARNLEPQTMVIEYIGELIRLELANKREKDYEAHNRGIYMFRLNDDTVIDATVCGGLARYINHSCQPNCFAEFLNFGDHSHIVIITNRLIEKGEELCY-DYNFDLEDGGSKIPCLCRSTNCRKWMN 1750          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A094ZLC1 (Histone-lysine N-methyltransferase 2C OS=Schistosoma haematobium OX=6185 GN=MS3_03747 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 5.421e-166
Identity = 288/599 (48.08%), Postives = 382/599 (63.77%), Query Frame = 3
Query: 5586 KKAAIGPSVKSSPQKIHKGSKYSVFHSN---PIPEPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP-HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHL----LXXXXXXXXSGKIPDNILFN-----NKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            KK  I  S   S  +  +G ++  + S+   P    +  +I+ +S    LS  + +V+      DKR C LC + GD PE+G GRLL  D+D W+HINCALWC  V+E   G+LNN+      + ++ C+ CG  GAG+ CY P+C+  YHVPCA    C+FF DR MYC  HQ K++ P  L++L V RRVYISRDE SQVA  ++ +     +R+G + + SIGQLLPHQI SGNFHN  ++YPTG  S RI+WS R   +R+ Y CEIL ++D   P F++TA D +MEN      TC   W+ IL++I  L K HK+VK FP+ ++ EDL+GL E H++RA+ESLPG++SL DY F FG+++LI EMPL IN SG  R+EP ++ Y          S +F        +   +  + +G    N ++N     +K   SS+ QQYRKLK E   NV+L RS+IQG GL+AA+DLE+ TM+IEYVGELIR E+AN REK YE+  +GIYMFRLD  TVIDAT  G LARYINH C PNC  E ++F   SHIVII+NR+I+KGEEL Y       + + DKIPCLC A NCR+WMN
Sbjct:  111 KKRPINTSTVPSKFRKWQGIRWRQYVSDAHHPSDMSSKRNIVDDSLSPFLS--NPAVMHAPHSGDKRVCDLCQQAGDAPEDGAGRLLPLDLDNWIHINCALWCYEVYETIGGSLNNLDIWLAKAKETACTQCGLLGAGLPCYNPKCSYVYHVPCAIRIRCMFFTDRGMYCPQHQPKEIHPMQLSSLAVSRRVYISRDENSQVARVVHEDSDKHVVRVGGVSLHSIGQLLPHQIDSGNFHNRRNIYPTGMCSTRIYWSMRRPRSRAKYVCEIL-EKDCH-PFFRITAIDRDMENMSVTHETCDGAWQIILSRIEALCKEHKLVKLFPQLLRGEDLFGLNESHIVRAVESLPGVDSLRDYVFNFGRLELISEMPLAINPSGCARSEPKMQTYMKRMHDTGEYSISFSHRTGLPGVRRLSHPSFNGTTCSNGVYNIDNMASKQHQSSRSQQYRKLKTEVNSNVILGRSRIQGLGLFAARDLEQQTMVIEYVGELIRLEIANKREKNYEAHNRGIYMFRLDDDTVIDATVCGGLARYINHSCQPNCLAEFVNFGGHSHIVIITNRRIKKGEELCY-DYNFDFEDRSDKIPCLCRAPNCRKWMN 704          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A448WEJ8 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS3256 PE=4 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 4.987e-165
Identity = 283/605 (46.78%), Postives = 386/605 (63.80%), Query Frame = 3
Query: 5568 NDKLLKKKAAIGPSVKSSPQKIHKGSKYSVFHSN-PIPEPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP-HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEP----FVKLYRHIHKPAIHQSPNF-------LRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            N   LK++    P   S   K  KG ++  F S+  I +  S    + ++  +L      +LR     D R+C LCHR GDL E+GPGRLLC+ VD+W+H+NC+LWC  V+E  CG+LNN    +  + ++ CS CG  GAG+ CY PRC+  YHVPCAQE GC+FF DR MYC  HQ  +  P  L +L V RRVY++R+E  QVA  I+ E+    +RIG L + S+GQLLPHQ+ SG FH   ++YP GF++ RI+WS R +  R  Y CE+        P F +TA D+ + NE   G+TC   W +IL +I++LR SH+++K FP++ K EDL+GL+EPH++RAIESLPG++ L DY FKFG++QLI EMPL IN SG  R+EP    ++K  R         S  F       L H  + A  +  +  +P ++  +++ +L  + QQYR+LK E   N++L RS+IQG GL+AA+DL++ TM+IEY+GELIR ++AN REK YE+  +GIYMFRLD  TVIDAT +G LARYINH C+PNC  E ++F +  HIVII+  KI KGEELTY       +    KIPC CG+ NCR+WMN
Sbjct:  914 NSTALKRRLGT-PGSISPKSKRWKGVRWRSFASDQAIKDKDSGHKPNSAEALELLRGHSGILRDPLLNDLRSCFLCHRAGDLREDGPGRLLCYGVDEWIHLNCSLWCYEVYEAICGSLNNERSCYIRARRTPCSYCGTLGAGLPCYNPRCSAVYHVPCAQEIGCMFFTDRGMYCPQHQPLEHHPMKLPSLAVYRRVYLAREENEQVAQVIHEEEPLHIVRIGGLCLHSVGQLLPHQLESGRFHTQRYIYPVGFRTVRIYWSMRRVFCRGRYLCEV--QECSGAPNFVITAIDKGLANETVIGATCDAAWHQILGRIASLRTSHRLIKLFPQYNKGEDLFGLSEPHIVRAIESLPGVDQLRDYVFKFGRLQLIAEMPLAINPSGCSRSEPKMRTYIKRTRRNGDFIPSTSTRFTSSGSSGLMHRNSIAHLSLYNKLLPGSVDTSSRQSLVGRSQQYRRLKLEINNNIILGRSRIQGLGLFAARDLDQHTMVIEYIGELIRVQLANKREKVYEAHNRGIYMFRLDEDTVIDATVSGGLARYINHSCEPNCVAEYVNFGEGGHIVIITTCKIHKGEELTY-DYNFDLEDCTSKIPCHCGSFNCRKWMN 1514          

HSP 2 Score: 68.1662 bits (165), Expect = 3.464e-7
Identity = 91/393 (23.16%), Postives = 156/393 (39.69%), Query Frame = 3
Query: 4068 TNNKRRNSSVAKSTSKKQKLSNEPIY-----------------HDKLNNPLQRCQQNMVKVLGQPNFRKLVHEPRIKNNLTVLAPLGCKQR-----STQCSDIVQLQDNCVKYKRMPFAMPQINPINLGVNRCSENSFILQNINVSIPECGLLSAHE-------SDDIDCLIAPSPSNNELDYLSVFN-------------CDPISSPTVNLSAGPNLEMLHPPNRNQSPQLSVFHCPNKDYLKFDHADXXXXXXXXXXXXXXRKPDSQSLLRPTGISRVQISHKYSSVSTAAEPIPENT-----LIDSETGEIVSKPVNDQTRSSNNKPREKLLMTFTINPP--DDVEKTVRNITDVLGIDYNSVEFKETTRGGEIAIDKDSMVSNSIPREI 5099
            T+ K+R +    + SKK+K +  P+                     +N       Q ++  L     + LV +PRI +   VL P G         S Q  D+ +L++  +KY+R PF+        LG +    +SF+LQ++  + P   +L   +       S       +P P + E   ++++               DP ++         N+    P +R  +P L V+H PN   L                    R P     +   GI   +     + +S A E  P        ++DSETGE++      + R    +  E+L +TFTIN    D V + +R ITD+LGID  S+ ++ T  G +I   ++   S ++ R++
Sbjct:  322 TSVKKRQNPTPSTNSKKRKTALSPVSAVNNKSATACGALDSSKQPSVNKATPEIVQQLLDKLKHQEPKDLVSDPRISSFAFVLPPYGAASHPVFLCSPQEEDL-RLREKGLKYRRTPFSSSVQRSFALGGDEEVSDSFMLQHMEANTPIEPMLHTTKHLKFSPSSQRPQVCPSPKPVSLESSLMALYTGTSQLKSGFDDSESDPATTLLPVFHIANNISRDFPQDRC-TPPLPVYHMPNPHLL-------------------IRSPG----INGKGIESNKKDCLSAELSCAKETSPYTDDSSLPVVDSETGEVLGGRRPKEAREVTGE-DEQLHVTFTINSSMTDSVPEVIRRITDLLGIDSGSLTYEVTRSGTQITFGQNQSQSKNVIRDL 688          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183W274 (Histone-lysine N-methyltransferase OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6830 PE=4 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 3.038e-163
Identity = 286/561 (50.98%), Postives = 377/561 (67.20%), Query Frame = 3
Query: 5688 STSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP-HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLY-RHIHKPAIHQSPNFLRH-LLXXXXXXXXSGKIPDNILFNN------KTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            S+  +SE+        + +V+R +   DKR C LC + GD PE+GPGRLL  DV+ W+HINCALWC  V+E   G+LNN+      + ++ CS CG  GAG+ CY P+C+  YHVPCA +  C+FF DR MYC  HQTK+  P  L++L V RRVYI+RDE SQVA  ++ ++    +RIG + + S+GQLLPHQI SGNFHNL ++YPTG  + RI+WS R    R+ Y CEIL ++D   P F++TA D+ ME+      TC   W+ IL++I +L K HK+V+ FP+ +K EDL+GL E H++RAIESLPG++ L DY F FG+++LI EMPL IN SG  R+EP ++ Y + +H      SP+  R  +L        SG     + +NN      K   S+++QQYRKLK E K NV L RS+IQG GL+AA+DLE  TM+IEY+GELIR EVAN REKQYE++ +GIYMFRLD  TVIDAT  G LARYINH C PNC+ E L+F   SHIVII+NR+++KGEEL+Y       + + DKIPCLC A NCR+WMN
Sbjct: 1145 SSRCVSENDITSTMKANLAVMRASHSDDKRVCVLCQQAGDAPEDGPGRLLPLDVNNWIHINCALWCYEVYETVGGSLNNLDVWLAKAKETNCSHCGLTGAGLPCYNPKCSCVYHVPCAIKIRCMFFTDRGMYCPQHQTKEFHPMQLSSLVVSRRVYINRDENSQVARVVHEDNDKHIVRIGGVSLHSVGQLLPHQIDSGNFHNLRNIYPTGMCATRIYWSMRRPRARAKYVCEIL-EKDCH-PFFRITAVDKGMEDVSVTHETCDGAWQIILSRIESLFKEHKLVRVFPQLLKGEDLFGLNESHIVRAIESLPGVDGLRDYVFNFGRLELISEMPLAINPSGCARSEPKMQTYLKRLHDSGEFSSPSSHRTGILPGVRRLPHSGFC--GLSYNNMDNTISKQYQSNRFQQYRKLKSEAKSNVTLGRSRIQGLGLFAARDLESQTMVIEYIGELIRLEVANRREKQYEARNKGIYMFRLDEDTVIDATVCGGLARYINHSCQPNCYAEHLNFGDHSHIVIITNRRVKKGEELSY-DYNFDLEDRSDKIPCLCRAPNCRKWMN 1700          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2d (lysine methyltransferase 2D [Source:NCBI gene;Acc:103042576])

HSP 1 Score: 433.721 bits (1114), Expect = 1.108e-121
Identity = 238/528 (45.08%), Postives = 323/528 (61.17%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            DKR C  CH  GD   +GP RLL  DVD W+H+NCALW   V+E Q GAL NV  +    L++ C+ C K GA   C   RC   YH  CA    C+FF D+ M C  H+ K  GP    L++  V RRVYI RDE  Q+A  +   D+    R+G L+  ++GQLLP Q+ +  FH+   ++P G+++ RI+WS+RV N R  Y C I       +PLF+V   +   E+  +   +    W KI+ K++ LR+   ++K F +H+K E++YGLT   V+R  ESLPG+E+  DY F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+I  N  ++ K  + SK  QYR+LK E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARY+NH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 2896 DKRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCACCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHKLK--GPSEEELSSFAVFRRVYIERDEVKQIASILQRGDRIHLFRVGGLIFHAVGQLLPSQMAA--FHSPTAIFPVGYEATRIYWSTRVPNRRCRYRCRI--SEQDGVPLFEVRVLEPGQEDLHFRDCSPDGIWDKIVQKVAKLREDAAMLKLFADHVKGEEMYGLTVHAVMRITESLPGVENCQDYTFRYGRHPLM-ELPLMINPTGCARSEP--KILTHCKRPHTLNSTS-----MSKAYQSTFTGEI--NTPYS-KQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 3405          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2d (lysine methyltransferase 2D [Source:NCBI gene;Acc:103042576])

HSP 1 Score: 430.639 bits (1106), Expect = 1.417e-120
Identity = 238/528 (45.08%), Postives = 323/528 (61.17%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            DKR C  CH  GD   +GP RLL  DVD W+H+NCALW   V+E Q GAL NV  +    L++ C+ C K GA   C   RC   YH  CA    C+FF D+ M C  H+ K  GP    L++  V RRVYI RDE  Q+A  +   D+    R+G L+  ++GQLLP Q+ +  FH+   ++P G+++ RI+WS+RV N R  Y C I       +PLF+V   +   E+  +   +    W KI+ K++ LR+   ++K F +H+K E++YGLT   V+R  ESLPG+E+  DY F++G+  L+ E+PL IN +G  R+EP  K+  H  +P    S +     ++ A  +  +G+I  N  ++ K  + SK  QYR+LK E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARY+NH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct: 4552 DKRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCACCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHKLK--GPSEEELSSFAVFRRVYIERDEVKQIASILQRGDRIHLFRVGGLIFHAVGQLLPSQMAA--FHSPTAIFPVGYEATRIYWSTRVPNRRCRYRCRI--SEQDGVPLFEVRVLEPGQEDLHFRDCSPDGIWDKIVQKVAKLREDAAMLKLFADHVKGEEMYGLTVHAVMRITESLPGVENCQDYTFRYGRHPLM-ELPLMINPTGCARSEP--KILTHCKRPHTLNSTS-----MSKAYQSTFTGEI--NTPYS-KQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 5061          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000041567.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001314.1:1300751:1307385:-1 gene:ENSAMXG00000036494.1 transcript:ENSAMXT00000041567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.59 bits (758), Expect = 2.013e-89
Identity = 156/354 (44.07%), Postives = 220/354 (62.15%), Query Frame = 3
Query: 6282 NFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            +FH+   ++P G+++ RI+WS R  N R  Y C I  D     P F +   ++  E+    GS+    W K+L  +++ R    ++K FP ++K EDL+GLT P V R +ESLPG+E+ + Y F++G+  L+ E+PL IN SG  R+EP  K   H+ +P    S + ++ L     + A    +P      +K  + SK  QYR++K E K NV L RS+IQG GLYAA+D+EK T++IEY+G +IRNEVAN +EK YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E++ FEK+  I+I SNR+I++GEEL Y       +    KIPC CGA NCR+WMN
Sbjct:    3 DFHSSAAIFPVGYEASRIYWSMRHGNRRCRYLCSI--DEKDGEPEFSIRVIEQGYEDLLLTGSSPKGVWDKVLEPVADRRNETGILKLFPVYLKGEDLFGLTVPAVTRIVESLPGVEACSRYTFRYGRNPLM-ELPLAINPSGCARSEP--KALTHVKRPHTLTSGSTIKTLQTNGGSPAELTGVP-----YSKQFVHSKSSQYRRMKAEWKSNVYLARSRIQGLGLYAARDIEKDTLVIEYIGTIIRNEVANRKEKMYESQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCIAEVVTFEKDHKIMITSNRRIQRGEELCY-DYKFDLEDDQHKIPCHCGAVNCRKWMN 345          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000033484.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:1968942:1979026:-1 gene:ENSAMXG00000036099.1 transcript:ENSAMXT00000033484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.567 bits (719), Expect = 3.181e-83
Identity = 157/408 (38.48%), Postives = 241/408 (59.07%), Query Frame = 3
Query: 6120 LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            L   +V RRVY+ RDE  Q+A  +   +     R+GSL+  ++GQL P  +   +FH+ + ++P G+++ R++WS R    R  Y C +  +  Q  P F +   +   E+     ++    W K+L  ++  R    +++ FP ++K EDL+GLT   V R  ESLPG+++ + Y F++G    ++E+PL IN +G  R+E  ++++    +  I    N    +L        +  + +    ++K  + SK  QYR+L  E K NV L  S+IQG GL+AA+D+EK TM+IEY+G+++R EVA  +E  Y++K +  +MFR+D   VIDAT +G  ARYINH C PNC  E++ FE+   I+I SNR+IEKGEEL YDYK  L   ++ K PCLCGA NCR+WMN
Sbjct:   26 LRCFSVFRRVYVQRDELRQLASAVQRPELGHTFRVGSLLFHAMGQLPPALL--PHFHSASAIFPPGYEASRLYWSMRHGRRRCRYVCSV--EEHQGRPEFSIRVLERGYEDLVLTDTSAKGVWDKVLGSVAERRAETGMLRLFPVYLKGEDLFGLTVSAVARIAESLPGVKACSRYRFRYG-WNPMLELPLCINPTGCARSE--LRVHPQNQRLKILSVWNRPSRILQ-------NSALAEGGPSHSKHFVHSKSSQYRRLTSEWKSNVYLAHSRIQGLGLFAARDIEKQTMVIEYLGDVLRAEVAARKELHYKAKNRKAFMFRIDGEYVIDATCSGSPARYINHSCSPNCVAEVVTFERGYKIIISSNRRIEKGEELCYDYKLGLVKNQNQKTPCLCGAVNCRKWMN 419          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2bb (lysine (K)-specific methyltransferase 2Bb [Source:ZFIN;Acc:ZDB-GENE-080521-1])

HSP 1 Score: 158.688 bits (400), Expect = 6.567e-38
Identity = 108/327 (33.03%), Postives = 169/327 (51.68%), Query Frame = 3
Query: 6375 ECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSS----KWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            E + L   DQ    FK+T +D+    E     +    W+ +L  +   R + K+ +     +    + GL    V+  +E L G  S + + F+F K Q   E  LPIN SG  R+E +++        +     NFL         T    +  D++L  +    +S       ++R L+  +K  V + RS I G GL+  +++E G M+IEY G +IR+ + + REK Y+ K  G YMFR+D   V+DAT  G+ AR+INH C+PNC++ +++ E + HIVI + RKI +GEELTY       +   +K+ C CGAR CRR++N
Sbjct: 3684 EDQFLPRGDQPHLRFKIT-SDDGFSVE---ADSIEVAWRAVLDGVQEARAAAKLRQLSFTGMNGARMMGLLHDAVVYLVEQLQGASSCHRHPFRFHK-QASQEEDLPINPSGCARSEVYLRK-------STFDMFNFLASQHRQLPDTDLYDEEEDDVLLKSSRRATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIVIFALRKIYRGEELTY-DYKFPIEDASNKLGCNCGARRCRRFLN 3997          

HSP 2 Score: 103.99 bits (258), Expect = 2.495e-21
Identity = 67/230 (29.13%), Postives = 106/230 (46.09%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLT--TLNVDRRVYISRDEYSQVAGTINN-EDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRD--QKMPLFKVTATDEN 6443
            D+R C LC + GD      GRLL    ++W H+NC++W   VFE   G L +V  +        C  C + GA + C    C   YH  CA+ + C+F  D+ ++C  H+    G  +T     V RRVY+  +  S     +   E ++  ++IGSL+V  +G+L       G         P G++  R +WS+   + R  Y C ++  R   Q+ P+ +     EN
Sbjct: 2162 DERQCVLCQKYGDAKSADAGRLLYLGQNEWAHVNCSMWSAEVFEEDNGCLMHVHSAVARGRLMRCERCNQTGATVGCCLTSCQSNYHFMCARSRNCVFQDDKTVFCYKHRDLISGQIITGQGFEVLRRVYVDFEGISLRRKFLTGLEPESINMKIGSLLVSKLGKLNELSASQGKL------VPVGYECSRWYWSAVNPHRRCKYTCRVMEVRPAVQEKPVEEFPNQGEN 2385          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002322.1 (pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 gene:ENSPMAG00000002099.1 transcript:ENSPMAT00000002322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 432.565 bits (1111), Expect = 6.889e-122
Identity = 233/550 (42.36%), Postives = 327/550 (59.45%), Query Frame = 3
Query: 5703 SESQFKKLSMKSKSVLR-KTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKD-LGPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNF-FLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            SE + ++L  K  + LR +    D R+CS CH  GD   +GP RLL  D+D W+H+NCALW + V+E Q GAL NV  +    L + C +C + GA   C  PRC   YH  CA    C+FF D+ + C  H+ +   G  L    V RRVY+ RDE  Q+A  +          R+GSL+  ++GQ+LP Q  S  FH+   +YP G+++ R++WS+R  N R  Y C +     +  P F V   ++  E+  +  ST    W KIL  +  LRK  ++++ FP++++ E+++GLT   VLR  ESLPG+E   +Y F++G+  L+ E+PL +N SG  RTEP  +L  H  +P    S +      + +  +  SG++       +K  + SK  QYR++K E K NV L RS+IQG GLYA++D+EK TM+IEY+GE+IRNEVAN  EK YES  +G+YMFRLD   VIDAT  G  ARYINH C PNC  EL+ F++E+ I+I S R+I+KGEELTY       +   +KIPC CGA NCR+WMN
Sbjct: 3387 SEDEIEELMRKLGTSLRPEPAPPDMRSCSFCHLQGDGATDGPARLLNLDLDIWVHLNCALWSSEVYETQAGALINVEGARRRGLGTKCGACLRMGATTSCNRPRCPNVYHFACALRMRCMFFKDKTVLCPAHRPRSSTGQELGCFAVLRRVYVQRDEVRQLASLVRRGPMGGGTFRVGSLLFHALGQILPGQASSPYFHSRTALYPIGYQATRLYWSTRYTNKRCRYLCSV--SEAEGRPQFTVRIVEQGHEDLVHAASTPQGVWDKILEPVVRLRKGAEMLRLFPDYMRGEEMFGLTVQAVLRITESLPGVECCQNYMFRYGRHPLM-ELPLAVNPSGCARTEP--RLRSHFKRPHTLNSSS-----NSKSFQSTMSGELSAPY---SKQFVYSKSSQYRRMKTEWKINVYLARSRIQGLGLYASRDIEKHTMVIEYIGEIIRNEVANRHEKLYESTNRGVYMFRLDSEHVIDATITGGPARYINHSCAPNCVAELVTFDRENKIIISSCRRIQKGEELTY-DYLFDFEDDQNKIPCHCGAINCRKWMN 3922          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010827.1 (pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 gene:ENSPMAG00000009809.1 transcript:ENSPMAT00000010827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 2.540e-46
Identity = 79/137 (57.66%), Postives = 101/137 (73.72%), Query Frame = 3
Query: 6936 RSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKE-SHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            R   QG GLYAA+D+EK TM+IEY+G +IRNEVAN RE  Y+++ +G+YMFR+D   VIDAT  G  ARYINH C PNC  E+++F+KE S I+IIS+R+++KGEELTY       +    KIPC CGA NCR+WMN
Sbjct:    1 RCATQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRREALYKAQNRGVYMFRIDGDHVIDATLTGGPARYINHSCSPNCVAEVVNFDKERSKIIIISSRRLQKGEELTY-DYKFDFEDDQHKIPCHCGAPNCRKWMN 136          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 130.954 bits (328), Expect = 2.715e-30
Identity = 66/153 (43.14%), Postives = 101/153 (66.01%), Query Frame = 3
Query: 6888 QYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGI-YMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            ++ +LKF  K  +   +S+I  +GL+A + +    M+IEYVG+ IR  VA++REK+YE +  G  Y+FR+D  T+IDAT+ G+LAR+INH C+PNC+ +++  E +  IVI S + I   EE+TY         +++KIPCLCGA +CR  +N
Sbjct: 1706 KFNQLKFRKK-KLRFTKSRIHEWGLFALEPIAAEEMVIEYVGQGIRQLVADMREKRYEVEGIGSSYLFRVDHDTIIDATKVGNLARFINHSCNPNCYAKVITVESQKRIVIYSKQAINVNEEITY---DYKFPIEENKIPCLCGAEHCRGTLN 1854          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002229.1 (pep scaffold:Pmarinus_7.0:GL477110:4214:18323:-1 gene:ENSPMAG00000002027.1 transcript:ENSPMAT00000002229.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 6.440e-23
Identity = 68/226 (30.09%), Postives = 103/226 (45.58%), Query Frame = 3
Query: 5775 RTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTT--LNVDRRVYISRDEYSQVAGTINN-EDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDEN 6443
            R CS C        N  GRLL    D+W H NCA+W   VFE   G+L NV  +     +  C  CG+ GA + C  P C   +H  CA+ + C+F  D+ +YCQ H+    G  +      V RRV++  +        ++  E     + IGSL +  +G L    ++ G       ++P G++  R++WS+       VY C++L  R +       T TD N
Sbjct:  333 RNCSRCFLYSKWLLNEAGRLLGIGQDEWTHSNCAVWSAEVFEDDDGSLKNVHAAVWRGKQLRCEHCGRMGATVGCCLPACQANFHFMCARARSCVFQDDKKLYCQRHKDLIRGEVVAEDGFEVLRRVFVDFEGIGLRRKFLSGLEPDKIQMMIGSLTIECLGVLNDLSLYEGK------LFPIGYQCTRVYWSTADARRLCVYTCKVLEFRPES------TTTDVN 546          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004922.1 (pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 gene:ENSPMAG00000004401.1 transcript:ENSPMAT00000004922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.889e-13
Identity = 39/115 (33.91%), Postives = 66/115 (57.39%), Query Frame = 3
Query: 6915 KFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTY 7259
            K +++L  S + G+G++    ++K   I EY GE+I  + A+ R K Y+ K    ++F L+   V+DATR G+  R+ NH   PNC+ +++    +  I I + R I+ GEEL +
Sbjct:  648 KKHLLLAPSDVAGWGIFIKVPVQKNEFISEYCGEIISQDEADRRGKVYD-KYMCSFLFNLNNDFVVDATRKGNKIRFANHSVSPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFF 761          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: RAD1 (Single-stranded DNA endonuclease (with Rad10p); cleaves single-stranded DNA during nucleotide excision repair and double-strand break repair; subunit of Nucleotide Excision Repair Factor 1 (NEF1); homolog of human XPF protein [Source:SGD;Acc:S000005943])

HSP 1 Score: 198.749 bits (504), Expect = 1.165e-51
Identity = 132/383 (34.46%), Postives = 208/383 (54.31%), Query Frame = 3
Query: 1542 PRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLI--------------LPEMCYDVQKSIYGTSSRIGGSD---NIVANV-IVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMS----SNHKNAFSLFIGN-NEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGR--PEPSKEKL-----------PTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKP 2582
            P  II+F+P +S +R+IE Y+A ++   +P    +YFM Y  SIEEQ +LT +++EK+AF  LI+  A+L               L E    + K     +   GG     N+  +V IVD REF + LP LL++ G ++ P  + VGDY++ P IC+ERKS++D IGSL N RL +QC  M++YY    LLIEF    S S    S  +N  +  I   + IS +++ ++I  KL  L + FP L+I+WS SP  TV +  +LKLGR  P+PS   +            TA G     ++  NE     +L +PG++  ++     +I SF+ L + + ++I E+I ++++ ++IY FL   K+E       E+ ++N + P
Sbjct:  709 PSYIIMFEPDISFIRQIEVYKA-IVKDLQP---KVYFMYYGESIEEQSHLTAIKREKDAFTKLIRENANLSHHFETNEDLSHYKNLAERKLKLSKLRKSNTRNAGGQQGFHNLTQDVVIVDTREFNASLPGLLYRYGIRVIPCMLTVGDYVITPDICLERKSISDLIGSLQNNRLANQCKKMLKYYAYPTLLIEFDEGQSFSLEPFSERRNYKNKDISTVHPISSKLSQDEIQLKLAKLVLRFPTLKIIWSSSPLQTVNIILELKLGREQPDPSNAVILGTNKVRSDFNSTAKGL----KDGDNESKFKRLLNVPGVSKIDYFNLRKKIKSFNKLQKLSWNEINELINDEDLTDRIYYFLRTEKEE----QEQESTDENLESP 1079          

HSP 2 Score: 129.413 bits (324), Expect = 2.924e-30
Identity = 119/426 (27.93%), Postives = 200/426 (46.95%), Query Frame = 3
Query:  117 ENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYC--------IEDVLVLVINA----------SMEESKYYVDKLKQDSVS---------HEPVHI-TADCLT-KTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIH----EIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLD-SIRSNALS-----GKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIK-EKSSTEESRKTLVIVGKEVTALLLAKL 1274
            EN +I +      L+I GKG+G+  I+ + L +          ++  LVLV+NA          ++EE  ++ +  K D  +           P ++ TAD L+ +    +Y  GG++ ++S+ILIVD L   +    V+G++V     +     E+F L +++  N  GF+KAFS+        +S L   M  L +K V LWPRF + V + LN      H    E+ + +T   +  Q  L++ +K+ + EL   N  +  D   +EN +   F R++     P W +IS +S+QL+ +I+ +R L  +L+  D V FF  +  S+ +N  S      +S W+ +  A ++ + AK R+F             +E  +E  PKW     IL  I  E+ +      TLV     +T L LAK+
Sbjct:  100 ENSLITE----DALIIMGKGLGLLDIVANLLHVLATPTSINGQLKRALVLVLNAKPIDNVRIKEALEELSWFSNTGKDDDDTAVESDDELFERPFNVVTADSLSIEKRRKLYISGGILSITSRILIVDLLSGIVHPNRVTGMLVLNADSLRHNSNESFILEIYRSKNTWGFIKAFSEAPETFVMEFSPLRTKMKELRLKNVLLWPRFRVEVSSCLNATNKTSHNKVIEVKVSLTNSMSQIQFGLMECLKKCIAELSRKNPELALDWWNMENVLDINFIRSIDSVMVPNWHRISYESKQLVKDIRFLRHLLKMLVTSDAVDFFGEIQLSLDANKPSVSRKYSESPWLLVDEAQLVISYAKKRIF-----------YKNEYTLEENPKWEQLIHILHDISHERMTNHLQGPTLVACSDNLTCLELAKV 510          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 134.42 bits (337), Expect = 1.007e-31
Identity = 72/143 (50.35%), Postives = 96/143 (67.13%), Query Frame = 3
Query: 6924 VVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGI---YMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            V+  RS I  +GLYA   +    MIIEYVGE IR  VA +REK+Y   K GI   Y+FR+D +TVIDAT+ G +AR+INHCCDPNC  +++       IVI + R I   EELTYDYKF+ +   ++++PCLCGA NC+ ++N
Sbjct:  940 VMFARSAIHNWGLYALDSIAAKEMIIEYVGERIRQPVAEMREKRY--LKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCLCGAPNCKGFLN 1080          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET2 (Histone methyltransferase with a role in transcriptional elongation; methylates H3 lysine 36 (H3K36), which suppresses incorporation of acetylated histones and signals for the deacetylation of these histones within transcribed genes; associates with the C-terminal domain(CTD) of Rpo21p; H3K36me3 (trimethylation) requires Spt6p, proline 38 on H3, CTD of Rpo21p, Ctk1p, and C-terminal SRI domain of Ste2p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003704])

HSP 1 Score: 67.3958 bits (163), Expect = 2.300e-11
Identity = 46/136 (33.82%), Postives = 68/136 (50.00%), Query Frame = 3
Query: 6924 VVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKK-QGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNC 7328
            + + ++K +G+G+ A +D+E    I EY GE+I       R   Y+ +  +  Y   L     IDAT  G LAR+ NH C PN +      + +  + I + RKI KGEE+T+DY  D    +  K  C C   NC
Sbjct:  122 IAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFKHFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQK--CYCEEPNC 255          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO37589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA7])

HSP 1 Score: 331.257 bits (848), Expect = 2.675e-100
Identity = 213/473 (45.03%), Postives = 282/473 (59.62%), Query Frame = 3
Query: 5961 CSSCGKPGAGIVC----YYP--RCTLKYHVPCAQEKGCLFFADRAMYCQLHQTK-DLGPHLTTLNVDRRVYISRDEYSQVAGTI--NNE---DQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            C  C K GA +VC    +Y   RC+  YH  CA    C+FF D+ M C  H+   D    L +  V R+V+I RDE  Q+A  +  N E   D+   LRIGSLVV S+GQLL HQ+ +  FH  N VYP GF S R +WS R IN R  Y C++  +  + MPLF +   ++  E+  + G +  + WK++L  I  LRK   +V  +P +I  EDL+GLTE  VLR IES+PG++ +  Y  ++G    I+EMPL IN +G  R E  +K +    +     S         + AA  +S +  ++     K  + SK  QYRKLK E + NV L RS IQG GL+A +D+E G M+IEY+G +IRNEVAN +E  YES+ +GIYMFR+D  +VIDAT AG  ARYINH C PNC  E++ FEKE  I+IIS+RKIEKGEELTY       +  + KI CLCGA NCR+WMN
Sbjct:    3 CCMCHKMGATVVCNRVNFYNKVRCSNTYHFGCAIRNNCMFFKDKTMLCHEHRPDGDREDRLPSYAVFRKVFIHRDEIEQIARMLRHNQESGGDKLQTLRIGSLVVKSLGQLLLHQLQT--FHTRNAVYPVGFNSIRFYWSMREINKRCQYHCKV--EECEGMPLFTLRVNEQGHEDTVFKGKSPRDVWKQVLEPIHKLRKEAVLVNLWPAYITGEDLFGLTEQFVLRIIESMPGVDYMQGYNMRYGPSS-IMEMPLAINPTGCARAEALIKTHFRSTRSVSSIST------AGSNAAGNSSREAEESTSLYMKQFVYSKASQYRKLKTEWRQNVFLGRSNIQGLGLFANRDMEPGCMVIEYIGSIIRNEVANKKESIYESQNRGIYMFRIDSDSVIDATIAGGPARYINHSCMPNCVAEVVTFEKEQKIIIISSRKIEKGEELTY-DYKFDFEDDEHKISCLCGAPNCRKWMN 463          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO39065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB73])

HSP 1 Score: 265.388 bits (677), Expect = 2.397e-73
Identity = 153/364 (42.03%), Postives = 219/364 (60.16%), Query Frame = 3
Query: 1497 SSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDI-ISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPE-----------MCYDVQKSIYGTSSRIGGSDNIVAN----VIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEP-SKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHD---LLRFTEDDIYEIIKNKNIANQIYSFLHQSKK 2528
            S P   +H+L  + +P+ ++L+D  +  VR++E ++A      +P I + +YFM+Y+ S+EEQKYLTTLRKEKEAFE LI+ KAS++ PE           +  D  K+    ++R  G     +     VIVDMREFRSELPSL+H++G  IEP+T+ VGDYIL+P +CVERKSV D IGSL+NGRLYSQ  +M RYY   ILLIEF  + S S   + +         +S +++I ++ SKL LLTIHFPKLRILW HSPYAT ELF +LK+  PEP S   +     S  + + K +     +I+ +P  +    G  +  +N   D   L   +E ++ +++ N   A  ++ FLH  K+
Sbjct:  537 SDPYSLIHTLY-EVEPKYVVLYDADIEFVRQLEVFKA-----SRPGIPLRVYFMIYTGSVEEQKYLTTLRKEKEAFEKLIREKASMVTPEEQEGRSWAAMALSRDPSKATDAVNTRKAGGRQTESQAPRKVIVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILSPDMCVERKSVGDLIGSLNNGRLYSQAVAMTRYYKRPILLIEFDPNKSFSLQARTS---------LSGEISIQNVTSKLTLLTIHFPKLRILWCHSPYATAELFDELKMNHPEPDSTVAVNVGTDSSTAADLKYSVGPQASIISMPFDSAIPVGWCVFVMNQTKDIQQLCNLSEAELAKLLGNNISAKALWEFLHTDKR 885          

HSP 2 Score: 254.218 bits (648), Expect = 1.072e-69
Identity = 146/383 (38.12%), Postives = 235/383 (61.36%), Query Frame = 3
Query:   90 LFNKMLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSN--ALSGKSNWITLRAANMLFNSAKLRLFKNAN----------VDWRKITTA--SELNIEIPPKWNAFTDILKRIKE 1196
            + +  LL+YE+ M +++     L I+ +G+ I +++ SF+K+YC    LV+V+N+S  E    V++LK + V   P  IT +  +   ESIY  GG++F++S+IL+VD L  RIP  LVSG++V + HK+ E+CQEAF LRL++E+N  GF+KAFSD      +GY  ++RVM NL V+++ LWPRF   V   L   KP++ E+ L++T    + Q +LLD+I   L EL+  N  +D+DEL+VEN I   FD+ LR+  +P+W Q+  +++QL+ ++K +R +   L + D V+F+  L+S+R++   ++ KS W+ + A + LF +AK R++  +N              K++ A   E  +E  PKW    DILK I+E
Sbjct:    1 MADGALLEYESAMFLEIQEEDGLFITARGLSIHRVLTSFIKMYCDPAALVIVVNSSKYEEDRIVEELKSEGVML-PKVITTEYSSSERESIYLGGGVLFVTSRILVVDMLTKRIPVHLVSGMLVLKAHKIIESCQEAFILRLYRENNKTGFIKAFSDQPTAFMSGYCKVERVMKNLFVRKLSLWPRFHAGVSALLERHKPDVVELHLQMTSLMLANQTALLDLIDTSLRELRRANPSLDADELSVENCIIKSFDKALRVLLDPVWHQLGVKTKQLVADLKVLRLILFYLTQYDCVTFYKFLESLRASEREVTRKSLWLFMDATDSLFVNAKERVYGTSNNKPKAKKMKKDKEPKMSKACDDEPLLEESPKWKLLADILKEIEE 382          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK6])

HSP 1 Score: 132.109 bits (331), Expect = 2.318e-33
Identity = 98/309 (31.72%), Postives = 154/309 (49.84%), Query Frame = 3
Query: 6483 TWKKILTKISNLRKSHKVVKFFPEHIKAED--LYGLTEPHVLRAIESLPGLESLNDYAFKFG---KMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNI--------LFNNKTTLSSK-------WQQYRKLKFET--KFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
             W+ I   + + R SH ++K  P  I   D  + G+T+  V   +E L     L +Y F++           + L  N +G  RTEP        H+  ++    FL      A+   T  ++ DN          + N TT+            +YR LK     K  + + RS I G GLY  + +  G M+IEY G LIR+ + + RE  YESK  G YMFR+D + V+DAT +G+ AR+INH C+PNC++ ++  +    I+I +++ I +GEELTY         +D+K+PC C ++ CR+++N
Sbjct:   24 AWRMIFDLVRDSRSSH-LLKDLP-FIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGEDGLELKENPTGCCRTEPH-------HRRLMYDMFAFL------ASEYRTPPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTY---DYKFPLEDEKLPCHCKSKRCRKYLN 314          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO44546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVC2])

HSP 1 Score: 128.642 bits (322), Expect = 3.305e-33
Identity = 71/156 (45.51%), Postives = 98/156 (62.82%), Query Frame = 3
Query: 6879 KWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGI-YMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            K+ + R  K + KF     +S I  +GL+A + +    M+IEYVGE+IR  +A+ RE+ YE +  G  YMFRLD +T+IDAT  G+ AR+INHCCDPNC+ +++  E    IVI S R I+  EE+TY         +D+KIPCLCGA  CR  +N
Sbjct:   65 KFNKLRVRKKQLKF----AKSSIHDWGLFALEPIAADEMVIEYVGEVIRQAIADYRERCYEERGIGSSYMFRLDETTIIDATTMGNFARFINHCCDPNCYAKVIAVENMKKIVIYSKRDIQVDEEITY---DYKFPIEDEKIPCLCGAPQCRGTLN 213          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK5])

HSP 1 Score: 127.487 bits (319), Expect = 5.507e-32
Identity = 97/305 (31.80%), Postives = 152/305 (49.84%), Query Frame = 3
Query: 6495 ILTKISNLRKSHKVVKFFPEHIKAED--LYGLTEPHVLRAIESLPGLESLNDYAFKFG---KMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNI--------LFNNKTTLSSK-------WQQYRKLKFET--KFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            I   + + R SH ++K  P  I   D  + G+T+  V   +E L     L +Y F++           + L  N +G  RTEP        H+  ++    FL      A+   T  ++ DN          + N TT+            +YR LK     K  + + RS I G GLY  + +  G M+IEY G LIR+ + + RE  YESK  G YMFR+D + V+DAT +G+ AR+INH C+PNC++ ++  +    I+I +++ I +GEELTY         +D+K+PC C ++ CR+++N
Sbjct:    2 IFDLVRDSRSSH-LLKDLP-FIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGEDGLELKENPTGCCRTEPH-------HRRLMYDMFAFL------ASEYRTPPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTY---DYKFPLEDEKLPCHCKSKRCRKYLN 288          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000028985.1 (pep primary_assembly:ASM223467v1:20:4868775:4873089:-1 gene:ENSORLG00000027146.1 transcript:ENSORLT00000028985.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 329.331 bits (843), Expect = 4.632e-100
Identity = 175/408 (42.89%), Postives = 250/408 (61.27%), Query Frame = 3
Query: 6120 LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            L   +V RRV++ RDE  Q+A  +   ++    R+GSL+  ++G+LLPHQI +  FHN   ++P G+ ++R++WS R  N R  Y C I  +     PLFKV   ++  E+    G +    W +IL  ++ +R S   +K FP ++K EDL+GLT   V R IESLPG+E+   Y F++G+  L+ E PL  N SGS R+EP +             S +  R  L  + A    G + +++   ++    SK  QYR++K E K NV L RS+IQG GLYAA+D+EK TM+IEY+G +IR+EVAN +E+ YES+ +G+YMFR+D   VIDAT  G  ARYINH C PNC TE+++ EKE+ I+I S R+I++GEEL+Y       +    KIPC CGA NCR+WMN
Sbjct:   11 LRCFSVFRRVFVQRDEARQIAAIVQRGERQHTFRVGSLLFRTVGRLLPHQIST--FHNETAIFPVGYHANRLYWSMRHSNRRCKYMCHI--EEVGGQPLFKVKVVEKGYEDLVLTGPSPKAVWDQILEPVAQMRSSSGTLKLFPAYLKGEDLFGLTTSAVSRIIESLPGVEACERYTFRYGRNPLM-EWPLAFNPSGSARSEPKLT------------SASLFRPYLLTSVAPRCQGSVGESVAAAHQGR-HSKAAQYRRMKAEWKSNVYLARSRIQGLGLYAARDIEKCTMVIEYIGAIIRSEVANRKERLYESQNRGVYMFRIDNDYVIDATITGGPARYINHSCAPNCITEVVNVEKENKIIISSCRRIQRGEELSY-DYKFDLEDDQHKIPCHCGAVNCRKWMN 399          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000033878.1 (pep primary_assembly:ASM223467v1:7:12278136:12280872:-1 gene:ENSORLG00000024034.1 transcript:ENSORLT00000033878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.168 bits (827), Expect = 9.097e-98
Identity = 189/425 (44.47%), Postives = 265/425 (62.35%), Query Frame = 3
Query: 6078 MYCQLHQTKDLGP---HLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            M C  H+ K  GP    L+T  V RRVYI RDE  Q+A  +   D+    R+G L+  ++GQLLP Q+   NFH+   ++P G+++ RI+WS+RV N R  Y C I    D   PLF+V   +  ME+  Y  ++    W++I+ +++ LR    ++K F E++K E+++GLT   V+R  ESLPG+E+   Y F++G+  L+ E+PL IN +G  R+EP  K+     +P    S +     ++ A  +  +G++  N  ++ K  + SK  QYR+LK E K NV L RS+IQG GLYAAKDLEK TM+IEY+G +IRNEVAN REK YE + +GIYMFR++   VIDAT  G  ARY+NH C PNC  E++ F+KE  I+IIS+R+I KGEELTY       +    KIPC CGA NCR+WMN
Sbjct:    1 MLCTQHKLK--GPSEDELSTFAVLRRVYIERDEVKQIASILQRGDRIHLFRVGGLIFHAVGQLLPSQM--ANFHSATAIFPVGYEATRIYWSTRVPNKRCRYRCRI--SEDDGRPLFEVRVLEHGMEDLHYRDASPDGIWERIVQQVAKLRTDSSMLKLFTENLKGEEMFGLTIHAVMRITESLPGVENCQSYQFRYGRHPLM-ELPLMINPTGCARSEP--KVSTQCKRPHTLNSTS-----VSKAYQSTFTGEL--NTPYS-KQFVHSKSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTVIRNEVANRREKIYELQNRGIYMFRINNEQVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTY-DYQFDFEDDQHKIPCHCGAWNCRKWMN 407          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000036251.1 (pep primary_assembly:ASM223467v1:17:25405391:25409583:1 gene:ENSORLG00000025059.1 transcript:ENSORLT00000036251.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 285.804 bits (730), Expect = 1.136e-84
Identity = 156/436 (35.78%), Postives = 238/436 (54.59%), Query Frame = 3
Query: 6078 MYCQLHQTKDLGPH-----LTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEP---------FVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            M C  H+ +  G       L    V RRVY+ RDE  Q+A  +   +  F  R+GSLV+ +IGQL P Q+ S  FH+   ++P G+++ R++WS R  N R  Y C +  + +  +P F +   +    +     ++    W K+L  ++  R     ++ FP ++K EDL+GLT P V +  ESLPG+ES + Y+F++G+   +V +PL  N +G  R +P          ++L   +H  +   + N  +            G +P +        +  +  QYR +K E + NV L RS+IQG GL+AA+D+EK +M+IEY G ++RNEVA  +EK Y S+ + ++MFR+D   V+DATR G LARYINH C PNC  E++ FE+   I+I   R++EKGEEL +            +I C CGA  CR+WMN
Sbjct:    1 MLCHAHRPRGTGGQALEHELRCFAVFRRVYVQRDEMRQIATAVQQPELGFTFRVGSLVLHAIGQLTPLQMAS--FHSSTAIFPVGYEACRVYWSMRHGNRRCRYVCSV--EDNDGLPEFTIRVIERGYPDLLLTDASPKGVWDKVLGPVAEKRSESGTLQLFPVYLKGEDLFGLTVPAVTKITESLPGVESCDRYSFRYGRNPRLV-LPLVFNPAGCARAQPRTSSPYTSLVIRLGHVLHLSSARSNQNVAQ----------GEGGVPHS----KTPVVHPRSSQYRWMKSEWRANVYLGRSQIQGLGLFAARDIEKQSMVIEYNGTILRNEVAIRKEKVYRSQNRAVFMFRIDSEHVVDATRTGGLARYINHSCAPNCVAEVVTFERGYKIIISCVRRVEKGEELCF-DYQFDAVEGRHRIACHCGAPKCRKWMN 416          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ercc4 (ERCC excision repair 4, endonuclease catalytic subunit [Source:NCBI gene;Acc:101167401])

HSP 1 Score: 282.722 bits (722), Expect = 7.682e-79
Identity = 148/417 (35.49%), Postives = 259/417 (62.11%), Query Frame = 3
Query:  105 LLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNA--LSGKSNWITLRAANMLFNSAKLRLFK----------NANVDWRKITTASELN----IEIPPKWNAFTDILKRI-KEKSSTEESRKTLVIVGKEVTALLLAKLSITGAKNVLN 1304
            LL+YE E+ + +++   LL+  +GMG+++I+  F+++Y  +D LVL++N +  E +Y+ ++L+ + V+H P  +T+D  +    S+Y  GG++F++S+IL+VD+L+ RIP  L+SGI+V+R HK+ E+CQEAF LRLF++ N  GF+KAF+D +   S G+  ++RVM NL VK++YLWPRF  SV T L   KP + E+ + +T    + Q S+LDI+   L ELK  N  +++++L++EN + N F++T+R Y +P+W Q+  +++ L+ ++K +R L   L + D V+F  +L+S+RS+       S W+ L ++  +F +A+ R+++                +K ++A E+     +E  PKW A T++L+ I KE  S EE+   L+    + T   L +    G+  +L+
Sbjct:    5 LLEYETEIFLSLFSSDGLLVVAEGMGLDRILLQFMRVYSEKDSLVLLLNTTTPEQEYFTEQLRVEGVTHLPRTVTSDVQSSERYSVYTEGGVLFVTSRILVVDFLLDRIPAHLISGILVYRAHKIIESCQEAFILRLFRQKNKTGFIKAFTDKATAFSTGFCQVERVMRNLFVKKLYLWPRFQASVNTVLERHKPEVVELHVSLTPAMRAVQSSILDIMGACLKELKRYNPTLEAEDLSLENTLGNAFEKTIRHYLDPLWHQLGAKTKALVQDLKVLRVLLLYLTQYDCVTFLNLLESLRSSQKIFGSNSGWLFLDSSTSMFVNARSRVYRIPEGKKKLRVGEEEQRQKSSSAPEMKRELVLEKSPKWEALTEVLEEIEKENKSCEEAGGVLICASDDRTCAQLQQYIRHGSDGLLH 421          

HSP 2 Score: 282.337 bits (721), Expect = 1.132e-78
Identity = 166/381 (43.57%), Postives = 232/381 (60.89%), Query Frame = 3
Query: 1434 IVEESNIIIHYTSEGCSEKYISSPNFKLHSLIR---KYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPE-----------MCYDVQKSIYGTSS-RIGGSDNIV--ANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPS--KEKLPTADGSLYSEENKL-NEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLH 2516
            I++E   +IH   +GC++          HSL R   + +P  ++L+D  LS VR++E Y+A  M   KP  + +YF++Y  S EEQKYLT L KEK+AFE+LI+ KA++++PE           +  +++ +   T++ + GG +     + VIVDMREFRSELPSLLH++G  IEP+T+ VGDYIL P  CVERKSV+D IGSL +GRLYSQC SM RYY   +LLIEF  +   S   ++ F      +EIS     ND+ SKL LLT+HFP+LRILW  SP+AT ELF +LK GRPEP        TA+    +E   L N    D +LK+PG+  KN+   +   +S  D+ R  +D + EI+ N + A  +Y F+H
Sbjct:  517 ILKEPLTVIH-PLKGCTDP---------HSLTRVLHEVEPSFVVLYDAELSFVRQLEVYKA--MRPGKP--LRVYFLIYGGSTEEQKYLTALSKEKKAFEHLIREKATMVVPEEREGREDTNLDLARNLEPANATTNTHKAGGQEQRSEPSRVIVDMREFRSELPSLLHRRGLDIEPVTLEVGDYILTPDTCVERKSVSDLIGSLQSGRLYSQCLSMTRYYRKPVLLIEFDPAKPFSLTARSDF-----RHEISS----NDVSSKLTLLTLHFPRLRILWCPSPHATAELFLELKRGRPEPDAAAALAVTAESDTVAESAGLYNPGPYDFLLKMPGVNVKNYRALIKHADSLADISRLGQDKLAEILGNTHNAKLLYEFMH 874          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: kmt2bb (lysine methyltransferase 2B [Source:NCBI gene;Acc:101174945])

HSP 1 Score: 151.369 bits (381), Expect = 1.045e-35
Identity = 103/331 (31.12%), Postives = 164/331 (49.55%), Query Frame = 3
Query: 6381 EILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVK----------LYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            E   ++DQ    F++T+ D           +    WK ++  +   R   K+     + +    + GL    V+  +E L G      + F+F K Q   +  LP+N +G  R+E +++            +H   P I    +    +L  +   ATS ++P  + F             R L+  +K  V + RS I G GL+  +++E G M+IEY G +IR+ + + REK Y+ K  G YMFR+D   V+DAT  G+ AR+INH C+PNC++ +++ E   HIVI + RKI +GEELTY       +   +K+ C CGAR CRR++N
Sbjct: 3487 ECPTNKDQPHLRFEITSED----GFSVEADSIEVAWKAVIDGVQEARAIAKLRPLTFQRVTGAGMLGLVHDTVVFLLEQLEGAHRCQKHTFRFFKQQ-SPDDDLPVNPNGCARSELYLRKSTFDMFNFLASQHRQLPDIGPYDDEEDEVLLKSTRRATSLELPMAMRF-------------RHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYAGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTY-DYKFPIEDASNKLNCNCGARRCRRFLN 3798          

HSP 2 Score: 107.071 bits (266), Expect = 2.599e-22
Identity = 67/209 (32.06%), Postives = 97/209 (46.41%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLT--TLNVDRRVYISRDEYSQVAGTINNEDQNFF-LRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEI 6386
            D+R CSLC + GDL  +  GRLL    ++W H+NC LW   VFE   G+L +V  +        C  C K GA + C    C   YH  CA+ + C+F  D+ +YC  H+    G  +T     V+RRVY+  +  S     +   +  F  + IGSL +  +G L       G        +P GF+  R +WS+     R  Y C +
Sbjct: 2157 DERQCSLCQKYGDLKPDEAGRLLYLGQNEWAHVNCCLWSAEVFEEDNGSLLHVHSAVTRGRLMRCERCNKTGATVGCCLTSCQSNYHFMCARSRQCVFQDDKKVYCYKHRHLISGRMITGQEFEVNRRVYVDFEGISLRRKFLTGLEPEFINVMIGSLQIDKLGVLSELSASKGKL------FPVGFQCFRWYWSTVNPLRRCRYTCTV 2359          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000064115.1 (SMESG000064115.1)

HSP 1 Score: 2758.4 bits (7149), Expect = 0.000e+0
Identity = 1457/1464 (99.52%), Postives = 1458/1464 (99.59%), Query Frame = 3
Query: 2955 MEQNQSEQPYFISNLASPNIISSAQFPCTVIGSNKTTNYTIVPNNSNSSVNYRQYQNSTSNDLKNAQNLPSSIAHNCYATNNQSDEFKFLASNINKNKKQYKRNLTMKTSQCLNSNDNSSDITAAPNQLTILVQEVLPAQVPDNPVLTSTIPPHLNAIKAHSSNIISTSPISEKKLDLSIKKEISPDKKDVNFLPLSTDSEIIXXXXXXXXXXXXESRDTITEVIKEVLIKALSNDPHEDVFLSVIKSRENVSRSVTETVDXXXXXXXXXXXXXXXXXDNPLIQLTIQNNIPFQRHSEMFRPNKTISTVNFTHPQYSNPNDIKPIANDVKSNILAQSFPKSEFYPVNCQIHQKPNLNDELLHSNLEPSAKPTNNKRRNSSVAKSTSKKQKLSNEPIYHDKLNNPLQRCQQNMVKVLGQPNFRKLVHEPRIKNNLTVLAPLGCKQRSTQCSDIVQLQDNCVKYKRMPFAMPQINPINLGVNRCSENSFILQNINVSIPECGLLSAHESDDIDCLIAPSPSNNELDYLSVFNCDPISSPTVNLSAGPNLEMLHPPNRNQSPQLSVFHCPNKDYLKFDHADXXXXXXXXXXXXXXRKPDSQSLLRPTGISRVQISHKYSSVSTAAEPIPENTLIDSETGEIVSKPVNDQTRSSNNKPREKLLMTFTINPPDDVEKTVRNITDVLGIDYNSVEFKETTRGGEIAIDKDSMVSNSIPREICERYNTSVYKMEXXXXXXXXXXXKPFDNLISIDKSTELPLYSEKVYKSTALLNKPCLKCSNCDKLIPDQKLMYSNNNMLCDRIKYRDLCFCDEACQQEYXXXXXXXXXXXXXXXXXX-XXIKDQCIYVGDDICDASVIVQGXXXXXXXXXXRLGALINDKLLKKKAAIGPSVKSSPQKIHKGSKYSVFHSNPIPEPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            MEQNQSEQPYFISNLASPNIISSAQFPCTVIGSNKTTNYTIVPNNSNSSVNYRQYQNSTSNDLKNAQNLPSSIAHNCYATNNQSDEFKFLASNINKNKKQYKRNLTMKTSQCLNSNDNSSDITAAPNQLTILVQEVLPAQVPDNPVLTSTIPPHLNAIKAHSSNIISTSPISEKKLDLSIKKEISPDKKDVNFLPLSTDSEIIQPNVPVVQTNVNESRDTITEVIKEVLIKALSNDPHEDVFLSVIKSRENVSRSVTETVDSLEMSSSMSSPILSQISDNPLIQLTIQNNIPFQRHSEMFRPNKTISTVNFTHPQYSNPNDIKPIANDVKSNILAQSFPKSEFYPVNCQIHQKPNLNDELLHSNLEPSAKPTNNKRRNSSVAK TSKKQKLSNEPIYHDKLNNPLQRCQQNM+KVLGQPNFRKLVHEPRIKNNLTVLAPLGCKQRSTQCSDIVQLQDNCVKYKRMPFAMPQINPINLGVNRCSENSFILQNINVSIPECGLLSAHESDDIDCLIAPSPSNNELDYLSVFNCDPISSPTVNLSAGPNLEMLHPPNRNQSPQLSVFHCPNKDYLKFDHADLSSLTSFSSSSSSTRKPDSQSLLRPTGISRVQISHKYSSVSTAAEPIPENTLIDSETGEIVSKPVNDQTRSSNNKPREKLLMTFTINPPDDVEKTVRNITDVLGIDYNSVEFKETTRGGEIAIDKDSMVSNSIPREICERYNTSVYKMESTTNINNSITTKPFDNLISIDKSTELPLYSEKVYKSTALLNKPCLKCSNCDKLIPDQKLMYSNNNMLCDRIKYRDLCFCDEACQQEYSTLDDDTHSNNNN TT   SDIKDQCIYVGDDICDASVIVQGSISKSKQISKRLGALINDKLLKKKAAIGPSVKSSPQKIHKGSKYSVFHSNPIPEPTS SIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLAAAAATATSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYDYKFDLDDGKDDKIPCLCGARNCRRWMN
Sbjct:    1 MEQNQSEQPYFISNLASPNIISSAQFPCTVIGSNKTTNYTIVPNNSNSSVNYRQYQNSTSNDLKNAQNLPSSIAHNCYATNNQSDEFKFLASNINKNKKQYKRNLTMKTSQCLNSNDNSSDITAAPNQLTILVQEVLPAQVPDNPVLTSTIPPHLNAIKAHSSNIISTSPISEKKLDLSIKKEISPDKKDVNFLPLSTDSEIIQPNVPVVQTNVNESRDTITEVIKEVLIKALSNDPHEDVFLSVIKSRENVSRSVTETVDSLEMSSSMSSPILSQISDNPLIQLTIQNNIPFQRHSEMFRPNKTISTVNFTHPQYSNPNDIKPIANDVKSNILAQSFPKSEFYPVNCQIHQKPNLNDELLHSNLEPSAKPTNNKRRNSSVAKLTSKKQKLSNEPIYHDKLNNPLQRCQQNMIKVLGQPNFRKLVHEPRIKNNLTVLAPLGCKQRSTQCSDIVQLQDNCVKYKRMPFAMPQINPINLGVNRCSENSFILQNINVSIPECGLLSAHESDDIDCLIAPSPSNNELDYLSVFNCDPISSPTVNLSAGPNLEMLHPPNRNQSPQLSVFHCPNKDYLKFDHADLSSLTSFSSSSSSTRKPDSQSLLRPTGISRVQISHKYSSVSTAAEPIPENTLIDSETGEIVSKPVNDQTRSSNNKPREKLLMTFTINPPDDVEKTVRNITDVLGIDYNSVEFKETTRGGEIAIDKDSMVSNSIPREICERYNTSVYKMESTTNINNSITTKPFDNLISIDKSTELPLYSEKVYKSTALLNKPCLKCSNCDKLIPDQKLMYSNNNMLCDRIKYRDLCFCDEACQQEYSTLDDDTHSNNNNNTTTKCSDIKDQCIYVGDDICDASVIVQGSISKSKQISKRLGALINDKLLKKKAAIGPSVKSSPQKIHKGSKYSVFHSNPIPEPTSISIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLAAAAATATSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYDYKFDLDDGKDDKIPCLCGARNCRRWMN 1464          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000064113.1 (SMESG000064113.1)

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 825/830 (99.40%), Postives = 827/830 (99.64%), Query Frame = 3
Query:  102 MLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIKEKSSTEESRKTLVIVGKEVTALLLAKLSITGAKNVLNESLRKHLNXXXXXXXXXXXXXXXXXLPEETEEFQGIVKENNCFIVEESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKPRFD 2591
            MLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLM RIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISLLDIIKELLNELKILNSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIKEK STEESRKTLVIVGKEVTALLLAKLSITGAKNVLNESLRKHLNIKTAKVTKTKIIKPTSTLPEETEEFQGIVKENNCFIVEESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELP+LLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIR+YPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKL LLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKPRFD
Sbjct:    1 MLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVINASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMGRIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISLLDIIKELLNELKILNSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIKEKPSTEESRKTLVIVGKEVTALLLAKLSITGAKNVLNESLRKHLNIKTAKVTKTKIIKPTSTLPEETEEFQGIVKENNCFIVEESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELPALLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRHYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLALLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKPRFD 830          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000064113.1 (SMESG000064113.1)

HSP 1 Score: 1491.86 bits (3861), Expect = 0.000e+0
Identity = 764/769 (99.35%), Postives = 766/769 (99.61%), Query Frame = 3
Query:  285 KLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISXXXXXXXXXXXXXXXXSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIKEKSSTEESRKTLVIVGKEVTALLLAKLSITGAKNVLNESLRKHLNXXXXXXXXXXXXXXXXXLPEETEEFQGIVKENNCFIVEESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELPSLLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKPRFD 2591
            KLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLM RIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISLLDIIKELLNELKILNSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIKEK STEESRKTLVIVGKEVTALLLAKLSITGAKNVLNESLRKHLNIKTAKVTKTKIIKPTSTLPEETEEFQGIVKENNCFIVEESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELP+LLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIR+YPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKL LLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKPRFD
Sbjct:    3 KLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQILIVDYLMGRIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKAFSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHEIMLEITQHSTSCQISLLDIIKELLNELKILNSFIDSDELTVENAITNLFDRTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSIRSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIPPKWNAFTDILKRIKEKPSTEESRKTLVIVGKEVTALLLAKLSITGAKNVLNESLRKHLNIKTAKVTKTKIIKPTSTLPEETEEFQGIVKENNCFIVEESNIIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENYQAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASLILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELPALLHKKGFKIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRHYPLSILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLALLTIHFPKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNEDVVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQIYSFLHQSKKELFLSVNLENNNKNFKKPRFD 771          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000071222.1 (SMESG000071222.1)

HSP 1 Score: 521.931 bits (1343), Expect = 7.791e-156
Identity = 285/588 (48.47%), Postives = 371/588 (63.10%), Query Frame = 3
Query: 5592 AAIGPSV--KSSPQKIHKGSKYSVFHSNPIPEPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTTLNVDRRVYISRDEYSQVAGTIN-NEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLR-HLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            +++ P+V    S +K   G  YS F + P+   T    I ++    L  K     RK   VD R+C LC   GD  E+  GRL+  D D W+H+NCALWC  VFE   G+L  V  S   ++K+IC+ C + GAGI CY  +CT  YHVPCA + GC+F+ DR MYC  H   +   HL +L V+RRV I RDE + +AG +  ++D     R GSL + +IGQLLP Q+ SGN+++ + +YP G+ S RI+WSS  IN R  YEC  L+D    MPLFKV   D   EN      +C + WK IL KI+ LR+   + + FP ++  E LYGLTEP ++R IESLPG+E + +YAFKFGKMQLI EMPL IN +GS RTEP  KL  ++ +   +Q   F +  +L A         I DN   N    L+SK QQY++LK+E + NV+L RSKIQG GL+AAKD EK TMIIEY+GE+IRNEV N REK Y+++   IYMFRL+   +IDAT  G LARYINH C+PNC  E L  +  S I+I + + IE+GEELTYDYKFD +D K DKIPCLCG+ NCR+WMN
Sbjct:  754 SSVKPAVVVTDSIKKRLLGLNYSYFKTEPLK--TIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTICTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYEC--LIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEP--KLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 1334          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000027630.1 (SMESG000027630.1)

HSP 1 Score: 145.591 bits (366), Expect = 3.580e-34
Identity = 96/298 (32.21%), Postives = 155/298 (52.01%), Query Frame = 3
Query: 6486 WKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKM-------QLIVEMPLPINMSGSIRTEPFVKLY-RHIHKPAI---HQSPNFL-RHLLXXXXXXXXSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYXXXXXXXXXXXXXIPCLCGARNCRRWMN 7343
            W  I+ +I+ +RKS  ++++   +      +GL   HV+  +E +      N+Y FKF K        Q + ++  P    G +R   + K    HI +  +   H   N+  ++     A        PD        TL+ +++  R         V +  S I G GL+A +  +   +IIEYVGE+IR+ ++++RE +Y+      YMFRLD   ++DAT  G+ AR+INH C PNC+ +++ FE E HI+II+ RKI KGEELTY         +DDK+PC CG+ +C++++N
Sbjct: 2386 WGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSP---RGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAPLNADQLDDNPDPDEDYLR---TLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTY---DYRFPIEDDKLPCTCGSFSCKKYLN 2674          

HSP 2 Score: 82.0333 bits (201), Expect = 6.404e-15
Identity = 75/304 (24.67%), Postives = 133/304 (43.75%), Query Frame = 3
Query: 5769 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYP--------RCTLKYHVPCA--QEKGCLFFADRAMYCQLHQ----TKDLGPHLTTLNVDRRVYISRDEYSQV--AGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVY--PTGFKSHRIHWSSRVINTRSVYECEILMDRDQKM--PLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESL 6620
            D R C+LC  +GD  +   GRL+   +D W+H+NCALW ++V+E + GAL NV  +     K++C++C K GA + C  P         C   YH  CA       +F   R  YC        T      L  + + RR+Y+ +   + V  A T      N  + IG+L +  +G++           +   VY  P G+++ R+ WS   +++  +Y   +  + + K       V+A+    +N     +T +   ++ + ++   R + +     P   K + +Y + E   L+ I   
Sbjct: 1724 DIRHCALCAGSGD--DRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-------DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNNKANGDDLSVSASGVVNQNPATLVATAAIPHRRRMIEMPEQRTTKRSK---PMQCKQDIIYEMDEAGNLQPISGF 2015          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2C2.029e-12142.40lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2D2.563e-11944.51lysine methyltransferase 2D [Source:HGNC Symbol;Ac... [more]
KMT2C5.091e-11742.31lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2C5.091e-11742.31lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2C3.926e-11242.14lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-161.260e-4631.48Histone-lysine N-methyltransferase [Source:UniPro... [more]
xpf-17.751e-3531.92(Xeroderma Pigmentosum group F) DNA repair gene ho... [more]
xpf-17.751e-3531.92(Xeroderma Pigmentosum group F) DNA repair gene ho... [more]
set-22.034e-3048.00Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-24.488e-3048.00Histone-lysine N-methyltransferase set-2 [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trr4.596e-13244.36gene:FBgn0023518 transcript:FBtr0070362[more]
trr4.813e-13244.36gene:FBgn0023518 transcript:FBtr0070363[more]
mei-93.977e-7037.08gene:FBgn0002707 transcript:FBtr0343574[more]
mei-93.977e-7037.08gene:FBgn0002707 transcript:FBtr0070656[more]
trx4.218e-3547.37gene:FBgn0003862 transcript:FBtr0082947[more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2d3.621e-12345.83lysine (K)-specific methyltransferase 2D [Source:Z... [more]
kmt2ca1.016e-11641.90lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2ca1.080e-11641.90lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2ca1.158e-11441.71lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2cb3.148e-10036.00lysine (K)-specific methyltransferase 2Cb [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERCC41.370e-15234.67excision repair cross-complementation group 4 [Sou... [more]
ERCC42.645e-15234.67excision repair cross-complementation group 4 [Sou... [more]
ERCC44.304e-15234.67excision repair cross-complementation group 4 [Sou... [more]
ERCC46.201e-15134.57excision repair cross-complementation group 4 [Sou... [more]
rab9b1.495e-12344.78RAB9B, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kmt2c4.236e-12242.59lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2c6.320e-12242.50lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2d9.930e-12044.51lysine (K)-specific methyltransferase 2D [Source:M... [more]
Kmt2d1.137e-11944.51lysine (K)-specific methyltransferase 2D [Source:M... [more]
Kmt2c8.564e-11942.50lysine (K)-specific methyltransferase 2C [Source:M... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IRW8|TRR_DROME4.824e-13144.36Histone-lysine N-methyltransferase trr OS=Drosophi... [more]
sp|Q6PDK2|KMT2D_MOUSE6.946e-11944.51Histone-lysine N-methyltransferase 2D OS=Mus muscu... [more]
sp|O14686|KMT2D_HUMAN1.231e-11844.51Histone-lysine N-methyltransferase 2D OS=Homo sapi... [more]
sp|Q8BRH4|KMT2C_MOUSE5.990e-11842.50Histone-lysine N-methyltransferase 2C OS=Mus muscu... [more]
sp|Q8NEZ4|KMT2C_HUMAN2.445e-11642.31Histone-lysine N-methyltransferase 2C OS=Homo sapi... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N5Y31.138e-17034.57Histone-lysine N-methyltransferase MLL3 OS=Paragon... [more]
A0A3R7GXD14.281e-16837.31Histone-lysine N-methyltransferase 2C OS=Clonorchi... [more]
A0A094ZLC15.421e-16648.08Histone-lysine N-methyltransferase 2C OS=Schistoso... [more]
A0A448WEJ84.987e-16546.78Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A183W2743.038e-16350.98Histone-lysine N-methyltransferase OS=Trichobilhar... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2d1.108e-12145.08lysine methyltransferase 2D [Source:NCBI gene;Acc:... [more]
kmt2d1.417e-12045.08lysine methyltransferase 2D [Source:NCBI gene;Acc:... [more]
ENSAMXT00000041567.12.013e-8944.07pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033484.13.181e-8338.48pep primary_assembly:Astyanax_mexicanus-2.0:16:196... [more]
kmt2bb6.567e-3833.03lysine (K)-specific methyltransferase 2Bb [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002322.16.889e-12242.36pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 ge... [more]
ENSPMAT00000010827.12.540e-4657.66pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 ge... [more]
setd1a2.715e-3043.14SET domain containing 1A, histone lysine methyltra... [more]
ENSPMAT00000002229.16.440e-2330.09pep scaffold:Pmarinus_7.0:GL477110:4214:18323:-1 g... [more]
ENSPMAT00000004922.11.889e-1333.91pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RAD11.165e-5134.46Single-stranded DNA endonuclease (with Rad10p); cl... [more]
SET11.007e-3150.35Histone methyltransferase, subunit of the COMPASS ... [more]
SET22.300e-1133.82Histone methyltransferase with a role in transcrip... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375892.675e-10045.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390652.397e-7342.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308582.318e-3331.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445463.305e-3345.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308575.507e-3231.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028985.14.632e-10042.89pep primary_assembly:ASM223467v1:20:4868775:487308... [more]
ENSORLT00000033878.19.097e-9844.47pep primary_assembly:ASM223467v1:7:12278136:122808... [more]
ENSORLT00000036251.11.136e-8435.78pep primary_assembly:ASM223467v1:17:25405391:25409... [more]
ercc47.682e-7935.49ERCC excision repair 4, endonuclease catalytic sub... [more]
kmt2bb1.045e-3531.12lysine methyltransferase 2B [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064115.10.000e+099.52SMESG000064115.1[more]
SMESG000064113.10.000e+099.40SMESG000064113.1[more]
SMESG000064113.10.000e+099.35SMESG000064113.1[more]
SMESG000071222.17.791e-15648.47SMESG000071222.1[more]
SMESG000027630.13.580e-3432.21SMESG000027630.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002047 ID=SMED30002047|Name=Histone-lysine N-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=7494bp
TTTTTAAAGGCAATTGTTAATTATTTATTTTCAATCGAATTTGACTATTT
ATTGCGAATCATTTATATTATTCAACTTAATATTAATAATTATTCAACAA
GATGCTCTTAGATTATGAAAATGAAATGATAATTGATATGTATAATGGAA
GTACGTTACTGATATCTGGAAAAGGAATGGGAATTGAAAAAATAATTTAT
AGTTTTCTTAAACTATACTGTATTGAGGATGTGTTAGTTTTAGTGATAAA
TGCTTCTATGGAAGAATCAAAGTATTATGTAGACAAATTAAAACAGGATA
GTGTTTCTCACGAACCTGTTCATATAACTGCTGATTGTTTAACTAAAACT
CATGAAAGTATATATAAAAGAGGGGGTTTAATCTTTATGTCTAGTCAAAT
TTTAATAGTTGATTATCTGATGGCGCGTATTCCTGGTGCCCTGGTTTCAG
GGATTATGGTATTTAGAGGTCATAAAGTAACTGAAGCGTGCCAAGAGGCT
TTTGCGTTACGGCTATTCAAAGAAAGCAATCCAAATGGTTTTGTTAAAGC
ATTTAGTGATAATTCTCTGGGATTAAGTGCAGGATATTCTACGTTAGACA
GAGTGATGATGAATTTACACGTGAAAGAAGTATATTTATGGCCTAGATTC
AGCTTAAGTGTTGTAACAACTCTTAACAATTGTAAACCAAATATCCATGA
AATTATGCTTGAAATTACACAACATAGTACATCTTGCCAAATATCTCTTC
TTGATATTATCAAGGAATTATTAAATGAATTAAAAATTCTTAATTCATTT
ATTGACAGTGATGAATTAACTGTGGAAAATGCAATAACGAATTTATTTGA
TCGAACGTTGAGGATTTACTTTGAACCAATTTGGAGCCAAATAAGTAGAC
AAAGCCGCCAATTAATACATGAAATTAAAGATATGCGTCGTTTGACGCAT
ATTTTGATTGAACAAGATCCTGTTAGTTTTTTTATTGTATTAGATTCAAT
AAGATCAAACGCATTATCTGGAAAAAGCAATTGGATAACATTGCGAGCTG
CAAATATGCTTTTTAATAGTGCTAAGCTTCGTTTATTTAAGAATGCCAAT
GTTGATTGGAGAAAAATAACAACTGCCAGTGAATTAAATATAGAAATACC
GCCAAAATGGAATGCATTCACTGATATACTAAAGCGAATCAAAGAAAAAT
CATCAACAGAGGAATCTAGGAAGACTCTAGTTATTGTGGGAAAAGAAGTC
ACGGCGTTATTGTTGGCGAAACTATCAATAACTGGGGCCAAAAATGTTTT
AAATGAGAGCTTACGAAAACATTTGAATATCAAAACGGCTAAAGTTACTA
AGACAAAAATTATTAAACCGACTTCTACACTTCCAGAAGAAACGGAAGAA
TTTCAAGGAATAGTGAAAGAGAATAATTGTTTTATTGTTGAAGAGTCCAA
TATCATTATTCATTATACGTCTGAAGGGTGTAGTGAAAAATACATTTCAT
CTCCAAATTTTAAACTTCATAGTCTAATTCGCAAATATGATCCACGCCGC
ATCATTTTATTTGATCCTCGCTTGAGTGAAGTTCGAGAAATTGAAAATTA
TCAAGCAGAATTGATGTGTTCTGATAAACCAGATATTATAAGTATTTACT
TCATGATGTATTCCAATTCAATTGAAGAGCAAAAGTATTTAACGACATTA
AGAAAAGAAAAAGAAGCATTTGAGTATTTGATCAAGTCCAAAGCTAGTTT
AATTTTACCAGAAATGTGTTATGATGTCCAAAAATCTATATATGGTACAT
CCAGTCGTATTGGAGGTTCTGATAACATTGTAGCTAATGTTATAGTCGAT
ATGCGAGAATTTCGCAGTGAATTACCGTCGTTATTGCACAAAAAGGGATT
TAAGATTGAACCTCTGACCATCAATGTCGGTGATTATATTTTAGCACCAC
ATATATGTGTAGAACGTAAATCTGTAAATGATTTTATAGGATCTTTACAT
AATGGTAGACTGTATAGTCAATGTGCATCTATGATTCGGTACTATCCGTT
ATCTATTCTGTTGATCGAATTCTGTTCGTCAACCTCAATGTCTTCAAATC
ATAAAAACGCGTTTTCCTTATTCATTGGAAATAATGAAATTTCTAAACAA
GTCACTATAAATGATATTATATCAAAACTTGTTTTGTTGACAATTCACTT
TCCGAAGTTACGAATTTTATGGTCTCACAGTCCTTATGCAACTGTGGAAT
TATTCAAAGATTTGAAACTTGGTCGTCCAGAACCATCAAAAGAAAAGTTA
CCAACTGCTGACGGATCATTATATTCAGAAGAAAATAAATTGAATGAAGA
TGTGGTAGATACTATATTAAAAATACCTGGAATTACTTGGAAAAATCATG
GAATGTTTTTAAGTCGCATTAATAGTTTTCATGATTTATTGCGATTTACA
GAAGATGATATATATGAAATTATAAAAAACAAAAATATAGCTAATCAAAT
ATATTCATTTTTGCATCAATCTAAAAAGGAATTATTTTTATCTGTGAACC
TGGAAAACAATAATAAAAACTTTAAAAAGCCAAGATTTGATCTTTTGAAA
AAAAAATAAAGTTTAATCTGAATTTTAAAAAATTTATTTAAACTGCATTA
AATAAATTATTTTTAAAAAGCTAATAAACTCATTTTGTTTATAAATTATT
TGTTTATCAACAATTATGAATTTAATACTTATGGCGATTTAAATATTATA
AAACTTTCATTTTTAATTATTTTACAATTATATATTTATGATAATTAAAT
AAATTAAATTTGCATAATTCGTAATAATTTGCCATAAAAATAAATTATAA
ATCCTATATTTGCATTTTTAAAACTTGATCATTTAATAATCTTTTTAATG
GAATTTGATTAACATTAAACGTAAATTGTTATTGAAATTAAATTTTTTTA
ACACATGGAACAAAATCAAAGTGAACAACCATATTTTATATCGAATTTGG
CATCACCGAATATTATTTCCTCGGCTCAATTTCCATGTACTGTAATCGGC
TCAAATAAAACTACTAATTACACCATTGTGCCTAATAATAGCAATTCATC
AGTAAATTACAGACAATATCAAAACAGCACGTCAAACGATTTAAAAAATG
CTCAAAATCTACCGAGTTCCATTGCCCATAATTGCTATGCGACAAATAAT
CAAAGTGATGAATTTAAATTTCTGGCTTCAAATATTAATAAAAATAAGAA
GCAATATAAAAGAAATTTAACAATGAAGACATCACAATGTTTAAATAGCA
ATGACAATTCAAGTGATATTACAGCTGCACCGAATCAGTTAACTATTCTT
GTCCAAGAGGTTCTGCCAGCGCAAGTGCCAGATAATCCTGTGCTTACATC
GACAATTCCACCTCATTTAAATGCAATTAAAGCTCATTCTTCAAATATCA
TATCAACTTCTCCAATAAGTGAGAAAAAACTTGATTTATCAATTAAAAAA
GAAATATCTCCAGATAAAAAAGATGTAAATTTTTTACCTCTTTCTACAGA
TTCAGAAATTATTCAACCTAATGTTCCAGTTGTACAGACAAATGTGAATG
AATCACGAGACACAATTACAGAAGTTATCAAAGAGGTGTTAATTAAAGCT
CTCAGTAATGATCCTCACGAAGATGTGTTTCTCAGTGTGATTAAATCTAG
AGAAAATGTTTCTCGTTCTGTTACGGAAACTGTCGATAGTTTAGAAATGT
CAAGCTCAATGTCGTCGCCGATTTTATCACAGATTTCTGATAACCCACTA
ATTCAATTGACGATTCAAAACAACATTCCATTTCAACGTCATTCAGAAAT
GTTTCGACCGAACAAAACCATTTCTACAGTGAATTTTACCCATCCGCAAT
ATTCGAATCCGAATGACATTAAACCAATCGCAAATGATGTCAAATCGAAC
ATCCTTGCTCAATCGTTTCCGAAATCTGAATTCTATCCTGTCAACTGCCA
AATCCACCAGAAACCGAATCTCAATGACGAACTTTTACATTCAAACTTAG
AGCCGTCTGCGAAACCGACGAATAACAAACGTCGCAATTCATCTGTCGCG
AAATCGACAAGCAAAAAGCAAAAATTATCGAATGAGCCTATATATCATGA
CAAATTGAACAATCCACTGCAACGCTGTCAACAAAATATGGTTAAGGTTT
TGGGTCAGCCGAATTTCCGCAAACTTGTCCATGAGCCTCGAATAAAAAAC
AATCTAACCGTTCTTGCACCGCTTGGCTGCAAACAACGATCAACTCAATG
CTCAGACATCGTACAGCTGCAGGACAACTGCGTCAAATACAAACGAATGC
CATTCGCAATGCCACAAATCAATCCGATCAATCTCGGTGTTAATCGATGC
TCGGAAAACAGTTTCATTCTCCAGAATATCAATGTCAGTATTCCGGAATG
TGGGCTATTGTCGGCGCACGAATCAGACGATATTGATTGTTTGATAGCGC
CATCTCCGAGTAACAATGAACTCGATTATCTCAGTGTATTCAATTGTGAT
CCTATTTCATCGCCGACTGTCAATTTATCTGCTGGTCCCAATCTGGAAAT
GCTTCATCCACCAAATCGCAATCAATCTCCGCAGTTGTCTGTGTTTCATT
GTCCGAATAAAGATTATCTCAAATTCGATCATGCGGATTTATCATCGTTG
ACGTCGTTTTCGTCATCATCCTCGTCGACACGCAAACCCGATTCACAATC
ATTGTTGCGTCCCACCGGAATTTCACGGGTTCAAATATCCCATAAATATT
CATCAGTTTCCACAGCGGCTGAACCGATTCCCGAAAACACCCTAATCGAT
TCGGAAACCGGTGAGATTGTCAGTAAACCAGTCAATGATCAAACCAGATC
TAGTAACAATAAGCCGAGAGAGAAATTACTGATGACATTCACTATCAATC
CGCCGGATGATGTTGAGAAAACCGTGAGAAATATTACCGATGTGTTGGGA
ATCGATTACAATTCAGTCGAATTTAAAGAAACGACTCGCGGTGGGGAAAT
CGCTATCGACAAAGACAGTATGGTCAGCAATTCGATTCCCAGGGAAATTT
GTGAACGATATAATACATCAGTTTACAAGATGGAGTCCACTACTAACATT
AACAATAGTATTACAACGAAACCGTTCGATAATCTCATATCAATTGATAA
ATCAACTGAGCTTCCTCTTTATTCAGAAAAGGTCTACAAATCAACAGCAC
TTCTTAATAAGCCTTGTTTAAAATGTTCAAATTGTGACAAATTAATACCG
GATCAGAAATTGATGTATTCCAATAATAATATGTTATGTGATCGGATCAA
ATATCGAGATCTGTGTTTCTGTGATGAGGCTTGCCAACAGGAGTATTCAA
CACTTGATGATGACACTCACAGTAACAACAACAACACCACTACTAAGTGT
TCTGACATCAAGGATCAGTGCATTTATGTTGGAGATGATATTTGTGACGC
TTCGGTAATAGTTCAAGGATCCATATCGAAATCCAAACAAATCTCCAAAC
GATTAGGTGCTCTTATCAATGACAAACTTCTCAAGAAAAAGGCCGCAATC
GGTCCTTCAGTTAAATCGTCCCCGCAGAAAATCCACAAAGGCAGCAAATA
TTCTGTGTTCCATTCGAACCCGATTCCGGAACCGACGAGCACATCTATCA
TATCAGAATCGCAATTCAAGAAATTGTCAATGAAATCGAAATCCGTTTTG
CGGAAAACTGGATTCGTTGATAAACGAACTTGTTCGCTGTGTCATCGAAC
CGGAGATCTACCGGAGAATGGGCCGGGTCGGTTGCTGTGTTTCGATGTTG
ACAAATGGCTACACATCAACTGCGCTTTATGGTGTAACAATGTATTCGAA
ATGCAATGCGGAGCACTGAATAATGTTCCCGAGTCATTCGAAGCCTCATT
GAAATCAATTTGCAGCTCGTGTGGGAAACCCGGTGCCGGAATCGTTTGCT
ATTATCCCCGATGTACATTGAAATATCACGTGCCTTGTGCTCAAGAAAAA
GGGTGCTTGTTTTTTGCTGATCGAGCAATGTATTGCCAGTTGCATCAAAC
AAAAGATTTGGGTCCTCATTTAACAACGTTGAATGTTGATCGGCGAGTCT
ACATATCTCGAGATGAATATTCCCAAGTTGCTGGAACAATCAATAATGAG
GATCAGAATTTCTTTCTCAGGATCGGTTCTCTCGTTGTTCTATCAATCGG
GCAGCTGCTTCCACACCAGATACATTCAGGAAACTTTCACAATCTCAATC
ACGTCTATCCGACCGGATTCAAGTCCCATCGGATTCATTGGTCGTCTCGA
GTAATCAATACTCGATCTGTTTACGAATGTGAAATCCTGATGGACAGAGA
TCAAAAAATGCCTTTATTTAAAGTCACTGCAACAGATGAAAACATGGAGA
ATGAGTGCTATTTCGGATCGACTTGTTCAGAAACCTGGAAAAAAATTCTC
ACGAAGATCTCAAATCTAAGGAAATCACACAAAGTAGTGAAATTTTTTCC
GGAACATATCAAAGCTGAAGATTTGTATGGATTAACGGAACCACACGTAT
TAAGAGCTATTGAATCGTTGCCGGGCTTAGAGAGTTTAAATGATTACGCG
TTCAAATTCGGTAAAATGCAATTAATTGTCGAAATGCCACTCCCGATTAA
TATGAGCGGATCGATTCGGACCGAGCCGTTCGTAAAACTTTATCGGCACA
TTCACAAACCCGCTATCCATCAATCTCCTAACTTCCTGAGGCATTTGCTG
GCTGCTGCAGCAGCAACGGCCACATCAGGGAAAATCCCAGACAACATTCT
ATTCAACAACAAAACAACTCTCAGTAGTAAATGGCAACAATATCGGAAAC
TGAAATTCGAAACCAAGTTCAATGTGGTTTTGAAGCGATCCAAAATTCAG
GGATTCGGACTTTATGCAGCTAAAGATCTTGAAAAAGGTACAATGATCAT
AGAATACGTTGGGGAGTTGATTCGGAACGAGGTAGCCAACATTCGTGAGA
AACAATACGAAAGTAAAAAGCAAGGAATCTACATGTTTCGCCTCGATCCT
TCAACAGTGATCGATGCTACCAGAGCCGGTGATTTAGCCAGATATATTAA
TCATTGTTGTGATCCCAATTGTTTTACTGAACTGTTGGATTTTGAAAAAG
AGAGTCACATTGTCATTATATCAAACAGAAAAATCGAGAAAGGAGAAGAA
TTAACCTATGATTACAAATTTGATTTAGATGACGGTAAAGATGATAAAAT
CCCGTGTTTGTGCGGAGCCAGGAATTGTCGACGGTGGATGAATTGAACAT
ATGATGATAACGCCAACGATGCTTTTACAATTTAATAATACTTAATATTT
TGACAACGATAATGATGACATTAATGACAACATTATTTAAAAGAGTAATT
TTGTGATAGTTTTGTAAATTCTATACAGATATATACCTGATATA
back to top

protein sequence of SMED30002047-orf-1

>SMED30002047-orf-1 ID=SMED30002047-orf-1|Name=SMED30002047-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=836bp
MLLDYENEMIIDMYNGSTLLISGKGMGIEKIIYSFLKLYCIEDVLVLVIN
ASMEESKYYVDKLKQDSVSHEPVHITADCLTKTHESIYKRGGLIFMSSQI
LIVDYLMARIPGALVSGIMVFRGHKVTEACQEAFALRLFKESNPNGFVKA
FSDNSLGLSAGYSTLDRVMMNLHVKEVYLWPRFSLSVVTTLNNCKPNIHE
IMLEITQHSTSCQISLLDIIKELLNELKILNSFIDSDELTVENAITNLFD
RTLRIYFEPIWSQISRQSRQLIHEIKDMRRLTHILIEQDPVSFFIVLDSI
RSNALSGKSNWITLRAANMLFNSAKLRLFKNANVDWRKITTASELNIEIP
PKWNAFTDILKRIKEKSSTEESRKTLVIVGKEVTALLLAKLSITGAKNVL
NESLRKHLNIKTAKVTKTKIIKPTSTLPEETEEFQGIVKENNCFIVEESN
IIIHYTSEGCSEKYISSPNFKLHSLIRKYDPRRIILFDPRLSEVREIENY
QAELMCSDKPDIISIYFMMYSNSIEEQKYLTTLRKEKEAFEYLIKSKASL
ILPEMCYDVQKSIYGTSSRIGGSDNIVANVIVDMREFRSELPSLLHKKGF
KIEPLTINVGDYILAPHICVERKSVNDFIGSLHNGRLYSQCASMIRYYPL
SILLIEFCSSTSMSSNHKNAFSLFIGNNEISKQVTINDIISKLVLLTIHF
PKLRILWSHSPYATVELFKDLKLGRPEPSKEKLPTADGSLYSEENKLNED
VVDTILKIPGITWKNHGMFLSRINSFHDLLRFTEDDIYEIIKNKNIANQI
YSFLHQSKKELFLSVNLENNNKNFKKPRFDLLKKK*
back to top

protein sequence of SMED30002047-orf-2

>SMED30002047-orf-2 ID=SMED30002047-orf-2|Name=SMED30002047-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1464bp
MEQNQSEQPYFISNLASPNIISSAQFPCTVIGSNKTTNYTIVPNNSNSSV
NYRQYQNSTSNDLKNAQNLPSSIAHNCYATNNQSDEFKFLASNINKNKKQ
YKRNLTMKTSQCLNSNDNSSDITAAPNQLTILVQEVLPAQVPDNPVLTST
IPPHLNAIKAHSSNIISTSPISEKKLDLSIKKEISPDKKDVNFLPLSTDS
EIIQPNVPVVQTNVNESRDTITEVIKEVLIKALSNDPHEDVFLSVIKSRE
NVSRSVTETVDSLEMSSSMSSPILSQISDNPLIQLTIQNNIPFQRHSEMF
RPNKTISTVNFTHPQYSNPNDIKPIANDVKSNILAQSFPKSEFYPVNCQI
HQKPNLNDELLHSNLEPSAKPTNNKRRNSSVAKSTSKKQKLSNEPIYHDK
LNNPLQRCQQNMVKVLGQPNFRKLVHEPRIKNNLTVLAPLGCKQRSTQCS
DIVQLQDNCVKYKRMPFAMPQINPINLGVNRCSENSFILQNINVSIPECG
LLSAHESDDIDCLIAPSPSNNELDYLSVFNCDPISSPTVNLSAGPNLEML
HPPNRNQSPQLSVFHCPNKDYLKFDHADLSSLTSFSSSSSSTRKPDSQSL
LRPTGISRVQISHKYSSVSTAAEPIPENTLIDSETGEIVSKPVNDQTRSS
NNKPREKLLMTFTINPPDDVEKTVRNITDVLGIDYNSVEFKETTRGGEIA
IDKDSMVSNSIPREICERYNTSVYKMESTTNINNSITTKPFDNLISIDKS
TELPLYSEKVYKSTALLNKPCLKCSNCDKLIPDQKLMYSNNNMLCDRIKY
RDLCFCDEACQQEYSTLDDDTHSNNNNTTTKCSDIKDQCIYVGDDICDAS
VIVQGSISKSKQISKRLGALINDKLLKKKAAIGPSVKSSPQKIHKGSKYS
VFHSNPIPEPTSTSIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTG
DLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLK
SICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTK
DLGPHLTTLNVDRRVYISRDEYSQVAGTINNEDQNFFLRIGSLVVLSIGQ
LLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQ
KMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPE
HIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINM
SGSIRTEPFVKLYRHIHKPAIHQSPNFLRHLLAAAAATATSGKIPDNILF
NNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIE
YVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINH
CCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYDYKFDLDDGKDDKIP
CLCGARNCRRWMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004518nuclease activity
GO:0003677DNA binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0018024histone-lysine N-methyltransferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR034732EPHD
IPR006166ERCC4_domain
IPR020819DNA_repair_nuc_XPF/helicase
IPR011335Restrct_endonuc-II-like
IPR010994RuvA_2-like
IPR001214SET_dom
IPR003888FYrich_N
IPR003616Post-SET_dom
IPR003889FYrich_C
IPR001965Znf_PHD
Vocabulary: biological process
TermDefinition
GO:0006259DNA metabolic process
GO:0032259methylation
GO:0051568histone H3-K4 methylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001214SET domainSMARTSM00317set_7coord: 1323..1445
e-value: 1.6E-36
score: 137.3
IPR001214SET domainPFAMPF00856SETcoord: 1334..1438
e-value: 1.1E-18
score: 68.1
IPR001214SET domainPROSITEPS50280SETcoord: 1323..1439
score: 18.367
IPR003888FY-rich, N-terminalSMARTSM00541fyrn_3coord: 1102..1147
e-value: 9.9E-4
score: 28.4
IPR003888FY-rich, N-terminalPFAMPF05964FYRNcoord: 1092..1145
e-value: 1.4E-14
score: 53.6
IPR003888FY-rich, N-terminalPROSITEPS51542FYRNcoord: 1086..1148
score: 25.054
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 1003..1049
e-value: 0.0022
score: 27.2
IPR003889FY-rich, C-terminalSMARTSM00542fyrc_3coord: 1155..1242
e-value: 5.6E-20
score: 82.4
IPR003889FY-rich, C-terminalPFAMPF05965FYRCcoord: 1154..1237
e-value: 1.1E-22
score: 80.0
IPR003889FY-rich, C-terminalPROSITEPS51543FYRCcoord: 1151..1236
score: 26.085
IPR003616Post-SET domainSMARTSM00508PostSET_3coord: 1448..1464
e-value: 2.1E-5
score: 34.0
IPR003616Post-SET domainPROSITEPS50868POST_SETcoord: 1448..1464
score: 9.806
NoneNo IPR availablePFAMPF13771zf-HC5HC2Hcoord: 971..1048
e-value: 2.7E-8
score: 33.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.360coord: 1087..1229
e-value: 1.6E-33
score: 117.3
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 1294..1464
e-value: 8.8E-54
score: 184.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 366..389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 617..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 585..605
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 633..653
NoneNo IPR availablePANTHERPTHR45888FAMILY NOT NAMEDcoord: 922..1464
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 1305..1464
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 938..1052
e-value: 2.5E-20
score: 74.8
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 941..1049
score: 20.8