Potassium voltage gated channel protein

Overview
NamePotassium voltage gated channel protein
Smed IDSMED30002046
Length (bp)2025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage gated channel protein (SMED30002046) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage gated channel protein (SMED30002046) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage gated channel protein (SMED30002046) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage gated channel protein (SMED30002046) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002046

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002046SMESG000020672.1 SmedASXL_014136SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002046SMESG000020672.1 dd_Smed_v6_15425_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage gated channel protein vs. Ensembl Human
Match: KCNA1 (potassium voltage-gated channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:6218])

HSP 1 Score: 510.76 bits (1314), Expect = 2.020e-175
Identity = 300/427 (70.26%), Postives = 351/427 (82.20%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ----FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            + P +P ++  Y +  ++ +++  ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+IKE+ + LPE  +QR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K     +  F GT    ++I+   +      F++PFFI+ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT IA+   +Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ +
Sbjct:   14 AAPGHP-QDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKD----DKDFTGT---VHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage gated channel protein vs. Ensembl Human
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 510.76 bits (1314), Expect = 2.945e-174
Identity = 294/406 (72.41%), Postives = 339/406 (83.50%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIP-------QFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQ 1687
            ERV INISGLRFETQLKTL QFP TLLG+  +R +YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPID+F EEI+FY+LGEEA+EK+REDEG+++E+ + LP   FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+  +      A T+Q +++   +           FS+PFF++ET+CIIWF+FELLVRF + P K TF + IMNLIDIVAIIPYFITLGT +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+H+G+ Q
Sbjct:  104 ERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEK---DYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQSQYMHVGSCQ 506          
BLAST of Potassium voltage gated channel protein vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 505.753 bits (1301), Expect = 1.688e-173
Identity = 298/422 (70.62%), Postives = 340/422 (80.57%), Query Frame = 2
Query:  452 PYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDI-----PQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            P D     A+++  ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEI+FYELGEEA+E +REDEGYIKE+ + LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F   R  N    G+  + +      I       F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D++   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ + +  K
Sbjct:   19 PQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIF---RDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPK 437          
BLAST of Potassium voltage gated channel protein vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 505.753 bits (1301), Expect = 1.688e-173
Identity = 298/422 (70.62%), Postives = 340/422 (80.57%), Query Frame = 2
Query:  452 PYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDI-----PQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            P D     A+++  ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEI+FYELGEEA+E +REDEGYIKE+ + LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F   R  N    G+  + +      I       F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D++   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ + +  K
Sbjct:   19 PQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIF---RDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPK 437          
BLAST of Potassium voltage gated channel protein vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 505.753 bits (1301), Expect = 1.688e-173
Identity = 298/422 (70.62%), Postives = 340/422 (80.57%), Query Frame = 2
Query:  452 PYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDI-----PQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            P D     A+++  ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEI+FYELGEEA+E +REDEGYIKE+ + LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F   R  N    G+  + +      I       F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D++   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ + +  K
Sbjct:   19 PQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIF---RDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPK 437          
BLAST of Potassium voltage gated channel protein vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 332.413 bits (851), Expect = 3.146e-107
Identity = 200/401 (49.88%), Postives = 288/401 (71.82%), Query Frame = 2
Query:  437 PDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1639
            P   TP     +   Y  + VTIN+SG+RF+T   TL ++PN+LLG+  KR  +F    NE+FFDR+R +F++ILY YQSGGR++RP  VPID+F +E++F+++G++ +E++   EGY K    ++P N  QRK+W L EYP+SS+ AR +A  S+ VI LSI+ FC ET+P     + +N++      +A  ++E D   +S PFF IE +CI+WFT EL++RF S P K+TF  +++N+ID VAI P+F+      AD S+S N +MS A+LRV+RLVRVFR+FKLSRHS GLQILG+T ++SV+E  LL+FF+ I+++LF+S +YFAE     S F SIP +FW+ +VTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   26 PQRGTPDTSSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNS-----ATAELLDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 417          
BLAST of Potassium voltage gated channel protein vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 332.413 bits (851), Expect = 3.146e-107
Identity = 200/401 (49.88%), Postives = 288/401 (71.82%), Query Frame = 2
Query:  437 PDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1639
            P   TP     +   Y  + VTIN+SG+RF+T   TL ++PN+LLG+  KR  +F    NE+FFDR+R +F++ILY YQSGGR++RP  VPID+F +E++F+++G++ +E++   EGY K    ++P N  QRK+W L EYP+SS+ AR +A  S+ VI LSI+ FC ET+P     + +N++      +A  ++E D   +S PFF IE +CI+WFT EL++RF S P K+TF  +++N+ID VAI P+F+      AD S+S N +MS A+LRV+RLVRVFR+FKLSRHS GLQILG+T ++SV+E  LL+FF+ I+++LF+S +YFAE     S F SIP +FW+ +VTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   26 PQRGTPDTSSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNS-----ATAELLDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 417          
BLAST of Potassium voltage gated channel protein vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 332.028 bits (850), Expect = 6.291e-107
Identity = 200/401 (49.88%), Postives = 288/401 (71.82%), Query Frame = 2
Query:  437 PDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1639
            P   TP     +   Y  + VTIN+SG+RF+T   TL ++PN+LLG+  KR  +F    NE+FFDR+R +F++ILY YQSGGR++RP  VPID+F +E++F+++G++ +E++   EGY K    ++P N  QRK+W L EYP+SS+ AR +A  S+ VI LSI+ FC ET+P     + +N++      +A  ++E D   +S PFF IE +CI+WFT EL++RF S P K+TF  +++N+ID VAI P+F+      AD S+S N +MS A+LRV+RLVRVFR+FKLSRHS GLQILG+T ++SV+E  LL+FF+ I+++LF+S +YFAE     S F SIP +FW+ +VTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   39 PQRGTPDTSSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNS-----ATAELLDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 430          
BLAST of Potassium voltage gated channel protein vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 331.643 bits (849), Expect = 2.157e-106
Identity = 200/401 (49.88%), Postives = 288/401 (71.82%), Query Frame = 2
Query:  437 PDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1639
            P   TP     +   Y  + VTIN+SG+RF+T   TL ++PN+LLG+  KR  +F    NE+FFDR+R +F++ILY YQSGGR++RP  VPID+F +E++F+++G++ +E++   EGY K    ++P N  QRK+W L EYP+SS+ AR +A  S+ VI LSI+ FC ET+P     + +N++      +A  ++E D   +S PFF IE +CI+WFT EL++RF S P K+TF  +++N+ID VAI P+F+      AD S+S N +MS A+LRV+RLVRVFR+FKLSRHS GLQILG+T ++SV+E  LL+FF+ I+++LF+S +YFAE     S F SIP +FW+ +VTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   72 PQRGTPDTSSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNS-----ATAELLDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 463          
BLAST of Potassium voltage gated channel protein vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 331.643 bits (849), Expect = 8.588e-106
Identity = 200/401 (49.88%), Postives = 288/401 (71.82%), Query Frame = 2
Query:  437 PDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1639
            P   TP     +   Y  + VTIN+SG+RF+T   TL ++PN+LLG+  KR  +F    NE+FFDR+R +F++ILY YQSGGR++RP  VPID+F +E++F+++G++ +E++   EGY K    ++P N  QRK+W L EYP+SS+ AR +A  S+ VI LSI+ FC ET+P     + +N++      +A  ++E D   +S PFF IE +CI+WFT EL++RF S P K+TF  +++N+ID VAI P+F+      AD S+S N +MS A+LRV+RLVRVFR+FKLSRHS GLQILG+T ++SV+E  LL+FF+ I+++LF+S +YFAE     S F SIP +FW+ +VTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:  115 PQRGTPDTSSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNS-----ATAELLDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 506          
BLAST of Potassium voltage gated channel protein vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0346706)

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 301/405 (74.32%), Postives = 347/405 (85.68%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD--------------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
            ERV IN+SGLRFETQL+TL QFP+TLLG+  +R +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELG++AI K+REDEG+IKE+ + LP+N  QRKVWLLFEYPESS  AR VAI SVFVI+LSIVIFC+ETLP FKHY++ N+T  GT     KIEED++P  ++PFF+IET+CIIWFTFEL VRF + P KL F + +MN+IDI+AIIPYFITL TV+A++               +S NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TLKAS+RELGLL+FFL I V+LFSSAVYFAEA +D S+F+SIPD FWWAVVTMTTVGYGDMRPV VWGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+ Q+
Sbjct:   97 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT-----KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSDSSFFKSIPDGFWWAVVTMTTVGYGDMRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQS 496          
BLAST of Potassium voltage gated channel protein vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302903)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 308/444 (69.37%), Postives = 362/444 (81.53%), Query Frame = 2
Query:  413 FNQSMPKYP--DEETP-----------YDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD--------------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
             NQS+PK    DEE             ++ +  + ++  ERV IN+SGLRFETQL+TL QFP+TLLG+  +R +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELG++AI K+REDEG+IKE+ + LP+N  QRKVWLLFEYPESS  AR VAI SVFVI+LSIVIFC+ETLP FKHY++ N+T  GT     KIEED++P  ++PFF+IET+CIIWFTFEL VRF + P KL F + +MN+IDI+AIIPYFITL TV+A++               +S NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TLKAS+RELGLL+FFL I V+LFSSAVYFAEA ++ S+F+SIPDAFWWAVVTMTTVGYGDM PV VWGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+ Q+
Sbjct:   47 LNQSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDF-CERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT-----KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQS 484          
BLAST of Potassium voltage gated channel protein vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089661)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 308/444 (69.37%), Postives = 362/444 (81.53%), Query Frame = 2
Query:  413 FNQSMPKYP--DEETP-----------YDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD--------------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
             NQS+PK    DEE             ++ +  + ++  ERV IN+SGLRFETQL+TL QFP+TLLG+  +R +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELG++AI K+REDEG+IKE+ + LP+N  QRKVWLLFEYPESS  AR VAI SVFVI+LSIVIFC+ETLP FKHY++ N+T  GT     KIEED++P  ++PFF+IET+CIIWFTFEL VRF + P KL F + +MN+IDI+AIIPYFITL TV+A++               +S NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TLKAS+RELGLL+FFL I V+LFSSAVYFAEA ++ S+F+SIPDAFWWAVVTMTTVGYGDM PV VWGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+ Q+
Sbjct:   47 LNQSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDF-CERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT-----KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQS 484          
BLAST of Potassium voltage gated channel protein vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302902)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 308/444 (69.37%), Postives = 362/444 (81.53%), Query Frame = 2
Query:  413 FNQSMPKYP--DEETP-----------YDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD--------------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
             NQS+PK    DEE             ++ +  + ++  ERV IN+SGLRFETQL+TL QFP+TLLG+  +R +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELG++AI K+REDEG+IKE+ + LP+N  QRKVWLLFEYPESS  AR VAI SVFVI+LSIVIFC+ETLP FKHY++ N+T  GT     KIEED++P  ++PFF+IET+CIIWFTFEL VRF + P KL F + +MN+IDI+AIIPYFITL TV+A++               +S NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TLKAS+RELGLL+FFL I V+LFSSAVYFAEA ++ S+F+SIPDAFWWAVVTMTTVGYGDM PV VWGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+ Q+
Sbjct:   47 LNQSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDF-CERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT-----KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQS 484          
BLAST of Potassium voltage gated channel protein vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0308200)

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 308/444 (69.37%), Postives = 362/444 (81.53%), Query Frame = 2
Query:  413 FNQSMPKYP--DEETP-----------YDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD--------------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
             NQS+PK    DEE             ++ +  + ++  ERV IN+SGLRFETQL+TL QFP+TLLG+  +R +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELG++AI K+REDEG+IKE+ + LP+N  QRKVWLLFEYPESS  AR VAI SVFVI+LSIVIFC+ETLP FKHY++ N+T  GT     KIEED++P  ++PFF+IET+CIIWFTFEL VRF + P KL F + +MN+IDI+AIIPYFITL TV+A++               +S NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TLKAS+RELGLL+FFL I V+LFSSAVYFAEA ++ S+F+SIPDAFWWAVVTMTTVGYGDM PV VWGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+ Q+
Sbjct:   47 LNQSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDF-CERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT-----KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQS 484          
BLAST of Potassium voltage gated channel protein vs. Ensembl Zebrafish
Match: kcna2b (potassium voltage-gated channel, shaker-related subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-080204-89])

HSP 1 Score: 503.056 bits (1294), Expect = 1.101e-172
Identity = 300/414 (72.46%), Postives = 337/414 (81.40%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHF--------KHYRI-VNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVI---ADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYN 1696
            ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNV +D+F EEI+FYELGEEAIE +REDEG+IKE+ K+LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F        K YR   NST + T  S Y         F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +   A+D +   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+++ +  K +
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEEKLLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEETDMHKAYRTDSNSTISYT--STY---------FTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPDSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLNVTSVPKID 435          
BLAST of Potassium voltage gated channel protein vs. Ensembl Zebrafish
Match: kcna1a (potassium voltage-gated channel, shaker-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-110408-15])

HSP 1 Score: 494.197 bits (1271), Expect = 3.407e-169
Identity = 293/425 (68.94%), Postives = 337/425 (79.29%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ-FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQ----NQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            ++P +P +  P D          ERV INI+GLRFETQLKTL QFP TLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRP NVP+D+F EEIKFYELG EA+EK+REDEG+I+E+ + LPE  FQR++WLLFE+PESS  AR +AI SV VI++SIVIFC+ETLP  K          G     YK      P   ++PFFIIET+CIIWF+FEL+VRF + P K  FFK +MN IDIVAIIPYFITLGT +A++   +     QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +SYF SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +++ N
Sbjct:   14 AVPGHPQDTYPPDHDDHEC---CERVVINIAGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPANVPLDMFSEEIKFYELGVEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPEGRIKIIGNTTYYYK------PSILADPFFIIETLCIIWFSFELIVRFFACPSKAAFFKNMMNTIDIVAIIPYFITLGTELAEEQDGKEGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKESYFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLNVSN 429          
BLAST of Potassium voltage gated channel protein vs. Ensembl Zebrafish
Match: kcna1a (potassium voltage-gated channel, shaker-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-110408-15])

HSP 1 Score: 494.197 bits (1271), Expect = 3.407e-169
Identity = 293/425 (68.94%), Postives = 337/425 (79.29%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ-FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQ----NQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            ++P +P +  P D          ERV INI+GLRFETQLKTL QFP TLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRP NVP+D+F EEIKFYELG EA+EK+REDEG+I+E+ + LPE  FQR++WLLFE+PESS  AR +AI SV VI++SIVIFC+ETLP  K          G     YK      P   ++PFFIIET+CIIWF+FEL+VRF + P K  FFK +MN IDIVAIIPYFITLGT +A++   +     QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +SYF SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +++ N
Sbjct:   14 AVPGHPQDTYPPDHDDHEC---CERVVINIAGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPANVPLDMFSEEIKFYELGVEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPEGRIKIIGNTTYYYK------PSILADPFFIIETLCIIWFSFELIVRFFACPSKAAFFKNMMNTIDIVAIIPYFITLGTELAEEQDGKEGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKESYFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLNVSN 429          
BLAST of Potassium voltage gated channel protein vs. Ensembl Zebrafish
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 493.426 bits (1269), Expect = 7.955e-169
Identity = 288/405 (71.11%), Postives = 331/405 (81.73%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ-FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD-------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+I+E+ + LP+N FQR++WLLFE+PESS  AR +AI SV VI++SIVIFC+ETLP  K          G +   YK      P   ++PFF++ET+CIIWF+FEL+VRF + P K  FFK +MN ID+V+IIPYFITLGT +A+D            QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+   S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE +++   + + N
Sbjct:   32 ERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPDNEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPQGRLQVIGNSTFYYK------PNILTDPFFVVETLCIIWFSFELIVRFFACPSKPAFFKNMMNTIDVVSIIPYFITLGTEMAEDPEGGKEAKGGGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKDSFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGDEQAQLLTVSN 430          
BLAST of Potassium voltage gated channel protein vs. Ensembl Zebrafish
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 493.426 bits (1269), Expect = 7.955e-169
Identity = 288/405 (71.11%), Postives = 331/405 (81.73%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ-FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD-------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+I+E+ + LP+N FQR++WLLFE+PESS  AR +AI SV VI++SIVIFC+ETLP  K          G +   YK      P   ++PFF++ET+CIIWF+FEL+VRF + P K  FFK +MN ID+V+IIPYFITLGT +A+D            QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+   S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE +++   + + N
Sbjct:   32 ERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPDNEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPQGRLQVIGNSTFYYK------PNILTDPFFVVETLCIIWFSFELIVRFFACPSKPAFFKNMMNTIDVVSIIPYFITLGTEMAEDPEGGKEAKGGGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKDSFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGDEQAQLLTVSN 430          
BLAST of Potassium voltage gated channel protein vs. Ensembl Xenopus
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 514.612 bits (1324), Expect = 2.797e-177
Identity = 298/404 (73.76%), Postives = 340/404 (84.16%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGT-----NQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQ 1687
            ERV INISGLRFETQLKTL QFP+TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPID+F EEI+FYELGEEA+EK+REDEG+I+E+ + LP N FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+     +  ++GT     N +   I       F++PFF++ET+CIIWF+FELLVRF + P K TF K IMN+IDIVAIIPYFITLGT +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+H+G+ Q
Sbjct:   22 ERVVINISGLRFETQLKTLAQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIREEERPLPPNEFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRD----DKEYSGTALPPGNGTGPYISSS----FTDPFFVVETLCIIWFSFELLVRFFACPSKATFCKNIMNIIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLHVGSCQ 417          
BLAST of Potassium voltage gated channel protein vs. Ensembl Xenopus
Match: KCNA1 (potassium channel, voltage gated shaker related subfamily A, member 1 [Source:NCBI gene;Acc:100492822])

HSP 1 Score: 508.064 bits (1307), Expect = 1.753e-174
Identity = 294/398 (73.87%), Postives = 337/398 (84.67%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIG 1678
            ERV IN++GLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+I+E+ + LPE  FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K  RI    F+    ++    + +I  F++PFF++ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT +A+    Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+ D+S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ 
Sbjct:   34 ERVVINVAGLRFETQLKTLSQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPEKEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVIFCLETLPELKDERI----FSRRVNNSTVFYKSNI--FTDPFFVVETLCIIWFSFELVVRFFACPSKPEFFKNIMNFIDIVAIIPYFITLGTEMAEQEGPQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEDESHFASIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVS 425          
BLAST of Potassium voltage gated channel protein vs. Ensembl Xenopus
Match: KCNA2 (potassium channel, voltage gated shaker related subfamily A, member 3 [Source:NCBI gene;Acc:100496794])

HSP 1 Score: 496.893 bits (1278), Expect = 5.602e-170
Identity = 291/408 (71.32%), Postives = 332/408 (81.37%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIP-----QFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEI+FYELGEEA+E +REDEG+IKE+ + LP+N +Q++VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F   R  N    G+  + Y      +       F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D +   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ + +  K
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEIFREDEGFIKEEERPLPDNEYQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVF---RDENEDMHGSGVNYYPYSNSTVRYQKSNTFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKTEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPK 437          
BLAST of Potassium voltage gated channel protein vs. Ensembl Xenopus
Match: ENSXETT00000049277.1 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:NCBI gene;Acc:100492986])

HSP 1 Score: 493.812 bits (1270), Expect = 2.123e-169
Identity = 290/408 (71.08%), Postives = 332/408 (81.37%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYR-------IVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN-QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            ERV INISGLRFETQL+TL QFP TLLG+  KR ++FDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEE IE +R+DEG+IKE+ + LPEN FQR+VWLLFEYPESS  AR +AI SV +I++SIVIFC+ETLP F+           VN T   TN             F++PFF+ ET+CIIWF+FELLVRF + P K  FFK +MN+IDIVAIIPYFITLGT +A+   S   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TL+AS+RELGLL+FFL I VILFSSAVYFAE D  +S F SIPDAFWWAVV+MTTVGYGDM P+T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E++  Y H+   Q+
Sbjct:   14 ERVVINISGLRFETQLRTLSQFPQTLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPVDIFLEEIKFYELGEEVIEIFRDDEGFIKEEERPLPENDFQRQVWLLFEYPESSGPARGIAIVSVLIILISIVIFCLETLPEFREEARQSGGQPAVNGTHTFTNSP-----------FTDPFFLTETLCIIWFSFELLVRFFACPSKPAFFKNMMNVIDIVAIIPYFITLGTELAEQQGSNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPESLFTSIPDAFWWAVVSMTTVGYGDMYPMTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQSQYTHVTCGQQ 410          
BLAST of Potassium voltage gated channel protein vs. Ensembl Xenopus
Match: KCNA5 (potassium channel, voltage gated shaker related subfamily A, member 5 [Source:NCBI gene;Acc:496997])

HSP 1 Score: 485.723 bits (1249), Expect = 1.071e-163
Identity = 283/392 (72.19%), Postives = 327/392 (83.42%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIP--QFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIAD-DSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDK 1657
            +RV INI+GLRFETQL TL QFP+TLLG+  KR ++FDPLRNEYFFDRNRPSFD ILY+YQSGG++RRPVNV IDVF +EI+FYELGEEA+E++REDEG+IK++ K LP N FQR+VWL+FEYPESS  AR +AI SV VI++SI+ FC+ETLP F+     N      ++     +E   P    ++PFFIIET C+IWFTFELLVRF + P K  F K IMN+IDIVAIIPYFITLGT +A   + +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S+F SIPDAFWWAVVTMTTVGYGDMRPVTV GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E++
Sbjct:  169 QRVIINIAGLRFETQLSTLNQFPDTLLGDPEKRMRFFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYELGEEAMERFREDEGFIKDEEKPLPCNEFQRQVWLIFEYPESSSSARGIAIVSVLVILISIITFCLETLPEFRDE---NELPPALSKVLNDTQEHPSPPSGLTDPFFIIETTCVIWFTFELLVRFFACPSKSDFSKNIMNIIDIVAIIPYFITLGTELAQHQTNNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQ 557          
BLAST of Potassium voltage gated channel protein vs. Ensembl Mouse
Match: Kcna1 (potassium voltage-gated channel, shaker-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96654])

HSP 1 Score: 509.605 bits (1311), Expect = 3.097e-175
Identity = 300/427 (70.26%), Postives = 351/427 (82.20%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ----FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            + P +P ++  Y +  ++ +++  ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+IKE+ + LPE  +QR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K     +  F GT    ++I+   +      F++PFFI+ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT IA+   +Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ +
Sbjct:   14 TAPGHP-QDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKD----DKDFTGT---IHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage gated channel protein vs. Ensembl Mouse
Match: Kcna1 (potassium voltage-gated channel, shaker-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96654])

HSP 1 Score: 509.605 bits (1311), Expect = 3.097e-175
Identity = 300/427 (70.26%), Postives = 351/427 (82.20%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ----FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            + P +P ++  Y +  ++ +++  ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+IKE+ + LPE  +QR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K     +  F GT    ++I+   +      F++PFFI+ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT IA+   +Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ +
Sbjct:   14 TAPGHP-QDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKD----DKDFTGT---IHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage gated channel protein vs. Ensembl Mouse
Match: Kcna3 (potassium voltage-gated channel, shaker-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96660])

HSP 1 Score: 510.375 bits (1313), Expect = 5.983e-175
Identity = 294/404 (72.77%), Postives = 336/404 (83.17%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNST-----FAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQ 1687
            ERV INISGLRFETQLKTL QFP TLLG+  +R +YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPID+F EEI+FY+LGEEA+EK+REDEG+++E+ + LP   FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+  +   ++     F   N S           FS+PFF++ET+CIIWF+FELLVRF + P K TF + IMNLIDIVAIIPYFITLGT +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+H+G+ Q
Sbjct:   57 ERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSG-APSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQ 459          
BLAST of Potassium voltage gated channel protein vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 504.597 bits (1298), Expect = 4.264e-173
Identity = 298/422 (70.62%), Postives = 338/422 (80.09%), Query Frame = 2
Query:  452 PYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDI-----PQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            P D     A+++  ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEI+FYELGEEA+E +REDEGYIKE+ + LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F   R  N    G   + +      I       F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D++   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ + +  K
Sbjct:   19 PQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIF---RDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPK 437          
BLAST of Potassium voltage gated channel protein vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 504.597 bits (1298), Expect = 4.264e-173
Identity = 298/422 (70.62%), Postives = 338/422 (80.09%), Query Frame = 2
Query:  452 PYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDI-----PQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQK 1690
            P D     A+++  ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEI+FYELGEEA+E +REDEGYIKE+ + LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F   R  N    G   + +      I       F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D++   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ + +  K
Sbjct:   19 PQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIF---RDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPK 437          
BLAST of Potassium voltage gated channel protein vs. UniProt/SwissProt
Match: sp|P08510|KCNAS_DROME (Potassium voltage-gated channel protein Shaker OS=Drosophila melanogaster OX=7227 GN=Sh PE=1 SV=3)

HSP 1 Score: 531.946 bits (1369), Expect = 1.092e-180
Identity = 300/405 (74.07%), Postives = 347/405 (85.68%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADD--------------SRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
            ERV IN+SGLRFETQL+TL QFP+TLLG+  +R +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELG++AI K+REDEG+IKE+ + LP+N  QRKVWLLFEYPESS  AR VAI SVFVI+LSIVIFC+ETLP FKHY++ N+T  GT     KIEED++P  ++PFF+IET+CIIWFTFEL VRF + P KL F + +MN+IDI+AIIPYFITL TV+A++               +S NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TLKAS+RELGLL+FFL I V+LFSSAVYFAEA ++ S+F+SIPDAFWWAVVTMTTVGYGDM PV VWGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+ Q+
Sbjct:   97 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT-----KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQS 496          
BLAST of Potassium voltage gated channel protein vs. UniProt/SwissProt
Match: sp|Q09470|KCNA1_HUMAN (Potassium voltage-gated channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=KCNA1 PE=1 SV=2)

HSP 1 Score: 510.76 bits (1314), Expect = 9.700e-175
Identity = 300/427 (70.26%), Postives = 351/427 (82.20%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ----FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            + P +P ++  Y +  ++ +++  ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+IKE+ + LPE  +QR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K     +  F GT    ++I+   +      F++PFFI+ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT IA+   +Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ +
Sbjct:   14 AAPGHP-QDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKD----DKDFTGT---VHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage gated channel protein vs. UniProt/SwissProt
Match: sp|P10499|KCNA1_RAT (Potassium voltage-gated channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Kcna1 PE=1 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 2.030e-174
Identity = 300/427 (70.26%), Postives = 351/427 (82.20%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ----FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            + P +P ++  Y +  ++ +++  ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+IKE+ + LPE  +QR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K     +  F GT    ++I+   +      F++PFFI+ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT IA+   +Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ +
Sbjct:   14 AAPGHP-QDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKD----DKDFTGT---IHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage gated channel protein vs. UniProt/SwissProt
Match: sp|P16388|KCNA1_MOUSE (Potassium voltage-gated channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Kcna1 PE=1 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 2.167e-174
Identity = 300/427 (70.26%), Postives = 351/427 (82.20%), Query Frame = 2
Query:  422 SMPKYPDEETPYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQ----FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            + P +P ++  Y +  ++ +++  ERV INISGLRFETQLKTL QFPNTLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELGEEA+EK+REDEG+IKE+ + LPE  +QR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP  K     +  F GT    ++I+   +      F++PFFI+ET+CIIWF+FEL+VRF + P K  FFK IMN IDIVAIIPYFITLGT IA+   +Q   QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +H+ +
Sbjct:   14 TAPGHP-QDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKD----DKDFTGT---IHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage gated channel protein vs. UniProt/SwissProt
Match: sp|P16390|KCNA3_MOUSE (Potassium voltage-gated channel subfamily A member 3 OS=Mus musculus OX=10090 GN=Kcna3 PE=1 SV=3)

HSP 1 Score: 510.375 bits (1313), Expect = 4.185e-174
Identity = 294/404 (72.77%), Postives = 336/404 (83.17%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNST-----FAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQ 1687
            ERV INISGLRFETQLKTL QFP TLLG+  +R +YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPID+F EEI+FY+LGEEA+EK+REDEG+++E+ + LP   FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+  +   ++     F   N S           FS+PFF++ET+CIIWF+FELLVRF + P K TF + IMNLIDIVAIIPYFITLGT +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+H+G+ Q
Sbjct:   57 ERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSG-APSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQ 459          
BLAST of Potassium voltage gated channel protein vs. TrEMBL
Match: A0A267G5S4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000768g3 PE=3 SV=1)

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 343/405 (84.69%), Postives = 372/405 (91.85%), Query Frame = 2
Query:  479 EYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 1693
            +YD ERV IN+SGLRFETQLKTL QFP+TLLGN+ KRN+Y+DPLRNEYFFDRNRPSFDAILY+YQSGGRLRRPVNVPIDVF EEI+FYELGEEAIEKYR+DEG+IKE++K+LPEN FQRKVWLLFEYPESSM AR +AI SV VI+LSIVIFC+ETLPHF+ Y++VNS+F  T      IEEDDIPQF EPFFIIET+CI+WFTFEL+VRF+SSPEKL FFK IMN IDIVAIIPYFITLGTVIADDSRS NQAMSLAILRVIRLVRVFRIFKLSRH KGLQILGQTLKASVRELGLLVFFL ISVILFSSAVYFAEAD+ KS+F SIP AFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTY+H+ +   Y
Sbjct:   25 DYDCERVVINVSGLRFETQLKTLNQFPDTLLGNSQKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFSEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPENEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCVETLPHFRRYKVVNSSFGNTTYGQV-IEEDDIPQFGEPFFIIETICIVWFTFELMVRFASSPEKLGFFKNIMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLKASVRELGLLVFFLFISVILFSSAVYFAEADSTKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHVQSCPSY 427          
BLAST of Potassium voltage gated channel protein vs. TrEMBL
Match: A0A1I8JAN4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 343/405 (84.69%), Postives = 372/405 (91.85%), Query Frame = 2
Query:  479 EYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 1693
            +YD ERV IN+SGLRFETQLKTL QFP+TLLGN+ KRN+Y+DPLRNEYFFDRNRPSFDAILY+YQSGGRLRRPVNVPIDVF EEI+FYELGEEAIEKYR+DEG+IKE++K+LPEN FQRKVWLLFEYPESSM AR +AI SV VI+LSIVIFC+ETLPHF+ Y++VNS+F  T      IEEDDIPQF EPFFIIET+CI+WFTFEL+VRF+SSPEKL FFK IMN IDIVAIIPYFITLGTVIADDSRS NQAMSLAILRVIRLVRVFRIFKLSRH KGLQILGQTLKASVRELGLLVFFL ISVILFSSAVYFAEAD+ KS+F SIP AFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTY+H+ +   Y
Sbjct:   70 DYDCERVVINVSGLRFETQLKTLNQFPDTLLGNSQKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFSEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPENEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCVETLPHFRRYKVVNSSFGNTTYGQV-IEEDDIPQFGEPFFIIETICIVWFTFELMVRFASSPEKLGFFKNIMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLKASVRELGLLVFFLFISVILFSSAVYFAEADSTKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHVQSCPSY 472          
BLAST of Potassium voltage gated channel protein vs. TrEMBL
Match: A0A267G5V4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003232g2 PE=3 SV=1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 345/411 (83.94%), Postives = 376/411 (91.48%), Query Frame = 2
Query:  467 GENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEAD-ADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYN 1696
            G  A  D ERV IN+SGLRFETQLKTL QFP +LLG+ LKRN+Y+DPLRNEYFFDRNRPSFDAILY+YQSGGRLRRPVNVPIDVF EEI+FYELGEEAIEKYR+DEG+IKE++K+LPE+ FQRKVWLLFEYPESSM AR +AI SV VI+LSIVIFC+ETLPHF+HY++VN TF   N +++ IEEDDIPQF EPFF+IET+CIIWFTFELLVRF+SSPEKL FFK +MN IDIVAIIPYFITLGTVIADDSRS NQAMSLAILRVIRLVRVFRIFKLSRH KGLQILGQTL+ASVRELGLLVFFLLISVILFSSAVYFAEAD A KS+F SIP AFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTY+HI +   Y+
Sbjct:   95 GAAASSDCERVVINVSGLRFETQLKTLAQFPESLLGDPLKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFTEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPEDEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCMETLPHFRHYKVVNDTFG--NVTSHAIEEDDIPQFDEPFFVIETICIIWFTFELLVRFASSPEKLAFFKNMMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLRASVRELGLLVFFLLISVILFSSAVYFAEADSALKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHIQSCPAYS 502          
BLAST of Potassium voltage gated channel protein vs. TrEMBL
Match: A0A1I8I8A4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 329/405 (81.23%), Postives = 359/405 (88.64%), Query Frame = 2
Query:  479 EYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 1693
            +YD ERV IN+SGLRFETQLKTL QFP+TLLGN+ KRN+Y+DPLRNEYFFDRNRPSFDAILY+YQSGGRLRRPVNVPIDVF EEI+FYELGEEAIEKYR+DEG+IKE++K+LPEN FQRKVWLLFEYPESSM AR +AI SV VI+LSIVIFC+ETLPHF+ Y++VNS+F  T      IEEDDIPQF EPFFIIET+CI+WFTFEL+VRF+SSPEKL FFK IMN IDIVAIIPYFITLGTVIADDSRS NQAMSLA            I +LSRH KGLQILGQTLKASVRELGLLVFFL ISVILFSSAVYFAEAD+ KS+F SIP AFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTY+H+ +   Y
Sbjct:   70 DYDCERVVINVSGLRFETQLKTLNQFPDTLLGNSQKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFSEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPENEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCVETLPHFRRYKVVNSSFGNTTYGQV-IEEDDIPQFGEPFFIIETICIVWFTFELMVRFASSPEKLGFFKNIMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLA------------ILRLSRHFKGLQILGQTLKASVRELGLLVFFLFISVILFSSAVYFAEADSTKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHVQSCPSY 460          
BLAST of Potassium voltage gated channel protein vs. TrEMBL
Match: A0A267H5C2 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009376g1 PE=3 SV=1)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 343/408 (84.07%), Postives = 374/408 (91.67%), Query Frame = 2
Query:  476 AEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEAD-ADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYN 1696
            A  D ERV IN+SGLRFETQLKTL QFP +LLG+ LKRN+Y+DPLRNEYFFDRNRPSFDAILY+YQSGGRLRRPVNVPIDVF EEI+FYELGEEAIEKYR+DEG+IKE++K+LPE+ FQRKVWLLFEYPESSM AR +AI SV VI+LSIVIFC+ETLPH++HY++VN TF   N +++ IEEDDIPQF EPFF+IET+CIIWFTFELLVRF+SSPEKL FFK +MN IDIVAIIPYFITLGTVIADDSRS NQAMSLAILRVIRLVRVFRIFKLSRH KGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEAD A KS+F SIP AFWWAVVTMTTVGYGDM PVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTY+HI +   Y+
Sbjct:   98 ASSDCERVVINVSGLRFETQLKTLAQFPESLLGDPLKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFTEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPEDEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCMETLPHYRHYKVVNDTFG--NVTSHAIEEDDIPQFGEPFFVIETICIIWFTFELLVRFASSPEKLAFFKNMMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADSALKSHFDSIPSAFWWAVVTMTTVGYGDMLPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHIQSCPAYS 502          
BLAST of Potassium voltage gated channel protein vs. Ensembl Cavefish
Match: kcna2b (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103039676])

HSP 1 Score: 501.13 bits (1289), Expect = 6.226e-172
Identity = 295/406 (72.66%), Postives = 336/406 (82.76%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRI-VNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYN 1696
            ERV INISGLRFETQLKTL QFP+TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNV +D+F EEI+FYELGEEAIE +REDEG+IKE+ K LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F++  I +  T+ G + S           F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D +   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+++ +  K +
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEIFREDEGFIKEEEKPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDDIDMRKTYPGNSNSTTSYTST---YFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTELAESPEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEADSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLNVTSVPKID 434          
BLAST of Potassium voltage gated channel protein vs. Ensembl Cavefish
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:NCBI gene;Acc:103031324])

HSP 1 Score: 499.975 bits (1286), Expect = 4.307e-171
Identity = 293/406 (72.17%), Postives = 337/406 (83.00%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIP----QFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYN 1696
            ERV INISGLRFETQLKT  QFP+TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPIDVF EEI+FY+LGEEA+EK+REDEG+IKE+ + LP   FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+  R   +  A    +A  +     P     F++PFF+IET+CI+WF+FELLVRF + P K TF K IMN+IDIVAIIPYFITLGT +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET+ E+    ++ G++++ +
Sbjct:   68 ERVVINISGLRFETQLKTFSQFPDTLLGDPRKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDVFSEEIRFYQLGEEAMEKFREDEGFIKEEERPLPSREFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDDREAAAAAA-AAAAAVPLNNGTAPYGPGAFTDPFFVIETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPASSFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDGEEHAQCLNAGSSERVD 472          
BLAST of Potassium voltage gated channel protein vs. Ensembl Cavefish
Match: kcna2a (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103030675])

HSP 1 Score: 497.278 bits (1279), Expect = 1.630e-170
Identity = 290/411 (70.56%), Postives = 332/411 (80.78%), Query Frame = 2
Query:  452 PYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVI---ADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHI 1675
            P D  GE  +   ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNV +D+F EEI+FYELGEEAIE +REDEG+IKE+ + LP+N FQ++VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F+              ++          F++PFFI+ET+CIIWF+FE LVRF + P K +FF  IMN+ID+VAIIPYFITLGT +   A+D +   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+ +
Sbjct:   19 PQDYDGEAEQECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDE--EEMHKVRTYNSNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQV 427          
BLAST of Potassium voltage gated channel protein vs. Ensembl Cavefish
Match: ENSAMXT00000027012.2 (potassium voltage-gated channel subfamily A member 2-like [Source:NCBI gene;Acc:103027793])

HSP 1 Score: 497.664 bits (1280), Expect = 5.000e-170
Identity = 297/420 (70.71%), Postives = 336/420 (80.00%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFK-------HYRIVNSTFAGTNQSAYKIE-----EDDIPQ------FSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIAD---DSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQ 1687
            ERV INISGLRFETQLKTL QFP TLLG+  KR  YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPIDVF EEI+FYELGEEA+EK+REDEG+IKE+ + LP   FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+         R+  +     N    ++         +P       FS+PFF++ET+CI+WF+FELLVRF + P K TF K IMN+IDIVAIIPYFITLGT +A+    +    QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+H+ + Q
Sbjct:   76 ERVVINISGLRFETQLKTLAQFPETLLGDPRKRTAYFDPLRNEYFFDRNRPSFDAILYYYQSGGRVRRPVNVPIDVFTEEIRFYELGEEAMEKFREDEGFIKEEERALPAGEFQRQVWLLFEYPESSGPARGIAIVSVLVILVSIVIFCLETLPEFRDDDSDVTRDRVGTTPLHMLNHYPNEMHGHGNLTGGLPPILSGTPFSDPFFVVETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQQGNGGGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPDSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLHVASCQ 495          
BLAST of Potassium voltage gated channel protein vs. Ensembl Cavefish
Match: kcna1a (potassium voltage-gated channel subfamily A member 1 [Source:NCBI gene;Acc:103039047])

HSP 1 Score: 487.263 bits (1253), Expect = 1.440e-166
Identity = 293/429 (68.30%), Postives = 342/429 (79.72%), Query Frame = 2
Query:  419 QSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFK-----HYRIV-NSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN----QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHI 1675
             ++P +P +  P D    +     ERV INI+GLRFET+LKTL QFP TLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRP +VP+D+F EEIKFYELG EA+EK+REDEG+I+E  + LPE  FQR++WLLFE+PESS  AR +AI SV VI++SIVIFC+ETLP  K     H +I+ NSTF       YK         ++PFFI+ET+CIIWF+FEL+VRF + P K  FFK +MN ID+VAIIPYFITLGT +A+D  +++    QA SLAILRVIRLVRVFRIFKLSRHSKGLQILG TLKAS+RELGLLVFFL I VILFSSAVYFAEA+   SYF SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +++
Sbjct:   13 SAVPGHPQDTYPPDHDDHDC---CERVVINIAGLRFETELKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPASVPLDMFSEEIKFYELGYEAMEKFREDEGFIREKERPLPEAEFQRQIWLLFEHPESSGPARGIAIVSVTVILVSIVIFCLETLPQLKENPEGHIQIIGNSTF------YYKPS-----LLTDPFFIVETLCIIWFSFELIVRFLACPSKAAFFKDMMNTIDVVAIIPYFITLGTELAEDPNNKDGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGLTLKASMRELGLLVFFLFIGVILFSSAVYFAEAEEADSYFGSIPDAFWWAVVSMTTVGYGDMVPVTIGGKVVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAKLLNV 427          
BLAST of Potassium voltage gated channel protein vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 509.605 bits (1311), Expect = 4.101e-176
Identity = 296/398 (74.37%), Postives = 336/398 (84.42%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFA-GTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            ER+ IN+SGLRFETQLK+L QFP+TLLGN  KR++YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNV IDVF EEIKFYELG EA+ K++EDEG+IKE+ K LP + FQR+VWLLFEYPESS  AR +AI SV VI++SI+IFC+ETLP F+  +      A   N +  KI       F++PFFI+ET+CIIWF+FELLVRF + P K  FFK+IMN+IDIVAI+PYFITLGT +A    S  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S FRSIPDAFWWAVVTMTTVGYGDMRPVTV GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRET++E+   Y+H+ +
Sbjct:   28 ERIVINVSGLRFETQLKSLDQFPDTLLGNPSKRSRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVSIDVFSEEIKFYELGNEAMAKFQEDEGFIKEEEKPLPSDEFQRQVWLLFEYPESSNPARGIAIVSVLVILISIIIFCLETLPEFRDEKEQKFLPAKDINGTQVKIMHGS--SFTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLGTEMAKHQGSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDNEEHANYLHVSS 423          
BLAST of Potassium voltage gated channel protein vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 487.649 bits (1254), Expect = 3.030e-167
Identity = 280/397 (70.53%), Postives = 329/397 (82.87%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHI 1675
            ERV IN+SGLRFETQL+TL QFP+TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPV+VP D+F EE++FY+LGEE + +YREDEGY+KE  K LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SI+IFC+ETLP F+    +      TN + Y         F++PFFI+ET+CIIWF+FEL+VRF + P K+ F K +MN+IDIVAI+PYFITLGT +A+ + S N  Q MSLAILRVIRLVRVFRIFKLSRHSKGLQILG TL AS+RELGLL+FFL I VILFSSAV+FAE D+ K+ F+SIPDAFWW++VTMTTVGYGDM P TV GK+VGSLCAIAGVLT++LPVPVIVSNFNYFY RETE ED+  Y H+
Sbjct:   38 ERVVINVSGLRFETQLRTLAQFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVSVPYDIFTEEVRFYDLGEETMLRYREDEGYVKEPEKPLPENEFQRQVWLLFEYPESSSPARAIAIVSVLVILISIIIFCLETLPEFRDDADLYKVSYYTNGTHYFYHN----VFADPFFIMETICIIWFSFELMVRFCACPSKVEFGKNLMNIIDIVAIVPYFITLGTEMAEQTGSANGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGHTLHASMRELGLLIFFLFIGVILFSSAVFFAEVDSKKTEFQSIPDAFWWSLVTMTTVGYGDMSPKTVGGKIVGSLCAIAGVLTVSLPVPVIVSNFNYFYQRETEGEDQTVYSHV 430          
BLAST of Potassium voltage gated channel protein vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 439.499 bits (1129), Expect = 1.181e-149
Identity = 262/388 (67.53%), Postives = 306/388 (78.87%), Query Frame = 2
Query:  533 QLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHF----------KHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGT-VIADDSRSQN--QAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDK 1657
            QL+TL  FP+TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQS G+LRRP NVP D+F EE++FYELGEE + +YREDEGY+KE+ K LPEN  QR+VWLLFEYPESS  AR +AI SV VI++SIVIF  ETLP F          +H             ++           ++PFFI+ETVCI+WF+FELLVRF + P K  FFK IMN IDIVAI+PYFITLGT + A D+ + N  Q MSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTL+AS+RELGLL+FFL I VILFSSA+YFAE D   ++F SIP+AFWW++VTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHR +E+E++
Sbjct:    1 QLRTLAHFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSRGKLRRPTNVPYDIFAEEVRFYELGEETMARYREDEGYVKEEEKPLPENALQRQVWLLFEYPESSNPARVIAIVSVLVIVISIVIFVAETLPEFRDDKDLHSGTRHDVGAGDAAVAAAGNSSGGSSGGGSGHADPFFIVETVCIVWFSFELLVRFCACPSKPGFFKNIMNTIDIVAIMPYFITLGTELAAQDTGANNGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVILFSSAIYFAEVDDPNTHFHSIPEAFWWSLVTMTTVGYGDMFPVTLGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRGSEAEEQ 388          
BLAST of Potassium voltage gated channel protein vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 367.081 bits (941), Expect = 6.150e-122
Identity = 221/397 (55.67%), Postives = 289/397 (72.80%), Query Frame = 2
Query:  485 DIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIV--NSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYI 1669
            D++RV IN+SG RFETQLKTL QFP++LLG+  KR +YFDPL+NEYFFDR+  +FDAIL+YYQSGGRL +PV+VP DVF EE++FYELGEEA+ KY E+     E+  +  ++ FQ+ VW LFE  + S+ A+ +++ S    ILSI + C+ETLP F+    V  N T      S Y +         +PFF++ET C++WF FEL VRF + P K +F K  MN IDI+AI+PYFI   TV+ +  + Q+Q     +L++IRLVRV RIFKLSRH + LQILG TLKAS+REL +L FFL ++V++FS A+Y+ EAD  + +F SIPDAFWWAVVTMT VGYGDM P+TV GK+VG+LCAI GVLTI+LPVPVIVSNF YFY+   +++D + YI
Sbjct:    3 DLQRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHGKD-FQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNL---------DPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFI---TVVLEIMQQQDQTRQ-PLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN--LKNKDIKIYI 383          
BLAST of Potassium voltage gated channel protein vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 363.614 bits (932), Expect = 1.541e-120
Identity = 217/394 (55.08%), Postives = 284/394 (72.08%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIV--NSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTY 1666
            +RV IN+SG RFETQLKTL QFP++LLG+  KR +YFDPL+NEYFFDR+  +FDAIL+YYQSGGRL +PV+VP DVF EE++FYELGEEA+ KY E+     E+  +  ++ FQ+ VW LFE  + S+ A+ +++ S    ILSI + C+ETLP F+    V  N T      S Y ++         PFF++ET C++WF FEL VRF + P K +F K  MN IDI+AI+PYFIT   V+ +  + Q+Q     +L++IRLVRV RIFKLSRH + LQILG TLKAS+REL +L FFL ++V++FS A+Y+ EAD  + +F SIPDAFWWAVVTMT VGYGDM P+TV GK+VG+LCAI GVLTI+LPVPVIVSNF YFY+ + +   +  +
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHGKD-FQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNLD---------PFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFIT---VVLEIMQQQDQTRQ-PLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYNLKNKDIKRSAF 380          
BLAST of Potassium voltage gated channel protein vs. Ensembl Nematostella
Match: SHAK4 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB6])

HSP 1 Score: 411.764 bits (1057), Expect = 2.799e-138
Identity = 252/396 (63.64%), Postives = 310/396 (78.28%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKH-----YRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
            +R+ IN+SGL+FET ++TL   P+TLLGNA+KR +Y+D +RNEYFFDRNRP+FDAIL+YYQSGG+L RP NVP+DVF +EI+FYELG++ + K  ++EGYI+E+  ILPEN  QR++W LFE+P++SM AR VAI SVFVI LSIV FCIETLP F+      Y  VN T    +            +F +P+F +ET CIIWFTFE ++R  SSP+KL F ++ +N+IDIVAI+PY+ITL            +A SL +LRVIRLVRVFRIFKLSRHS+GLQILG TL+AS+RELGLL+FFLLI VILFSSAVY+AE     ++F+SIPDAFWWAVVTMTTVGYGDMRP+TVWGK+VGSLCAI+GVLTIALPVPVIVSNFNYFYHRE E    + 
Sbjct:   58 DRILINVSGLKFETHVQTLESNPDTLLGNAVKRAKYYDSVRNEYFFDRNRPAFDAILFYYQSGGKLLRPANVPMDVFADEIRFYELGDDVLHKVEQEEGYIEEEKPILPENKLQRQIWQLFEFPDTSMPARFVAIFSVFVITLSIVTFCIETLPQFQKKEEDLYVSVNGTLVPVDN-----------RFDQPWFSMETACIIWFTFEYIMRLISSPQKLIFIRSFLNMIDIVAILPYYITL-------PMQDTKASSLGVLRVIRLVRVFRIFKLSRHSRGLQILGHTLRASLRELGLLIFFLLIGVILFSSAVYYAEGGEKGTHFKSIPDAFWWAVVTMTTVGYGDMRPITVWGKIVGSLCAISGVLTIALPVPVIVSNFNYFYHRENEQRAAEA 435          
BLAST of Potassium voltage gated channel protein vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 359.762 bits (922), Expect = 7.092e-119
Identity = 231/396 (58.33%), Postives = 296/396 (74.75%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNST-----FAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQT 1663
            +R+ IN+SGLRFET   TL QFPNTLLG+  KR +YFD   +EYFFDRNR +F+AIL++YQS G+L RP  VP  +F +E+ F++LG++ +++  E+EGYI+E  ++LP +  QR++W LFEYP+SSMGAR +A+ SV VI++SIV+FCIETLP F+     +         GTN +A   +  +  + S  +  +E +CI WFT E +VR  SSP+KL F ++ +N+ID++AI+PY+ITL      D R      SLA+LRVIRLVRVFRIFKLSRHS+GLQ+LG TL+AS REL +L+FFLLISV+LFSSAVY+AE +   S F SIPDAFWWAVVTMTTVGYGDM PVT WGKLVGS+CAI+GVLTIALPVPVIVSNFNYFY RE  S   + 
Sbjct:    1 KRIIINVSGLRFETYEATLAQFPNTLLGSESKREEYFDSDADEYFFDRNRSTFEAILFFYQSNGKLVRPSGVPFLLFKDEVIFFKLGKDNLKRLEEEEGYIEETTRVLPRHHLQRRIWELFEYPDSSMGARVLAVWSVSVILISIVVFCIETLPTFRCKTSPDGNGCPKLLPGTNSTA---DHPEPVEKSSAWLALEILCIAWFTLEYVVRLLSSPQKLLFVRSFLNVIDLMAILPYYITLPM---KDLR----ITSLAVLRVIRLVRVFRIFKLSRHSRGLQVLGHTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAASKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIVSNFNYFYKREQLSSSMEA 386          
BLAST of Potassium voltage gated channel protein vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 329.717 bits (844), Expect = 1.980e-107
Identity = 213/384 (55.47%), Postives = 276/384 (71.88%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADK-SYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1639
            +R+TINISGLR+ET  KTL +FP +LLG   +R+ ++D + +EYFFDRNR  F++IL YYQ+ G L RP N+P  VF  +IK+++LGE+A+ +  +D      +I+ +P+N FQR VW LFE+P++S GAR +AI SV VI+LSIV+FC+ETLP F+            N     I  D+ P+ S  FF IE+ CI WFT E  +RF  SP+K  F  +++NLID+VAI+P+FITL               SLAILR +RLVRVFRIFKLSR+S+GLQILG TLKAS+RELGLL FFL + VILFSSAVY+AE + ++ + F SIP +FWW+++TMTTVGYGDM P T+ GKLVG  CAI+GVL IALPVPVIVSNF Y+Y RE
Sbjct:    1 KRITINISGLRYETFDKTLERFPESLLGCKSRRDDFYDSVNDEYFFDRNRLCFESILAYYQTCGVLIRPPNIPRKVFVSDIKYFDLGEQALRQAGDDLEITDREIRPMPKNKFQRTVWSLFEHPDTSNGARAIAIFSVAVIVLSIVLFCVETLPQFQR----RPKEVLRNNITETIMIDN-PKKSV-FFAIESFCIAWFTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLPMT------EPTSVSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILFSSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIVSNFAYYYSRE 372          
BLAST of Potassium voltage gated channel protein vs. Ensembl Nematostella
Match: SHAK1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK44])

HSP 1 Score: 311.227 bits (796), Expect = 3.290e-100
Identity = 203/391 (51.92%), Postives = 275/391 (70.33%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKE-DIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQ 1660
            E + IN+SG RFET  +TL +FP+TLLG   +R ++ +  + EYFFDR+R +FDAILYYYQ+GG L RP +VP  VF  E+ FY+L EEA++  + D G   E + K+LP+N + R VW   EYPE S  A+ +AI SV VI+LS++IFC+ETLP F    +     A  +   +K  +D    + E +F + T  I+WFT E ++R   SPEKL F    +N+ID+++I+PY++ L    A DS S     S+++LRV+R+VRVFR+FKLSRHS+GLQILG TL+AS+ EL +L+FFL I V++F+S VY+AE   D S FRSIP +FWWAVVTMTTVGYGD+ P + WGK+VG+LCAI+GVLTIALPVPVIVSNF  FY++E     ++
Sbjct:    1 EPIVINVSGKRFETYEETLARFPDTLLGCPARRAKFLNNKKGEYFFDRHRSAFDAILYYYQAGGSLIRPEHVPPHVFINEVIFYDLPEEALQSVQLDAGIADEPEEKVLPKNQYLRYVWETLEYPEYSKLAKFLAIFSVVVIVLSLIIFCVETLPEFMPQEVTKPKNATAD---WKPPKDP---YEETWFQLNTFVIVWFTAEYILRLICSPEKLKFLLAALNIIDLLSILPYYVQL----ALDSGSS----SISVLRVVRVVRVFRVFKLSRHSRGLQILGNTLRASMNELMMLMFFLFIGVMIFASCVYYAEGGID-SPFRSIPHSFWWAVVTMTTVGYGDISPESFWGKIVGALCAISGVLTIALPVPVIVSNFENFYNKEINRRKEE 376          
BLAST of Potassium voltage gated channel protein vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 310.842 bits (795), Expect = 4.727e-100
Identity = 201/385 (52.21%), Postives = 265/385 (68.83%), Query Frame = 2
Query:  494 RVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYRE---DEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYF-RSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHR 1636
            RVT+N+SG R++T ++TL +FP TLLG+  KR +YFDP  NEYFFDRN+  F+ ILY+YQS GRL  P ++  ++  EE++F++LGE AI   +E   DE    E  + +P N  Q + W LFEY +SS  AR +A+ SV +I+ SI + C+ETLP+F    I +       +   K  E  I      F  +E   I WFT E LVRF SSP+K  F ++ +N+IDI+AI+P++I L   I +  +S +  +SLA LR++RLVRVFRIFKLSRHS GLQILG TL+ S+RELGLL+FFL I V++FSS  Y+AEA    ++  RSIPD FWWA+VTMTTVGYGD+ P T+WGKLVGS CA+ GVL IALPVPVIVSNF+  Y +
Sbjct:    1 RVTLNVSGFRYQTYVETLDKFPTTLLGDPAKRREYFDPDLNEYFFDRNKQVFEIILYFYQSNGRLVCPPDLAPEILLEEVEFFDLGETAINAVKELLTDEEP-DETPRDMPTNKIQTQFWNLFEYADSSKAARVIALFSVSIIVASIAVLCVETLPNFAILPIHDPNNTEEVRRVNKHNEGAILA-RRWFGYLEAAFIAWFTLEYLVRFLSSPKKCPFVRSFLNVIDILAIVPFYIDL---ILNSVQSNDGTLSLAFLRILRLVRVFRIFKLSRHSSGLQILGLTLRKSLRELGLLIFFLFIGVVIFSSMAYYAEAGTKDTHLGRSIPDTFWWALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIVSNFDAIYKK 380          
BLAST of Potassium voltage gated channel protein vs. Ensembl Medaka
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3-like [Source:NCBI gene;Acc:105354379])

HSP 1 Score: 516.538 bits (1329), Expect = 1.659e-177
Identity = 300/399 (75.19%), Postives = 335/399 (83.96%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQ 1687
            ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGR+RRPVNVPID+F EEI+FYELGEEA+EK+REDEG+IKE+ + LPEN FQR+VWLLFEYPESS  AR VAI SV VI++SIVIFC+ETLP F+       T A             I  FS+PFF++ET+CIIWF+FELLVRF + P K TF K IMN+IDIVAI+PYFITLGT +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD   S F SIPDAFWWAVVTMTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+H+G+ Q
Sbjct:   74 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIKEEERPLPENEFQRQVWLLFEYPESSGPARGVAIVSVLVILISIVIFCLETLPEFRDENNDVITLAPVINGTVPY---FISPFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSKNIMNIIDIVAIVPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLHVGSCQ 469          
BLAST of Potassium voltage gated channel protein vs. Ensembl Medaka
Match: ENSORLT00000010657.2 (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:101157775])

HSP 1 Score: 503.442 bits (1295), Expect = 6.623e-173
Identity = 293/412 (71.12%), Postives = 340/412 (82.52%), Query Frame = 2
Query:  452 PYDKVGENAEYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIA---DDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHI 1675
            P D+ G   ++D  ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDR+RPSFDAILYYYQSGGRLRRPVNV +D+F EEI+FYELGEEA+E +REDEG+I+E+ + LPEN FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F++     S++   + S      D    F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +A   +D +S  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S F SIP+AFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y+++
Sbjct:   19 PNDQYGPETDHDCCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRHRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAMEIFREDEGFIREEERPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEEDPYSSYQVMSNSTTTF--DSSTYFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTELAERPEDGQSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEKQSQFSSIPEAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLNL 428          
BLAST of Potassium voltage gated channel protein vs. Ensembl Medaka
Match: ENSORLT00000025729.2 (shaker-related potassium channel tsha2 [Source:NCBI gene;Acc:101167693])

HSP 1 Score: 497.278 bits (1279), Expect = 8.326e-171
Identity = 289/401 (72.07%), Postives = 330/401 (82.29%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 1693
            ERV INISGLRFETQLKTL QFP TLLG+  KR ++FDPLRNEYFFDRNRPSFDAI+YYYQSGGRLRRPVNVP+D+F EEIKFYELGEE IE ++EDEG+IKE+ + LPE+ FQR+VWLLFEYPESS  AR +AI SV VI++SIVIFC+ETLP F+            N +A     D    F++PFFI+ET+CIIWF+FELLVRF + P K  FFK IMN IDIVAI+PYFITLG  +A+   +  QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILG+TL+AS+RELGLL+FFL I VILFSSAVYFAE D   S F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  Y H+   Q++
Sbjct:   36 ERVVINISGLRFETQLKTLAQFPATLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAIVYYYQSGGRLRRPVNVPVDIFMEEIKFYELGEEVIENFKEDEGFIKEEERPLPEHEFQRQVWLLFEYPESSGAARGIAIVSVLVILISIVIFCLETLPEFREDARDLEAQPYVNGTA---SADRANPFTDPFFIVETLCIIWFSFELLVRFLACPSKPAFFKNIMNTIDIVAIMPYFITLGLELAEHQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPHSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEHEEQFQYTHVTCGQQH 433          
BLAST of Potassium voltage gated channel protein vs. Ensembl Medaka
Match: kcna1b (potassium voltage-gated channel subfamily A member 1-like [Source:NCBI gene;Acc:101167438])

HSP 1 Score: 497.278 bits (1279), Expect = 1.895e-170
Identity = 290/403 (71.96%), Postives = 331/403 (82.13%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQ------NQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGN 1681
            ERV INISGLRFETQLKTL QFP TLLGN  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+D+F EEIKFYELG EA+EK+REDEG+I+E+ + LPE  FQR++WLLFE+PESS  AR +AI SV VI++SIVIFC+ETLP  K          G     YK        F++PFF++ET+CIIWF+FEL+VRF + P K  FFK +MN IDIVAIIPYFITLGT +ADD  ++       QA SLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEA+  +S+F SIPDAFWWAVV+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++   +++ N
Sbjct:   36 ERVVINISGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGAEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPNDRIQVVGNGTIYYKAN-----FFTDPFFVVETLCIIWFSFELIVRFFACPSKAAFFKNMMNSIDIVAIIPYFITLGTELADDQDNKEGKAGGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEDKESFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLNVSN 433          
BLAST of Potassium voltage gated channel protein vs. Ensembl Medaka
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 494.197 bits (1271), Expect = 1.441e-169
Identity = 293/406 (72.17%), Postives = 330/406 (81.28%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHF--------KHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIAD---DSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHI 1675
            ERV INISGLRFETQLKTL QFP TLLG+  KR +YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNV +D+F EEI+FYELGEEAIE +REDEG+IKE+ + LP+N FQR+VWLLFEYPESS  AR +AI SV VI++SIV FC+ETLP F        K +  V S    T   +Y         F++PFFI+ET+CIIWF+FE LVRF + P K  FF  IMN+IDIVAIIPYFITLGT +AD   D +   QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKAS+RELGLL+FFL I VILFSSAVYFAEAD  +S F SIPDAFWWAVV+MTTVGYGDM P T+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE E++  ++ +
Sbjct:   29 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDEDDMHKSHAKVFSPETNTTIISYTST-----YFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTELADRPEDGQPGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFESIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQFLQV 429          
BLAST of Potassium voltage gated channel protein vs. Planmine SMEST
Match: SMESG000020672.1 (SMESG000020672.1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 521/521 (100.00%), Postives = 521/521 (100.00%), Query Frame = 2
Query:  317 TIHYASNTKPTSSTNIDIGLYHQQMFDYRSHTFNQSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYNXXXXXXXXXXXXXXXLDNCNMLKYSTAIQPLIEPNKQANHIPRQTSVELSKRYDRTVETDV 1879
            TIHYASNTKPTSSTNIDIGLYHQQMFDYRSHTFNQSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYNSEHESSESKNSSSGSLDNCNMLKYSTAIQPLIEPNKQANHIPRQTSVELSKRYDRTVETDV
Sbjct:    3 TIHYASNTKPTSSTNIDIGLYHQQMFDYRSHTFNQSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYNSEHESSESKNSSSGSLDNCNMLKYSTAIQPLIEPNKQANHIPRQTSVELSKRYDRTVETDV 523          
BLAST of Potassium voltage gated channel protein vs. Planmine SMEST
Match: SMESG000020672.1 (SMESG000020672.1)

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 501/521 (96.16%), Postives = 505/521 (96.93%), Query Frame = 2
Query:  317 TIHYASNTKPTSSTNIDIGLYHQQMFDYRSHTFNQSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYNXXXXXXXXXXXXXXXLDNCNMLKYSTAIQPLIEPNKQANHIPRQTSVELSKRYDRTVETDV 1879
            TI  + NTKP+ S      + H   F  +SHTFNQSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYNSEHESSESKNSSSGSLDNCNMLKYSTAIQPLIEPNKQANHIPRQTSVELSKRYDRTVETDV
Sbjct:    3 TIQLSCNTKPSGS------MPHNDFFYEKSHTFNQSMPKYPDEETPYDKVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYNSEHESSESKNSSSGSLDNCNMLKYSTAIQPLIEPNKQANHIPRQTSVELSKRYDRTVETDV 517          
BLAST of Potassium voltage gated channel protein vs. Planmine SMEST
Match: SMESG000061194.1 (SMESG000061194.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 319/394 (80.96%), Postives = 353/394 (89.59%), Query Frame = 2
Query:  494 RVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHI 1675
            R+ INISGL+FET L TL  FPNTLLGN +KRN+++D LRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVP+DVF EEIKFYELGEEAI+KYREDEGY KE++K+LPEN FQR+VWLLFEYPESS  ARCVAI SVFVI+LSIVIFC+ETLPHFK+Y+++N T    +    + EEDDIP+F+EPFF+IET CI+WFTFELLVRF+SSP KL FFK IMNLIDIVAIIPYFITLGT + DD+R  NQ  SLAILRVIRLVRVFRIFKLSRHS GLQILGQTLKAS RELGLL+FFLLI VILFSSAVYFAEAD D++ FRSIPDAFWWAVVTMTTVGYGDM PVT+WGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +DKQTY+H+
Sbjct:   66 RIVINISGLKFETHLHTLSTFPNTLLGNPMKRNRFYDALRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPMDVFMEEIKFYELGEEAIDKYREDEGYNKEEVKVLPENEFQRRVWLLFEYPESSTSARCVAILSVFVIVLSIVIFCVETLPHFKYYKMINKTTHSDSVQQIEFEEDDIPKFTEPFFVIETCCIVWFTFELLVRFASSPRKLDFFKNIMNLIDIVAIIPYFITLGTALVDDTRRSNQTTSLAILRVIRLVRVFRIFKLSRHSTGLQILGQTLKASTRELGLLIFFLLICVILFSSAVYFAEADCDQTLFRSIPDAFWWAVVTMTTVGYGDMHPVTIWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRENEIDDKQTYVHV 459          
BLAST of Potassium voltage gated channel protein vs. Planmine SMEST
Match: SMESG000069004.1 (SMESG000069004.1)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 299/403 (74.19%), Postives = 352/403 (87.34%), Query Frame = 2
Query:  491 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRI--VNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 1693
            ER+ IN+SGLRFET+LKTL QFPNTLLGN +KRN+Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV ++VF EEI FYELGEEAIEKYR++EG++KE++K+LP N  Q+++WLL EYPESSM A+ VAI SV VI+LSIVIFC+ETLP+F+ YR+  VNST   +N   Y IEE+DIP F+EPFFIIET+CIIWF+FELL+RF+SSP+KL F K IMN+ID V+I+PYFITLGT++ D+ +SQNQA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFLLI VILFSSA YF EAD + +YFRSIPD FWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E+++KQ YIH+ +   Y
Sbjct:   76 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFVAIISVLVIVLSIVIFCVETLPNFRQYRVKPVNST--DSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSY 476          
BLAST of Potassium voltage gated channel protein vs. Planmine SMEST
Match: SMESG000053970.1 (SMESG000053970.1)

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 292/404 (72.28%), Postives = 348/404 (86.14%), Query Frame = 2
Query:  485 DIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAXXXXXXXXXXXXXXXXETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASVRELGXXXXXXXXXXXXXXXAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKYN 1696
            D ER+ IN+SGL FET L T+ ++PNTLLG+  KRN+Y+D ++NEYFFDRNR SFD+ILY+YQS GRLRRPVNVPID+F EEI+F+ELG+EAI++YR++EG++KE +K+LPEN  QRKVWLLFEYPESSM AR VAI SV VI++SI+IFC+ETLP F++YRI+N T +       ++EE+ IP+FSEPFFIIET CI+WFTFELL+RFSS+PEK  FFK IMNLIDIVAI+PYFITLGT +  D+ + NQA SLAILRVIRLVRVFRIFKLSRHSKGLQ+LG+TLKAS +ELGLL+FFLLI VILFSSAVYF E+D D ++FRSIPD FWWAVVTMTTVGYGDM PVT+WGKLVGSLCAIAGVLTIALPVPVIVSNFNYFY+RET  +D+Q Y+ + N    N
Sbjct:   16 DKERLIINVSGLIFETYLSTINRYPNTLLGDENKRNKYYDAVKNEYFFDRNRLSFDSILYFYQSQGRLRRPVNVPIDIFMEEIRFFELGQEAIDQYRDNEGFVKEQVKLLPENEMQRKVWLLFEYPESSMSARFVAIISVTVIVMSIIIFCVETLPVFRNYRIINKTISTDPDDTIEVEEESIPRFSEPFFIIETCCIVWFTFELLIRFSSAPEKFGFFKNIMNLIDIVAIMPYFITLGTALVSDNGTSNQATSLAILRVIRLVRVFRIFKLSRHSKGLQVLGKTLKASTQELGLLIFFLLICVILFSSAVYFVESDTDGTFFRSIPDGFWWAVVTMTTVGYGDMHPVTMWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYNRETGLDDQQVYVQLANGDSNN 419          
The following BLAST results are available for this feature:
BLAST of Potassium voltage gated channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA12.020e-17570.26potassium voltage-gated channel subfamily A member... [more]
KCNA32.945e-17472.41potassium voltage-gated channel subfamily A member... [more]
KCNA21.688e-17370.62potassium voltage-gated channel subfamily A member... [more]
KCNA21.688e-17370.62potassium voltage-gated channel subfamily A member... [more]
KCNA21.688e-17370.62potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shk-13.146e-10749.88Potassium voltage-gated channel protein shk-1 [So... [more]
shk-13.146e-10749.88Potassium voltage-gated channel protein shk-1 [So... [more]
shk-16.291e-10749.88Potassium voltage-gated channel protein shk-1 [So... [more]
shk-12.157e-10649.88Potassium voltage-gated channel protein shk-1 [So... [more]
shk-18.588e-10649.88Potassium voltage-gated channel protein shk-1 [So... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh0.000e+074.32gene:FBgn0003380 transcript:FBtr0346706[more]
Sh0.000e+069.37gene:FBgn0003380 transcript:FBtr0302903[more]
Sh0.000e+069.37gene:FBgn0003380 transcript:FBtr0089661[more]
Sh0.000e+069.37gene:FBgn0003380 transcript:FBtr0302902[more]
Sh0.000e+069.37gene:FBgn0003380 transcript:FBtr0308200[more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b1.101e-17272.46potassium voltage-gated channel, shaker-related su... [more]
kcna1a3.407e-16968.94potassium voltage-gated channel, shaker-related su... [more]
kcna1a3.407e-16968.94potassium voltage-gated channel, shaker-related su... [more]
kcna1b7.955e-16971.11potassium voltage-gated channel, shaker-related su... [more]
kcna1b7.955e-16971.11potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA32.797e-17773.76potassium voltage-gated channel subfamily A member... [more]
KCNA11.753e-17473.87potassium channel, voltage gated shaker related su... [more]
KCNA25.602e-17071.32potassium channel, voltage gated shaker related su... [more]
ENSXETT00000049277.12.123e-16971.08potassium channel, voltage gated shaker related su... [more]
KCNA51.071e-16372.19potassium channel, voltage gated shaker related su... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcna13.097e-17570.26potassium voltage-gated channel, shaker-related su... [more]
Kcna13.097e-17570.26potassium voltage-gated channel, shaker-related su... [more]
Kcna35.983e-17572.77potassium voltage-gated channel, shaker-related su... [more]
Kcna24.264e-17370.62potassium voltage-gated channel, shaker-related su... [more]
Kcna24.264e-17370.62potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08510|KCNAS_DROME1.092e-18074.07Potassium voltage-gated channel protein Shaker OS=... [more]
sp|Q09470|KCNA1_HUMAN9.700e-17570.26Potassium voltage-gated channel subfamily A member... [more]
sp|P10499|KCNA1_RAT2.030e-17470.26Potassium voltage-gated channel subfamily A member... [more]
sp|P16388|KCNA1_MOUSE2.167e-17470.26Potassium voltage-gated channel subfamily A member... [more]
sp|P16390|KCNA3_MOUSE4.185e-17472.77Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G5S40.000e+084.69BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8JAN40.000e+084.69BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267G5V40.000e+083.94BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8I8A40.000e+081.23BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5C20.000e+084.07BTB domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b6.226e-17272.66potassium voltage-gated channel subfamily A member... [more]
KCNA34.307e-17172.17potassium voltage-gated channel subfamily A member... [more]
kcna2a1.630e-17070.56potassium voltage-gated channel subfamily A member... [more]
ENSAMXT00000027012.25.000e-17070.71potassium voltage-gated channel subfamily A member... [more]
kcna1a1.440e-16668.30potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA34.101e-17674.37potassium voltage-gated channel subfamily A member... [more]
KCNA33.030e-16770.53potassium voltage-gated channel subfamily A member... [more]
KCNA31.181e-14967.53potassium voltage-gated channel subfamily A member... [more]
kcna1b6.150e-12255.67potassium voltage-gated channel, shaker-related su... [more]
kcna1b1.541e-12055.08potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
SHAK42.799e-13863.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK37.092e-11958.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK61.980e-10755.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK13.290e-10051.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK54.727e-10052.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.659e-17775.19potassium voltage-gated channel subfamily A member... [more]
ENSORLT00000010657.26.623e-17371.12potassium voltage-gated channel subfamily A member... [more]
ENSORLT00000025729.28.326e-17172.07shaker-related potassium channel tsha2 [Source:NCB... [more]
kcna1b1.895e-17071.96potassium voltage-gated channel subfamily A member... [more]
kcna2a1.441e-16972.17potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage gated channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020672.10.000e+0100.00SMESG000020672.1[more]
SMESG000020672.10.000e+096.16SMESG000020672.1[more]
SMESG000061194.10.000e+080.96SMESG000061194.1[more]
SMESG000069004.10.000e+074.19SMESG000069004.1[more]
SMESG000053970.10.000e+072.28SMESG000053970.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002046 ID=SMED30002046|Name=Potassium voltage gated channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2025bp
TACATTTCATCTTTGCTGTTACTACTTTTAACGAATCCCTGGCTAGCCCG
TATTGAGTAGATACCTGTTATAAAAAAAAGAAAAAAAAACAAGCTATAAT
TATATAGCATGTTTGACAATCTTCGTGTGATATTATAGCAATGATGCCCT
GATTTTTTCGTATTTTTCTAATTGATGATTGCAACATTTTCATTTCCCAG
TCTCGTTGATATATAGCATCGCTGTGATGTCATCTATTTCAACAGTTATT
TGCACCAGAATAGAGTTTCCCATTCATGTTTGCAGTTGATAGAAGTCAAA
TTCGTCGAACATGAACACGATCCACTATGCCAGTAATACCAAGCCAACTT
CATCTACAAACATTGACATTGGACTTTATCATCAGCAAATGTTCGATTAT
CGATCTCACACTTTTAATCAGTCAATGCCAAAGTATCCTGATGAAGAAAC
GCCTTACGATAAAGTCGGTGAAAATGCCGAATACGACATAGAAAGAGTGA
CAATTAACATAAGCGGTCTCCGATTTGAAACACAGTTGAAAACTTTGGGT
CAATTTCCAAACACTCTTTTGGGAAATGCTTTAAAACGAAATCAGTATTT
TGATCCGTTAAGAAATGAATATTTTTTCGACAGAAACCGACCAAGTTTCG
ATGCCATTTTGTATTATTATCAAAGCGGTGGTAGGCTTCGAAGACCGGTA
AATGTTCCAATTGATGTATTTTGTGAGGAGATAAAATTTTACGAGTTAGG
AGAAGAAGCTATTGAAAAATATCGAGAAGATGAAGGGTATATAAAAGAAG
ACATAAAGATTCTTCCAGAAAATCCTTTTCAACGAAAGGTTTGGTTACTT
TTTGAATATCCAGAGAGTTCAATGGGAGCCAGATGCGTAGCGATATGCTC
AGTCTTTGTGATAATATTATCTATTGTAATATTTTGTATTGAAACCTTGC
CTCATTTTAAACATTATCGGATCGTAAACTCAACGTTTGCCGGAACAAAT
CAGTCAGCCTACAAGATCGAAGAAGATGATATACCTCAGTTTTCTGAACC
ATTTTTTATTATTGAAACTGTATGTATAATTTGGTTTACGTTTGAGTTGT
TAGTTCGGTTTTCTTCCTCTCCAGAGAAATTAACTTTCTTTAAAACAATA
ATGAATTTGATAGATATTGTGGCCATTATTCCATATTTTATTACTCTTGG
TACTGTTATCGCTGATGACAGCCGAAGCCAAAATCAAGCCATGTCCTTAG
CAATACTAAGGGTCATTCGACTAGTTCGAGTATTCAGGATATTTAAGCTT
TCTCGGCATTCCAAAGGCCTACAAATTTTGGGCCAGACCTTAAAAGCCAG
TGTCAGAGAACTTGGATTACTTGTTTTCTTTCTATTAATAAGTGTAATTT
TATTTTCAAGTGCTGTTTACTTTGCCGAAGCTGATGCTGATAAATCATAT
TTCCGAAGTATTCCCGACGCTTTCTGGTGGGCGGTAGTGACAATGACTAC
CGTTGGCTATGGAGACATGAGGCCGGTGACGGTTTGGGGGAAACTGGTTG
GGAGTCTCTGTGCAATAGCAGGAGTGTTAACGATTGCACTTCCTGTTCCG
GTCATTGTCTCGAATTTCAATTACTTTTATCACCGAGAAACTGAATCAGA
AGACAAACAAACTTATATTCACATTGGAAATAATCAGAAATACAATTCCG
AACACGAAAGTAGTGAATCGAAAAATTCATCATCTGGAAGTTTAGATAAC
TGTAATATGCTCAAATACTCAACTGCCATTCAGCCTCTCATTGAACCAAA
TAAGCAAGCAAATCACATTCCTAGACAAACGTCTGTAGAATTGTCAAAGC
GCTATGACAGAACAGTAGAAACAGATGTGTAAAAATGTTCTTTTTTCCAT
TTCTTCCAGTTCTCAAATGCATTTGTATTTACACTAATAATGTATCGCAC
TTTATTCTTCGGCTTTTGCAAAATTCTTATTCAAAAAATTATGACCTTCA
TTCAAAAGTCGTTTATGAGATCCAC
back to top

protein sequence of SMED30002046-orf-1

>SMED30002046-orf-1 ID=SMED30002046-orf-1|Name=SMED30002046-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=524bp
MNTIHYASNTKPTSSTNIDIGLYHQQMFDYRSHTFNQSMPKYPDEETPYD
KVGENAEYDIERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPL
RNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEA
IEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFV
IILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFI
IETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVI
ADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRE
LGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGY
GDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQ
TYIHIGNNQKYNSEHESSESKNSSSGSLDNCNMLKYSTAIQPLIEPNKQA
NHIPRQTSVELSKRYDRTVETDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR003972K_chnl_volt-dep_Kv1
IPR000210BTB/POZ_dom
IPR003131T1-type_BTB
IPR005821Ion_trans_dom
IPR027359Volt_channel_dom_sf
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 184..212
score: 48.42
coord: 250..273
score: 54.77
coord: 276..296
score: 59.2
coord: 381..403
score: 80.01
coord: 410..436
score: 77.28
coord: 103..122
score: 65.82
coord: 321..347
score: 73.84
coord: 350..373
score: 61.86
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 60..160
e-value: 1.6E-37
score: 129.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 334..444
e-value: 5.8E-36
score: 124.5
NoneNo IPR availablePANTHERPTHR11537:SF28POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY A MEMBER 3coord: 45..475
NoneNo IPR availableCDDcd18407BTB_POZ_KCNA6coord: 61..187
e-value: 3.03653E-69
score: 216.017
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 190..437
NoneNo IPR availableTMHMMTMhelixcoord: 279..301
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 248..267
NoneNo IPR availableTMHMMTMhelixcoord: 412..434
NoneNo IPR availableTMHMMTMhelixcoord: 193..215
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 421..432
score: 86.18
coord: 103..113
score: 73.26
coord: 326..334
score: 85.28
coord: 350..364
score: 56.72
IPR003972Potassium channel, voltage dependent, Kv1PRINTSPR01496SHAKERCHANELcoord: 204..215
score: 78.46
coord: 147..158
score: 72.56
coord: 104..114
score: 98.0
coord: 181..197
score: 70.59
coord: 90..101
score: 63.21
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 61..155
e-value: 3.3E-8
score: 43.3
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 192..443
e-value: 3.9E-47
score: 160.6
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 63..153
e-value: 4.6E-28
score: 97.4
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 161..333
e-value: 1.5E-54
score: 186.0
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 45..475
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 61..157