Calsyntenin 1

Overview
NameCalsyntenin 1
Smed IDSMED30002038
Length (bp)3075
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calsyntenin 1 (SMED30002038) t-SNE clustered cells

Violin plots show distribution of expression levels for Calsyntenin 1 (SMED30002038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calsyntenin 1 (SMED30002038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calsyntenin 1 (SMED30002038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002038SMESG000078417.1 Contig3071GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002038SMESG000002830.1 PL05013A1F11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002038SMESG000002830.1 Contig3071GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002038SMESG000002834.1 SMESG000002830.1 Contig48897newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002038SMESG000002834.1 SMESG000002830.1 Contig48897uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v6_1518_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002038SMESG000002834.1 SMESG000002830.1 dd_Smed_v4_1518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN2 (calsyntenin 2 [Source:HGNC Symbol;Acc:HGNC:17448])

HSP 1 Score: 192.971 bits (489), Expect = 9.852e-50
Identity = 170/583 (29.16%), Postives = 268/583 (45.97%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPH-----FSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSFNIF--FTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG------GYRFSFSYVSVENTFDN-TNYLFGKRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINT 1798
            ++ G + EN   V L+P L  +  +  +  + EIC   IH +     PF   + +K  G  +++ K  ++  +L   YTF I+ YDC   PH      S K  V +++  VN   P F E +Y   V     EG     I ++ A +     Q SQ    IC Y+I+  + VPF ID+ G++ +T+K+ Y  +    Y+  V A DC + +P     LV VDV+  C   W+   K I+Y   SG MPLF      PS+H+  C     S  I        +GK         C  +  S    + LC A SG ++LL  +P +  +   G         F F         D         +F++T WMKHG +  +   K+ ILCNSD   MNRHH ++++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P +I   +LTVG+C+        ++ Q F G LA + +    +E+   + CL  C E L + + +E+L +            +++   +I ++     K+SYIN+
Sbjct:   47 SYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQ---ELPFEAVVLNKTSGEGRLRAKSPID-CELQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVT----EGKIYDSILQVEAIDEDCSPQYSQ----ICNYEIVTTD-VPFAIDRNGNIRNTEKLSY--DKQHQYEILVTAYDCGQ-KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF------PSIHLETCDGAVSSLQIVTELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLP-SPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDF--DQADTFRPAEFHWK-LDQICDKEWHYYVINVEFPVVTLYMDGATYEP---YLVTNDWPIHPSHI-AMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDI-NSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS 590          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 188.348 bits (477), Expect = 3.088e-48
Identity = 215/810 (26.54%), Postives = 346/810 (42.72%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN--ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMK--------DHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKS-----NE--------------YTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
             + G + EN+  V L+P L I L ++  +  + EICG  IH +     PF   + DK  G   I+ K+ ++  +L   Y+F I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG +   I   E      S Q +Q IC Y+I+    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + ++ +CT  W+G    I+Y   +G + +F      P++H+ + +    ++  T  +   +I       C  D  S      LC A +G   LL     S+         +       F F+        D    +  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+LI L R +   SE+ K+ P+E+ +  L QVCD EWHHY + +   +  L +DG    +P  V  +  L   P  I  T+L VG+C+   S     NE               TQ F G+LAG+ L    +     + CL TC E L L  ++E   +   +      ++  +   ++ +L      +SY+N+      P    R   IT  + I+C   A             +++ E   ISL  +   ++     E  E +      R ++        +   V+ +  G  D  + +S +   I + L                ES    +       I   ++  G+ F GV ++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   41 TYHGIVTENDNTVLLDPPL-IALDKDAPLRFAGEICGFKIHGQN---VPFDAVVVDKSTGEGVIRSKEKLD-CELQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVI----EGKQYDSILRVEAVDADCSPQFSQ-ICSYEII-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKR-ATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVF------PNIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQDP--SEEKKYRPAEFHWK-LNQVCDEEWHHYVLNVEFPSVTLYVDG-TSHEPFSVTEDYPLH--PSKIE-TQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDL-QVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIIS-------TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLD-RKFKLICSELNGRYISNEFKVEVNVI 803          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 186.422 bits (472), Expect = 1.406e-47
Identity = 215/819 (26.25%), Postives = 346/819 (42.25%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRII-------LAEN----ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMK--------DHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKS-----NE--------------YTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
             + G + EN+  V L+P L  +        AE+    ++   EICG  IH +     PF   + DK  G   I+ K+ ++  +L   Y+F I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG +   I   E      S Q +Q IC Y+I+    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + ++ +CT  W+G    I+Y   +G + +F      P++H+ + +    ++  T  +   +I       C  D  S      LC A +G   LL     S+         +       F F+        D    +  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+LI L R +   SE+ K+ P+E+ +  L QVCD EWHHY + +   +  L +DG    +P  V  +  L   P  I  T+L VG+C+   S     NE               TQ F G+LAG+ L    +     + CL TC E L L  ++E   +   +      ++  +   ++ +L      +SY+N+      P    R   IT  + I+C   A             +++ E   ISL  +   ++     E  E +      R ++        +   V+ +  G  D  + +S +   I + L                ES    +       I   ++  G+ F GV ++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   41 TYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIHGQN---VPFDAVVVDKSTGEGVIRSKEKLD-CELQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVI----EGKQYDSILRVEAVDADCSPQFSQ-ICSYEII-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKR-ATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVF------PNIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQDP--SEEKKYRPAEFHWK-LNQVCDEEWHHYVLNVEFPSVTLYVDG-TSHEPFSVTEDYPLH--PSKIE-TQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDL-QVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIIS-------TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLD-RKFKLICSELNGRYISNEFKVEVNVI 813          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 157.918 bits (398), Expect = 5.307e-39
Identity = 163/633 (25.75%), Postives = 271/633 (42.81%), Query Frame = 2
Query:  584 ICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMK--------DHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            IC Y+I+    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + ++ +CT  W+G    I+Y   +G + +F      P++H+ + +    ++  T  +   +I       C  D  S      LC A +G   LL     S+         +       F F+        D    +  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+LI L R +   SE+ K+ P+E+ +  L QVCD EWHHY + +   +  L +DG    +P  V  +  L   P  I  T+L VG+C+       TQ F G+LAG+ L    +     + CL TC E L L  ++E   +   +      ++  +   ++ +L      +SY+N+      P    R   IT  + I+C   A             +++ E   ISL  +   ++     E  E +      R ++        +   V+ +  G  D  + +S +   I + L                ES    +       I   ++  G+ F GV ++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   19 ICSYEII-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKRA-TEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVF------PNIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQDP--SEEKKYRPAEFHWK-LNQVCDEEWHHYVLNVEFPSVTLYVDG-TSHEPFSVTEDYPLH--PSKIE-TQLVVGACWQGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDL-QVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIIS-------TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLD-RKFKLICSELNGRYISNEFKVEVNVI 614          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN3 (calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371])

HSP 1 Score: 144.436 bits (363), Expect = 2.249e-34
Identity = 156/557 (28.01%), Postives = 237/557 (42.55%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLK-GAPDSMKDHQIGGYRFSFSY-VSVENTFDNTNYL-----------------FGKRFSLTFWMKHGNMLLNDPKQQ--ILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCY----------HSKSNEYTQN--------FFGHLAGMRLIRDFVEAVNTVRCLATCGESL 1666
            + G + EN+  V LNP L  +  +  + ++ EICG  +H    S  PF   I DK  G   I+ K+ V+  +    +TF I+ YDC + P       S K  V V +  VN   P F+E  Y   V     EG     I   E      S Q +Q IC Y+IL  N+ PF ID  G++ +T+K++Y  +  R YKF V A DC K +       V + V+ +C   W+G  K I+Y   +G + LF      P + + + +   +NI  T  +   ++       C  D  S      LC A +G V+LL    P++   +   G    +S   S+   F+ T  +                     F+L+FWMKHG       K++  I+CN+        H S+ +H C++  L       +   KF+   W+   L QVCD+EWHHY + +      L  DG   S  P ++ +  L   P       L +G+C+             S + TQ         F G+LAG  +    +E+   + CL  C E L
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAKEPVD-CEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVT----EGKLYDRILRVEAIDGDCSPQYSQ-ICYYEILTPNT-PFLIDNDGNIENTEKLQY--SGERLYKFTVTAYDCGKKR-AADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF------PGIRLETCDEPLWNIQATIELQTSHVAKG----CDRDNYSERALRKLCGAATGEVDLLPMPGPNA---NWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVKFL---WK---LEQVCDDEWHHYALNLEFPTVTLYTDG--ISFDPALIHDNGLIHPPRREPA--LMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGL 553          
BLAST of Calsyntenin 1 vs. Ensembl Celegans
Match: casy-1 (CAlSYntenin/Alcadein homolog; Calsyntenin [Source:UniProtKB/TrEMBL;Acc:G5ED46])

HSP 1 Score: 160.999 bits (406), Expect = 5.843e-40
Identity = 159/607 (26.19%), Postives = 264/607 (43.49%), Query Frame = 2
Query:  116 IGVKDGWAFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDIL-PVNSVPFFIDKYGSLHT-QKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSG---VMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLL-KGAPDSMKDHQI---GGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKH--GNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMN---DGNPILQIDGEIW---SKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQ 1873
            I ++     +  + E+E I+   P+  I+     S +  +C   +  +     PF  ++ DK  G+  +++KD          Y  Q++   CD     SE   + + +   N   P      Y F V             ++ +  G      PN  IC+Y+I   +  +PF I+ +G L T Q + +  +  ++Y   V A DC   + +  S LV V V + C      + + + Y    G   ++P  S++       +C    +   I   A  V +         C  D    ++    C   +  V LL + A  S  ++QI    G  F  +   V  + +N   L    F+L+F MKH  G       KQ ILC SD   MNRHH SV++ +CKL +++R E G +    F  +EWR+  + +VCDNEWH Y +  N   D N I  +DG+ +    + PE+L +  L K     T T+L VG+C+H +  +  Q F G L+ + L+   VE+   ++C  TC E L    + E L +  S T   D   + +++     +  M  +++Y+NT    EKP      R   ++TE+ C+
Sbjct:   29 INLQGAEELVAVVREDENIISTVPDFAIL-----SETGPVCNYLLTSQNNEPVPFDIQVVDKYTGAAVLRVKDAATLDCKKPEYNLQVQAVKCDNDNVKSEGVSLKIRVKDTNNHAPEIENPWYTFHVEEGKVVEEVGVLKASDKDCG-----HPNGEICEYEITNGLKELPFAINNHGVLRTTQPLNFTQS--KSYILTVVAIDCAMRKSK--SSLVTVHVDEKCVQGITAMNERVNYAPGVGSKLLLPDVSLEFCEKET-ICEPKSVQSVIELRAGHVTQG--------CARDTVYDNQTIQSCGLSTATVKLLNEEALTSSAENQILADQGIEFDGAR-GVTVSDENHQGLIPDHFTLSFSMKHAAGTKDEQSNKQNILCESDDFNMNRHHFSVYIRHCKLEVVLRREAGATSD--FRAAEWRWS-MPEVCDNEWHSYSLLFNGIDDVNVI--VDGKSFKADERNPEILDDWPLHKT--KATKTKLVVGACWHGRQQKLAQFFRGQLSSLYLLSGAVESERAIKCAHTCPEQLQFTGVDE-LLESQSATFSPDQTSLTLKAETSKQIGQMLKRVAYVNTQ---EKPAPG--HRVFLVETEVTCK 598          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0333700)

HSP 1 Score: 150.984 bits (380), Expect = 9.464e-37
Identity = 156/609 (25.62%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQG-ICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSG-VMPLFSMQSTSPSLHVCSSNCLS---FNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDP-KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPI-LQIDG-------EIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDS---------SVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIK 1891
            ++ G + ENE +V++ P +++       +  +IC  +I  + Y   PF  E+ +   G ++ +   N    +    Y F+I    CD  P  +   ++ V   +   P FLE SY   V+    EG    EI   E     +   P  G +CKY+IL  N  PF ID  GS+ +T+ + +       +   V A DC   +   A ++V + VR  C   + G+P+ I Y   S   + LF     +  L +C  +C +     I  +  +  K+I F     C  D+++    + + D         K          I  +  S   V      D+ ++       LT +  +  + +N   K+ I+C++D   MNRHH ++F+ NC+LI L+R      + + F P+EWR+  + +VCDNEWHHY + + D + + L IDG       E     PEV+ +  L     +   T L +G+CY S  N     F G ++ +++  + V     ++C  TC E LL P  +++  + S         ++ M   Y+  +  N +D++    K+ YINT    +KP      R+I + T + C+  + ++
Sbjct:   45 SYHGLIRENETLVEITPLIKV-------NEEKICNFHILKKPYHEIPFKIELVNN-LGILKARRTLN---CENRKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVD----EGRLYNEILRVE--ASDKDCTPLFGDVCKYEILN-NDEPFSIDNEGSIKNTEPLSH--KASHNHILSVVAYDCAMKES--APIMVSIKVRRVCETKFVGMPERIDYTSGSTESLQLFP----NARLDLCDISCKNEEDLRIHSSIALKTKHISFG----CDRDISNCTSGQKVKDLLPHGAEWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWK-IPEVCDNEWHHYVLNVEDSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHA--AHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAK--NKHDIEQFMRKVQYINTK---QKPTVG--RRNIEVLTTLNCKNESSLR 613          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0089207)

HSP 1 Score: 150.599 bits (379), Expect = 1.143e-36
Identity = 156/609 (25.62%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQG-ICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSG-VMPLFSMQSTSPSLHVCSSNCLS---FNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDP-KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPI-LQIDG-------EIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDS---------SVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIK 1891
            ++ G + ENE +V++ P +++       +  +IC  +I  + Y   PF  E+ +   G ++ +   N    +    Y F+I    CD  P  +   ++ V   +   P FLE SY   V+    EG    EI   E     +   P  G +CKY+IL  N  PF ID  GS+ +T+ + +       +   V A DC   +   A ++V + VR  C   + G+P+ I Y   S   + LF     +  L +C  +C +     I  +  +  K+I F     C  D+++    + + D         K          I  +  S   V      D+ ++       LT +  +  + +N   K+ I+C++D   MNRHH ++F+ NC+LI L+R      + + F P+EWR+  + +VCDNEWHHY + + D + + L IDG       E     PEV+ +  L     +   T L +G+CY S  N     F G ++ +++  + V     ++C  TC E LL P  +++  + S         ++ M   Y+  +  N +D++    K+ YINT    +KP      R+I + T + C+  + ++
Sbjct:   45 SYHGLIRENETLVEITPLIKV-------NEEKICNFHILKKPYHEIPFKIELVNN-LGILKARRTLN---CENRKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVD----EGRLYNEILRVE--ASDKDCTPLFGDVCKYEILN-NDEPFSIDNEGSIKNTEPLSH--KASHNHILSVVAYDCAMKES--APIMVSIKVRRVCETKFVGMPERIDYTSGSTESLQLFP----NARLDLCDISCKNEEDLRIHSSIALKTKHISFG----CDRDISNCTSGQKVKDLLPHGAEWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWK-IPEVCDNEWHHYVLNVEDSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHA--AHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAK--NKHDIEQFMRKVQYINTK---QKPTVG--RRNIEVLTTLNCKNESSLR 613          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0089208)

HSP 1 Score: 150.599 bits (379), Expect = 1.143e-36
Identity = 156/609 (25.62%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQG-ICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSG-VMPLFSMQSTSPSLHVCSSNCLS---FNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDP-KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPI-LQIDG-------EIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDS---------SVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIK 1891
            ++ G + ENE +V++ P +++       +  +IC  +I  + Y   PF  E+ +   G ++ +   N    +    Y F+I    CD  P  +   ++ V   +   P FLE SY   V+    EG    EI   E     +   P  G +CKY+IL  N  PF ID  GS+ +T+ + +       +   V A DC   +   A ++V + VR  C   + G+P+ I Y   S   + LF     +  L +C  +C +     I  +  +  K+I F     C  D+++    + + D         K          I  +  S   V      D+ ++       LT +  +  + +N   K+ I+C++D   MNRHH ++F+ NC+LI L+R      + + F P+EWR+  + +VCDNEWHHY + + D + + L IDG       E     PEV+ +  L     +   T L +G+CY S  N     F G ++ +++  + V     ++C  TC E LL P  +++  + S         ++ M   Y+  +  N +D++    K+ YINT    +KP      R+I + T + C+  + ++
Sbjct:   45 SYHGLIRENETLVEITPLIKV-------NEEKICNFHILKKPYHEIPFKIELVNN-LGILKARRTLN---CENRKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVD----EGRLYNEILRVE--ASDKDCTPLFGDVCKYEILN-NDEPFSIDNEGSIKNTEPLSH--KASHNHILSVVAYDCAMKES--APIMVSIKVRRVCETKFVGMPERIDYTSGSTESLQLFP----NARLDLCDISCKNEEDLRIHSSIALKTKHISFG----CDRDISNCTSGQKVKDLLPHGAEWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWK-IPEVCDNEWHHYVLNVEDSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHA--AHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAK--NKHDIEQFMRKVQYINTK---QKPTVG--RRNIEVLTTLNCKNESSLR 613          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0345193)

HSP 1 Score: 150.599 bits (379), Expect = 1.143e-36
Identity = 156/609 (25.62%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQG-ICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSG-VMPLFSMQSTSPSLHVCSSNCLS---FNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDP-KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPI-LQIDG-------EIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDS---------SVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIK 1891
            ++ G + ENE +V++ P +++       +  +IC  +I  + Y   PF  E+ +   G ++ +   N    +    Y F+I    CD  P  +   ++ V   +   P FLE SY   V+    EG    EI   E     +   P  G +CKY+IL  N  PF ID  GS+ +T+ + +       +   V A DC   +   A ++V + VR  C   + G+P+ I Y   S   + LF     +  L +C  +C +     I  +  +  K+I F     C  D+++    + + D         K          I  +  S   V      D+ ++       LT +  +  + +N   K+ I+C++D   MNRHH ++F+ NC+LI L+R      + + F P+EWR+  + +VCDNEWHHY + + D + + L IDG       E     PEV+ +  L     +   T L +G+CY S  N     F G ++ +++  + V     ++C  TC E LL P  +++  + S         ++ M   Y+  +  N +D++    K+ YINT    +KP      R+I + T + C+  + ++
Sbjct:   45 SYHGLIRENETLVEITPLIKV-------NEEKICNFHILKKPYHEIPFKIELVNN-LGILKARRTLN---CENRKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVD----EGRLYNEILRVE--ASDKDCTPLFGDVCKYEILN-NDEPFSIDNEGSIKNTEPLSH--KASHNHILSVVAYDCAMKES--APIMVSIKVRRVCETKFVGMPERIDYTSGSTESLQLFP----NARLDLCDISCKNEEDLRIHSSIALKTKHISFG----CDRDISNCTSGQKVKDLLPHGAEWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWK-IPEVCDNEWHHYVLNVEDSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHA--AHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAK--NKHDIEQFMRKVQYINTK---QKPTVG--RRNIEVLTTLNCKNESSLR 613          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 219.935 bits (559), Expect = 9.736e-59
Identity = 232/836 (27.75%), Postives = 368/836 (44.02%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN--ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSF--NIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFSYVSVENTFDNT-NYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESL--LLPHIVEALAK------DSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTG--AIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWEST-------------NWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIG 2467
             + G + EN+  V L+P L I L ++  + ++ EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G++ +T+K+ Y     R YK  V A DC K +     VLV ++++ +C   W+G  K I+Y   +G + LF      PS+H+  C     S   +I      +GK         C  D  S      LC A SG V LL  AP +  +  +G     G+     F F+        +   +    + F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+L+LL+R E   +E + + P+E+ +  L QVCD EWHHY + +      L +DG  +    E  +  +   L  +   T+LT+G+C+   S   TQ F G+LAG+ +    +E    + CL TC E L   LP  V +  K       SS+++  D       +I   + +   +SY+N+      P      R + + T ++C             G   +++ E   ISL  I+  ++     E  E +      R V+    +               D  + ++ +   I + L   E T                +       +   +++ G+V  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +NE  V+V +    ++T   +D   +    P    QV HA  D  G
Sbjct:   38 TYHGIVTENDDKVLLDPPL-IALDKDAPLRYAGEICGFRIHGQN---VPFEAVVLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATV----IEGKKYDSIMKVEAVDADCSFQFSQ-ICSYEIVTPD-VPFTIDKDGNIKNTEKLNY--GKERMYKLTVTAYDCGKNRAS-EDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF------PSMHLETCEEPITSIQASIMLETNHIGKG--------CDRDTYSEKSLHKLCGASSGTVELLP-APSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWMRHGPG--GREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQE--PTESESYKPAEFHW-KLDQVCDKEWHHYVLNIEFPAVTLFVDGGTF----EPFLVTEDYPLHTSKIETQLTIGACWQGGSARMTQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGD-------DIESFEKVMQHISYLNSRQFP-TPGI----RHLRVSTTVKCFNEETCISVPDSEGYVMVLQPEEPKISLSGIDHFARGAAEFESVEGVTLFPELRIVSTITREVEVEAEAETEAEGEDDPTVQETVVSEEIMHNLDTCEVTVVGEDLNGDHESLEVDLAQIQQRALEMSSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFD-RKFKLVCSELNGRYISNEFKVEVNV----IHTANPMDHANNAMVQPQFISQVQHASVDLSG 818          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 214.927 bits (546), Expect = 4.751e-57
Identity = 232/845 (27.46%), Postives = 366/845 (43.31%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRII-------LAENI----SHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSF--NIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFSYVSVENTFDNT-NYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESL--LLPHIVEALAK------DSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTG--AIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWEST-------------NWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIG 2467
             + G + EN+  V L+P L  +        AE+     +   EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G++ +T+K+ Y     R YK  V A DC K +     VLV ++++ +C   W+G  K I+Y   +G + LF      PS+H+  C     S   +I      +GK         C  D  S      LC A SG V LL  AP +  +  +G     G+     F F+        +   +    + F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+L+LL+R E   +E + + P+E+ +  L QVCD EWHHY + +      L +DG  +    E  +  +   L  +   T+LT+G+C+   S   TQ F G+LAG+ +    +E    + CL TC E L   LP  V +  K       SS+++  D       +I   + +   +SY+N+      P      R + + T ++C             G   +++ E   ISL  I+  ++     E  E +      R V+    +               D  + ++ +   I + L   E T                +       +   +++ G+V  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +NE  V+V +    ++T   +D   +    P    QV HA  D  G
Sbjct:   38 TYHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTFTKEGEICGFRIHGQN---VPFEAVVLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATV----IEGKKYDSIMKVEAVDADCSFQFSQ-ICSYEIVTPD-VPFTIDKDGNIKNTEKLNY--GKERMYKLTVTAYDCGKNRAS-EDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF------PSMHLETCEEPITSIQASIMLETNHIGKG--------CDRDTYSEKSLHKLCGASSGTVELLP-APSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWMRHGPG--GREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQE--PTESESYKPAEFHW-KLDQVCDKEWHHYVLNIEFPAVTLFVDGGTF----EPFLVTEDYPLHTSKIETQLTIGACWQGGSARMTQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGD-------DIESFEKVMQHISYLNSRQFP-TPGI----RHLRVSTTVKCFNEETCISVPDSEGYVMVLQPEEPKISLSGIDHFARGAAEFESVEGVTLFPELRIVSTITREVEVEAEAETEAEGEDDPTVQETVVSEEIMHNLDTCEVTVVGEDLNGDHESLEVDLAQIQQRALEMSSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFD-RKFKLVCSELNGRYISNEFKVEVNV----IHTANPMDHANNAMVQPQFISQVQHASVDLSG 828          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 209.149 bits (531), Expect = 3.957e-55
Identity = 232/853 (27.20%), Postives = 368/853 (43.14%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN--ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSF--NIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFSYVSVENTFDNT-NYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYH-----------------SKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESL--LLPHIVEALAK------DSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTG--AIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWEST-------------NWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIG 2467
             + G + EN+  V L+P L I L ++  + ++ EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G++ +T+K+ Y     R YK  V A DC K +     VLV ++++ +C   W+G  K I+Y   +G + LF      PS+H+  C     S   +I      +GK         C  D  S      LC A SG V LL  AP +  +  +G     G+     F F+        +   +    + F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+L+LL+R E   +E + + P+E+ +  L QVCD EWHHY + +      L +DG  +    E  +  +   L  +   T+LT+G+C+                    S   TQ F G+LAG+ +    +E    + CL TC E L   LP  V +  K       SS+++  D       +I   + +   +SY+N+      P      R + + T ++C             G   +++ E   ISL  I+  ++     E  E +      R V+    +               D  + ++ +   I + L   E T                +       +   +++ G+V  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +NE  V+V +    ++T   +D   +    P    QV HA  D  G
Sbjct:   38 TYHGIVTENDDKVLLDPPL-IALDKDAPLRYAGEICGFRIHGQN---VPFEAVVLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATV----IEGKKYDSIMKVEAVDADCSFQFSQ-ICSYEIVTPD-VPFTIDKDGNIKNTEKLNY--GKERMYKLTVTAYDCGKNRAS-EDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF------PSMHLETCEEPITSIQASIMLETNHIGKG--------CDRDTYSEKSLHKLCGASSGTVELLP-APSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWMRHGPG--GREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQE--PTESESYKPAEFHW-KLDQVCDKEWHHYVLNIEFPAVTLFVDGGTF----EPFLVTEDYPLHTSKIETQLTIGACWQDFSGHDNDTETLSEPLTGGSARMTQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGD-------DIESFEKVMQHISYLNSRQFP-TPGI----RHLRVSTTVKCFNEETCISVPDSEGYVMVLQPEEPKISLSGIDHFARGAAEFESVEGVTLFPELRIVSTITREVEVEAEAETEAEGEDDPTVQETVVSEEIMHNLDTCEVTVVGEDLNGDHESLEVDLAQIQQRALEMSSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFD-RKFKLVCSELNGRYISNEFKVEVNV----IHTANPMDHANNAMVQPQFISQVQHASVDLSG 835          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn2 (calsyntenin 2 [Source:ZFIN;Acc:ZDB-GENE-070911-2])

HSP 1 Score: 182.57 bits (462), Expect = 1.080e-46
Identity = 210/789 (26.62%), Postives = 345/789 (43.73%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSFNIFFTARI--VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSFSYVSVENTFD-NTNYLFGKRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSE--WRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKP--IYLFSNVQF--------------KRIGGDNVL--FKSCIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTN 2335
            ++ G + EN   V L+P L  +  +  + ++ EIC   IH +     PF  E+ ++  G   ++ +  ++  +    YTF I+ YDC   P+      S K  V +++  VN   P F E  Y  TV     EG     I ++ A+++    Q SQ    IC Y+I+     PF ID+ G++ +T+++ +  +  + YK  V A DC + +  + SV V +DV+  C   W+G  K + Y   +G   LF      P +H+  C     S       +   +GK         C  +  S    + LC A SG+ +LL  AP            DS +D  +    F F      N  D         +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +    + D F P+E  WR   L Q+CD EWH+Y I +   +  L +DG  +      LV       P  I   +LTVG+C+      +  +TQ F G L+G+ +    +     + CL  C E L +  + E+L K            +++ + ++  +    +K+SYIN+      P    R+  IT  T ++C        E   IS+  I+++      SE   ++  ++     + QL  P  + LF ++                +R G   ++     C V  I   L P  ES     +  +  H+ + N++ G+   GV S+  Y+  +R++ Y   K    L  R F L C+    RYT+
Sbjct:   35 SYHGVITENMDTVMLDPPLVALDKDAPVPYAGEICAFKIHGQ---EAPFEAEVLNRTSGEGVLRARGPID-CEQQKEYTFIIQAYDCGASPNGADWKKSHKAVVHIQVDDVNEFSPVFREPLYRATVT----EGKIYDSILQVEAWDQDCSPQYSQ----ICNYEIV-TQDTPFAIDRNGNIRNTERLSF--DKQQHYKIMVTAYDCGQKR-AMESVPVHIDVKPVCKPGWQGWNKRVDYEPGTGSKQLF------PKMHLETCDGPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLP-APSTSTNWTASLLTDSGRDSDL---IFRFDGRQAANIPDWVVPQNLTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--IQLDSFRPAEFHWR---LEQICDKEWHYYVINVEFPSVTLFVDGVTYEP---YLVTDDWPIHPSEI-DVQLTVGACWQGGEVTTPRFTQYFRGSLSGLTIRPGKIATQKVISCLQACKEGLDISSL-ESLGKGIKFHFNPAQSVLVMEADDLESINTAMTKVSYINSRQF---PTPGLRKLHIT--TTVQC------FGEDTCISIPEIKAMVMVLPPSEPRITIAGVERLVWPSAQLRAPVGVALFKDIHIISTVTKTDATLSIARRPGVLELMHNLDYCDVLVIGEELDPERESLEIHHSSLLGKHLDATNSTSGISIYGVDSMAHYEQAIRQVRYRNWKPGS-LSERRFRLSCSELNGRYTS 767          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: BX001019.1 (calsyntenin 3 [Source:NCBI gene;Acc:555627])

HSP 1 Score: 155.992 bits (393), Expect = 2.447e-38
Identity = 149/537 (27.75%), Postives = 236/537 (43.95%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRIILAENISH-SMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLF-----------GKRFSLTFWMKHGNMLLNDPKQQ----ILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGH----LAGMRLIRDFVEAVNTVRCLATCGESL 1666
            + G + EN+  V LNP L  +  +   H + EICG  +H+    L        D+  G   ++ K+ ++  +    ++F I+ YDC + P       S K  V V +  VN   P F+E  Y      SVPEG     I   E      S Q +Q IC YDI+  N VPF ID  G++ +T+ ++      R + F+V A DC K + + A   VIV V+ SC   W G  K I+Y   SG +PLF      P+LH+ +     +NI  T  +   +I       C  D  S      LC A  G V+LL   P    +          S  S+  +F+ + ++            G  F+L  WM+ G       +++    +LC ++L   +  H S+ +H C+L L    +   +   KF+   W+   L QVCD+EWHH  +++   +  L +DG  +   P ++ +     +P      RL +G+C+  + +    +   H    L+G+ +    VE  + V CL  C E L
Sbjct:   32 YQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPVVL--------DRSTGEGLVRSKEPLD-CESQKEHSFTIQAYDCGEGPDGTNSKKSHKATVHVRVNDVNEFSPVFVERRY----EASVPEGRLFDRIVRVEAVDADCSPQYSQ-ICFYDIITPN-VPFTIDNDGNIKNTEPLDS--KRQRVHSFWVTAFDCGKNRAQ-ADAQVIVTVKPSCKPGWIGWTKRIEYTPGSGSIPLF------PNLHLETCEETVWNIQATVELQTSHIGKG----CDRDSYSDRSVRRLCGAVRGEVDLLP-PPSPATNWTAALPTLPSSDSSLVFSFNGSTHVAVVPDSVASAVSGDHFTLQLWMRRGGASTQGTRKEEETIVLCETELNNDSYSHYSLSVHGCRLSLFYWPDVSAARPVKFL---WK---LEQVCDSEWHHLSLSVQFPSVTLYVDGVTFD--PALIHDN--GAIPNPAPHQRLVIGACWEREDDNSQDSTLNHNHRLLSGVTVRPGNVEPHSVVECLYACREGL 529          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 195.667 bits (496), Expect = 7.692e-51
Identity = 213/788 (27.03%), Postives = 351/788 (44.54%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFS-----EKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSN----CLSFNIFFTARIVGKNIKFAAPELCKHDL---NSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFS-YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTGAII--KTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNV--QFKRIGGDNVLFKS------------CIVRPISYLLRPW-ESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            A+ G + EN+  V L+P L  +  ++ + ++ EICG  IH +     PF   + D+  G   I+    ++  ++   YTF I+ YDC + P  S      K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G + +T+K+ Y       YK  V A DC K +     +LV V V+ +C V W+G  K I+Y   SG + LF      P +H+ + +     ++ ++      +GK         C  D     SIH+   L  + S   N   G P          + F+ +  V + + F   N  F + F ++ WM+HG       K+ +LC S    +++HH  +++HNCKL  L+   +  + ++ + P+E+ +  L Q CD EWHHY + +      L +DG ++ +P  V  +  +   P     ++L VG+C+     +  Q F G+LAG+ +    +E    + CL TC E L L H V+ + +  ++      V +    I+       ++SY+N+      P      R  TI T +RC             G II  + E   IS+K I+  ++         S  E +S+  V   L   +++ S +  + +  G D  + +S            C V  +   L P  ES    +       I   ++++G+   G+ S+E Y+ L+  I Y       L D R+F LIC+ L G+  +NE  V+V ++
Sbjct:   37 AYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHDQD---VPFEALVVDRSTGEGLIRSTKQLD-CEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVR----EGKKYDNILRVEAVDADCSPQFSQ-ICSYEIVTPD-VPFTIDKDGFIKNTEKLIYEKE--HQYKLTVTAYDCGKKRAA-EDILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCELLPSPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLN--FDEPFVISVWMRHGTG--GKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLL---HQVASEEIYKPAEFNW-KLNQACDKEWHHYVLNVELTTVTLYVDGVLF-EPSAVTEDYPMHPYP---IYSQLVVGACWEGDERQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLEL-HTVDGIGEAINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNSRQFP-TPGM----RRFTITTSVRCFNEETCITIPDVEGYIIVLQPEEPRISIKGIDHFAR---------SASEFESNGGV--PLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLDVTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD-RKFKLICSELNGRYISNEFHVEVNVI 767          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 194.897 bits (494), Expect = 1.712e-50
Identity = 216/800 (27.00%), Postives = 357/800 (44.62%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFS-----EKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSN----CLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTGAII--KTETHNISLKIIESLSKTKLGSEKDESLI-------------EIDSDRSVNGQL---NKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPW-ESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            A+ G + EN+  V L+P L  +  ++ + ++ EICG  IH +     PF   + D+  G   I+    ++  ++   YTF I+ YDC + P  S      K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G + +T+K+ Y       YK  V A DC K +     +LV V V+ +C V W+G  K I+Y   SG + LF      P +H+ + +     ++ ++      +GK         C  D  S      LC + S  V LL  +P    +  +G     G+     F F+    V + + F   N  F + F ++ WM+HG       K+ +LC S    +++HH  +++HNCKL  L+   +  + ++ + P+E+ +  L Q CD EWHHY + +      L +DG ++ +P  V  +  +   P     ++L VG+C+     +  Q F G+LAG+ +    +E    + CL TC E L L H V+ + +   + + +    V +    I+       ++SY+N+      P      R  TI T +RC             G II  + E   IS+K I+  +++    E +  +              EI+SD     +L   + P  +  ++  + I  D     +C V  +   L P  ES    +       I   ++++G+   G+ S+E Y+ L+  I Y       L D R+F LIC+ L G+  +NE  V+V ++
Sbjct:   28 AYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHDQD---VPFEALVVDRSTGEGLIRSTKQLD-CEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVR----EGKKYDNILRVEAVDADCSPQFSQ-ICSYEIVTPD-VPFTIDKDGFIKNTEKLIYEKE--HQYKLTVTAYDCGKKRAA-EDILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLP-SPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLN--FDEPFVISVWMRHGTG--GKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLL---HQVASEEIYKPAEFNW-KLNQACDKEWHHYVLNVELTTVTLYVDGVLF-EPSAVTEDYPMHPYP---IYSQLVVGACWEGDERQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLEL-HTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNSRQFP-TPGM----RRFTITTSVRCFNEETCITIPDVEGYIIVLQPEEPRISIKGIDHFARSASEFESNGGVPLFPELHIISTITREIESDGEDPTELSGYDDPCCVQESLVSEEIVHD---LDTCEVVVMGEELNPGEESLQLDVTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD-RKFKLICSELNGRYISNEFHVEVNVI 777          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 193.741 bits (491), Expect = 5.412e-50
Identity = 216/798 (27.07%), Postives = 356/798 (44.61%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFS-----EKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSN----CLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTGAII--KTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNV--QFKRIGGDNVLFKS------------CIVRPISYLLRPW-ESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            A+ G + EN+  V L+P L  +  ++ + ++ EICG  IH +     PF   + D+  G   I+    ++  ++   YTF I+ YDC + P  S      K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G + +T+K+ Y       YK  V A DC K +     +LV V V+ +C V W+G  K I+Y   SG + LF      P +H+ + +     ++ ++      +GK         C  D  S      LC + S  V LL  +P    +  +G     G+     F F+    V + + F   N  F + F ++ WM+HG       K+ +LC S    +++HH  +++HNCKL  L+   +  + ++ + P+E+ +  L Q CD EWHHY + +      L +DG ++ +P  V  +  +   P     ++L VG+C+     +  Q F G+LAG+ +    +E    + CL TC E L L H V+ + +   + + +    V +    I+       ++SY+N+      P      R  TI T +RC             G II  + E   IS+K I+  ++         S  E +S+  V   L   +++ S +  + +  G D  + +S            C V  +   L P  ES    +       I   ++++G+   G+ S+E Y+ L+  I Y       L D R+F LIC+ L G+  +NE  V+V ++
Sbjct:   87 AYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHDQD---VPFEALVVDRSTGEGLIRSTKQLD-CEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVR----EGKKYDNILRVEAVDADCSPQFSQ-ICSYEIVTPD-VPFTIDKDGFIKNTEKLIYEKE--HQYKLTVTAYDCGKKRAA-EDILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLP-SPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLN--FDEPFVISVWMRHGTG--GKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLL---HQVASEEIYKPAEFNW-KLNQACDKEWHHYVLNVELTTVTLYVDGVLF-EPSAVTEDYPMHPYP---IYSQLVVGACWEGDERQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLEL-HTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNSRQFP-TPGM----RRFTITTSVRCFNEETCITIPDVEGYIIVLQPEEPRISIKGIDHFAR---------SASEFESNGGV--PLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLDVTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD-RKFKLICSELNGRYISNEFHVEVNVI 826          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 189.889 bits (481), Expect = 5.858e-49
Identity = 219/807 (27.14%), Postives = 354/807 (43.87%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAE------------NISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFS-----EKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSN----CLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTGAII--KTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNV--QFKRIGGDNVLFKS------------CIVRPISYLLRPW-ESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            A+ G + EN+  V L+P L  +  +            N S S EICG  IH +     PF   + D+  G   I+    ++  ++   YTF I+ YDC + P  S      K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G + +T+K+ Y       YK  V A DC K +     +LV V V+ +C V W+G  K I+Y   SG + LF      P +H+ + +     ++ ++      +GK         C  D  S      LC + S  V LL  +P    +  +G     G+     F F+    V + + F   N  F + F ++ WM+HG       K+ +LC S    +++HH  +++HNCKL  L+   +  + ++ + P+E+ +  L Q CD EWHHY + +      L +DG ++ +P  V  +  +   P     ++L VG+C+     +  Q F G+LAG+ +    +E    + CL TC E L L H V+ + +  ++      V +    I+       ++SY+N+      P      R  TI T +RC             G II  + E   IS+K I+  ++         S  E +S+  V   L   +++ S +  + +  G D  + +S            C V  +   L P  ES    +       I   ++++G+   G+ S+E Y+ L+  I Y       L D R+F LIC+ L G+  +NE  V+V ++
Sbjct:   28 AYHGIVTENDNAVLLDPPLIALDKDSPLQYAGMKSVINFSSS-EICGFKIHDQD---VPFEALVVDRSTGEGLIRSTKQLD-CEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVR----EGKKYDNILRVEAVDADCSPQFSQ-ICSYEIVTPD-VPFTIDKDGFIKNTEKLIYEKE--HQYKLTVTAYDCGKKRAA-EDILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLP-SPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLN--FDEPFVISVWMRHGTG--GKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLL---HQVASEEIYKPAEFNW-KLNQACDKEWHHYVLNVELTTVTLYVDGVLF-EPSAVTEDYPMHPYP---IYSQLVVGACWEGDERQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLEL-HTVDGIGEAINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNSRQFP-TPGM----RRFTITTSVRCFNEETCITIPDVEGYIIVLQPEEPRISIKGIDHFAR---------SASEFESNGGV--PLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLDVTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD-RKFKLICSELNGRYISNEFHVEVNVI 775          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 187.578 bits (475), Expect = 3.592e-48
Identity = 216/801 (26.97%), Postives = 358/801 (44.69%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFS-----EKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSN----CLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILC---NSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTGAII--KTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNV--QFKRIGGDNVLFKS------------CIVRPISYLLRPW-ESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            A+ G + EN+  V L+P L  +  ++ + ++ EICG  IH +     PF   + D+  G   I+    ++  ++   YTF I+ YDC + P  S      K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+    VPF IDK G + +T+K+ Y       YK  V A DC K +     +LV V V+ +C V W+G  K I+Y   SG + LF      P +H+ + +     ++ ++      +GK         C  D  S      LC + S  V LL  +P    +  +G     G+     F F+    V + + F   N  F + F ++ WM+HG       K+ +LC    + +  +++HH  +++HNCKL  L+   +  + ++ + P+E+ +  L Q CD EWHHY + +      L +DG ++ +P  V  +  +   P     ++L VG+C+   S++ T  F G+LAG+ +    +E    + CL TC E L L H V+ + +   + + +    V +    I+       ++SY+N+      P      R  TI T +RC             G II  + E   IS+K I+  ++         S  E +S+  V   L   +++ S +  + +  G D  + +S            C V  +   L P  ES    +       I   ++++G+   G+ S+E Y+ L+  I Y       L D R+F LIC+ L G+  +NE  V+V ++
Sbjct:   28 AYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHDQD---VPFEALVVDRSTGEGLIRSTKQLD-CEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVR----EGKKYDNILRVEAVDADCSPQFSQ-ICSYEIV-TPDVPFTIDKDGFIKNTEKLIYEKE--HQYKLTVTAYDCGKKRAA-EDILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLP-SPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLN--FDEPFVISVWMRHGTG--GKEKESVLCFSGKTGILEISQHHYFLYIHNCKLGFLL---HQVASEEIYKPAEFNWK-LNQACDKEWHHYVLNVELTTVTLYVDGVLF-EPSAVTEDYPMHPYP---IYSQLVVGACWEDSSDQATL-FHGNLAGLMIHSGKLENKKVIDCLYTCKEGLEL-HTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNSRQFP-TPGM----RRFTITTSVRCFNEETCITIPDVEGYIIVLQPEEPRISIKGIDHFAR---------SASEFESNGGV--PLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLDVTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD-RKFKLICSELNGRYISNEFHVEVNVI 769          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn2 (calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897])

HSP 1 Score: 189.889 bits (481), Expect = 6.110e-49
Identity = 167/583 (28.64%), Postives = 271/583 (46.48%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPH-----FSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARI----VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFG-------KRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINT 1798
            ++ G + EN   V L+P L  +  +  +  + EIC   IH +     PF   + +K  G  +++ K  ++  +L   YTF I+ YDC   P       S K  V +++  VN   P F E +Y   V     EG     I ++ A +     Q SQ    IC Y+I+  + VPF ID+ G++ +T+K+ Y  +    Y+  V A DC + +P     LV VDV+  C   W+   K I+Y   SG MPLF      PS+H+ + +    ++  TA +    +GK         C  +  S    + LC A SG ++LL  +P +  +   G    S   +   +         G        +F++T WMKHG +  +   K+ ILCNSD   MNRHH ++++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P +I   +LTVG+C+         + Q F G LA + +    +E+   + CL  C E L + + +E+L +            +++   +I ++     K+SYIN+
Sbjct:   49 SYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQ---ELPFEAVVLNKTSGEGRLRAKSPID-CELQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVT----EGKIYDSILQVEAIDEDCSPQYSQ----ICNYEIVTTD-VPFAIDRNGNIRNTEKLSY--DKQHQYEILVTAYDCGQ-KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF------PSIHLETCDGAVSSLQVTAELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLP-SPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDF--DQADTFRPAEFHWK-LDQICDKEWHYYVINVEFPVVTLYMDGATYEP---YLVTNDWPIHPSHI-AMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDI-NSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS 592          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn2 (calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897])

HSP 1 Score: 189.889 bits (481), Expect = 6.982e-49
Identity = 167/583 (28.64%), Postives = 271/583 (46.48%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPH-----FSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARI----VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFG-------KRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINT 1798
            ++ G + EN   V L+P L  +  +  +  + EIC   IH +     PF   + +K  G  +++ K  ++  +L   YTF I+ YDC   P       S K  V +++  VN   P F E +Y   V     EG     I ++ A +     Q SQ    IC Y+I+  + VPF ID+ G++ +T+K+ Y  +    Y+  V A DC + +P     LV VDV+  C   W+   K I+Y   SG MPLF      PS+H+ + +    ++  TA +    +GK         C  +  S    + LC A SG ++LL  +P +  +   G    S   +   +         G        +F++T WMKHG +  +   K+ ILCNSD   MNRHH ++++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P +I   +LTVG+C+         + Q F G LA + +    +E+   + CL  C E L + + +E+L +            +++   +I ++     K+SYIN+
Sbjct:   49 SYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQ---ELPFEAVVLNKTSGEGRLRAKSPID-CELQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVT----EGKIYDSILQVEAIDEDCSPQYSQ----ICNYEIVTTD-VPFAIDRNGNIRNTEKLSY--DKQHQYEILVTAYDCGQ-KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF------PSIHLETCDGAVSSLQVTAELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLP-SPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDF--DQADTFRPAEFHWK-LDQICDKEWHYYVINVEFPVVTLYMDGATYEP---YLVTNDWPIHPSHI-AMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDI-NSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS 592          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn1 (calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895])

HSP 1 Score: 188.348 bits (477), Expect = 2.084e-48
Identity = 218/814 (26.78%), Postives = 352/814 (43.24%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDL---NSIHRREVLCDAYSGAV----------NLLKGAP-DSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSN-------------------EYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            + G + EN+  V L+P L  +  ++ +  + EICG  IH +     PF   + DK  G   I+ K+ ++  +L   YTF I+ YDC + P       S K  V +++  VN   P F E SY      +V EG +   I   E      S Q +Q IC Y+IL    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + V+ +C+  W+G    I+Y   +G + +F      PS+H+ + +    ++  T  +   +I       C  D     S+HR   LC A +G            N   G P D+  D       F F+        D    L  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+L+ L+R +   SE+ K+ P+E+ +  L QVCD +WHH+ + +   +  L +DG I  +P  V  +  L   P  I  T+L VG+C+   S                      TQ F G+LAG+ +    +     + CL TC E L L  + E   +   +   S   +  +   N+ +L      +SY+N+      P    R   IT  + ++C   A             +++ E   ISL  +   ++     E  E +       S+  +L     +   V+ +  G  D  + +S +   I + L                ES    +       I + ++  G+VF GV+++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   42 YHGIVTENDNTVLLDPPLIALDKDSPLRFAGEICGFKIHGQN---VPFDAVVVDKSTGEGIIRSKEKLD-CELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSY----KAAVVEGKQHSSILRVEAVDADCSPQFSQ-ICSYEIL-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKR-ATEDVLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVF------PSIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHR---LCGAAAGTSELLPSPSSSFNWTVGLPTDNGHD---SDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLVFLLRQDP--SEEKKYRPAEFHWK-LNQVCDEDWHHFVLNVEVPSVTLYVDG-IPHEPFSVTEDYPLH--PTKIE-TQLVVGACWQEYSGVESGNETEPATMASAGGDLHMTQFFRGNLAGLTVRSGKLADKKVIDCLYTCKEGLDL-QVPEDANRGVQIQASSSQAVLTLEGDNVGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STVKCFNEAACIEVPPVEGYVMVLQPEEPKISLSGVHHFARAASEFESAEGI-------SLFPELRIISTITREVEPEADGSEDPTVQESLVSEEIVHDLDTCEVTVEGDELNAEQESLEVDVTRLQQKGIEASHSDLGVVFTGVETMASYEEVLHLLRYRNWHTRSLLD-RKFKLICSELNGRYLSNEFKVEVNVI 803          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn1 (calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895])

HSP 1 Score: 185.267 bits (469), Expect = 1.976e-47
Identity = 222/824 (26.94%), Postives = 355/824 (43.08%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRII-------LAEN----ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDL---NSIHRREVLCDAYSGAV----------NLLKGAP-DSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKS-----NE--------------YTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            + G + EN+  V L+P L  +        AE+    ++   EICG  IH +     PF   + DK  G   I+ K+ ++  +L   YTF I+ YDC + P       S K  V +++  VN   P F E SY      +V EG +   I   E      S Q +Q IC Y+IL    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + V+ +C+  W+G    I+Y   +G + +F      PS+H+ + +    ++  T  +   +I       C  D     S+HR   LC A +G            N   G P D+  D       F F+        D    L  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+L+ L+R +   SE+ K+ P+E+ +  L QVCD +WHH+ + +   +  L +DG I  +P  V  +  L   P  I  T+L VG+C+   S     NE               TQ F G+LAG+ +    +     + CL TC E L L  + E   +   +   S   +  +   N+ +L      +SY+N+      P    R   IT  + ++C   A             +++ E   ISL  +   ++     E  E +       S+  +L     +   V+ +  G  D  + +S +   I + L                ES    +       I + ++  G+VF GV+++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   42 YHGIVTENDNTVLLDPPLIALDKDSPLRFAESFEVTVTKEGEICGFKIHGQN---VPFDAVVVDKSTGEGIIRSKEKLD-CELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSY----KAAVVEGKQHSSILRVEAVDADCSPQFSQ-ICSYEIL-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKR-ATEDVLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVF------PSIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHR---LCGAAAGTSELLPSPSSSFNWTVGLPTDNGHD---SDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLVFLLRQDP--SEEKKYRPAEFHWK-LNQVCDEDWHHFVLNVEVPSVTLYVDG-IPHEPFSVTEDYPLH--PTKIE-TQLVVGACWQEYSGVESGNETEPATMASAGGDLHMTQFFRGNLAGLTVRSGKLADKKVIDCLYTCKEGLDL-QVPEDANRGVQIQASSSQAVLTLEGDNVGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STVKCFNEAACIEVPPVEGYVMVLQPEEPKISLSGVHHFARAASEFESAEGI-------SLFPELRIISTITREVEPEADGSEDPTVQESLVSEEIVHDLDTCEVTVEGDELNAEQESLEVDVTRLQQKGIEASHSDLGVVFTGVETMASYEEVLHLLRYRNWHTRSLLD-RKFKLICSELNGRYLSNEFKVEVNVI 813          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn3 (calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323])

HSP 1 Score: 144.436 bits (363), Expect = 1.222e-34
Identity = 153/557 (27.47%), Postives = 237/557 (42.55%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLK-GAPDSMKDHQIGGYRFSFSY-VSVENTFDNTNYL-----------------FGKRFSLTFWMKHGNMLLNDPKQQ--ILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQN------------------FFGHLAGMRLIRDFVEAVNTVRCLATCGESL 1666
            + G + EN+  V LNP L  +  +  + ++ EICG  +H    S  PF   I DK  G   I+ K+ V+  +    +TF I+ YDC + P       S K  V V +  VN   P F+E  Y   V     EG     I   E      S Q +Q IC Y+IL  N+ PF ID  G++ +T+K++Y  +  + YKF V A DC K +       V + V+ +C   W+G  K I+Y   +G + LF      P + + + +   +NI  T  +   ++       C  D  S      LC A +G V+LL    P++   +   G    +S   S+   F+ T  +                 F   F+L+FWMKH        K++  I+CN+        H S+ +H C++  L       +   KF+   W+   L QVCD+EWHHY + +      L  DG   S  P ++ +  L   P       L +G+C+  + N+  +                   F G+LAG  +    +E+   + CL  C E L
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAKEPVD-CEAQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVT----EGKLYDRILRVEAIDGDCSPQYSQ-ICYYEILTPNT-PFLIDNDGNIENTEKLQY--SGEKLYKFTVTAYDCGKKR-AADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF------PGIRLETCDEPLWNIQATIELQTSHVAKG----CDRDNYSERALRKLCGAATGEVDLLPMPGPNA---NWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPAGLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVKFL---WK---LEQVCDDEWHHYALNLEFPTVTLYTDG--ISFDPALIHDNGLIHPPRREPA--LMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGL 553          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q6Q0N0|CSTN1_RAT (Calsyntenin-1 OS=Rattus norvegicus OX=10116 GN=Clstn1 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 5.966e-51
Identity = 216/792 (27.27%), Postives = 348/792 (43.94%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAV----------NLLKGAP-DSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            + G + EN+  V L+P L  +  ++ +  + EICG  IH +     PF   + DK  G   I+ K+ ++  +L   YTF I+ YDC + P       S K  V +++  VN   P F E SY      +V EG + G I   E      S Q +Q IC Y+IL    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + V+ +C+  W+G    I+Y   +G + +F      PS+H+ + +    ++  T  +   +I       C  D  S      LC A +G            N   G P D+  D       F F+        D    L  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+LI L+R +   SE+ K+ P+E+ +  L QVCD +WHH+ + +   +  L +DG +  +P  V  +  L   P  I  T+L VG+C+       TQ F G+LAG+ +    +     + CL TC E L L  + E   +   +   S   +  +   N+ +L      +SY+N+      P    R   IT  + ++C   A             +++ E   ISL  +   ++     E  E +       S+  +L     +   V+ +  G  D  + +S +   I + L                ES    +       I   ++  G+VF GV+++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   42 YHGIVTENDNTVLLDPPLIALDKDSPLRFAGEICGFKIHGQN---VPFDAVVVDKSTGEGIIRSKEKLD-CELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSY----KAAVVEGKQHGSILRVEAVDADCSPQFSQ-ICSYEIL-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKR-ATEDVLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVF------PSIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHRLCGAAAGTSELLPSPSSSFNWTVGLPTDNGHD---SDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLLRQDP--SEEKKYRPAEFHW-KLNQVCDEDWHHFVLNVEVPSVTLYVDG-VSHEPFSVTEDYPLH--PTKIE-TQLVVGACWQGGDLHMTQFFRGNLAGLTVRSGKLADKKVIDCLYTCKEGLDL-QVPEDGNRGVQIQTSSSQAVLTLEGENVGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STVKCFNEAACIEVPPVEGYVMVLQPEEPKISLSGVHHFARAASEFESPEGV-------SLFPELKIISTITREVEPEADGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNAEQESLEVDVARLQQKGIEVNHSDLGVVFTGVETMASYEEVLHLLRYRNWHTRSLLD-RKFKLICSELNGRYLSNEFKVEVNVI 784          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q9H4D0|CSTN2_HUMAN (Calsyntenin-2 OS=Homo sapiens OX=9606 GN=CLSTN2 PE=1 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 4.731e-49
Identity = 170/583 (29.16%), Postives = 268/583 (45.97%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPH-----FSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSFNIF--FTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG------GYRFSFSYVSVENTFDN-TNYLFGKRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINT 1798
            ++ G + EN   V L+P L  +  +  +  + EIC   IH +     PF   + +K  G  +++ K  ++  +L   YTF I+ YDC   PH      S K  V +++  VN   P F E +Y   V     EG     I ++ A +     Q SQ    IC Y+I+  + VPF ID+ G++ +T+K+ Y  +    Y+  V A DC + +P     LV VDV+  C   W+   K I+Y   SG MPLF      PS+H+  C     S  I        +GK         C  +  S    + LC A SG ++LL  +P +  +   G         F F         D         +F++T WMKHG +  +   K+ ILCNSD   MNRHH ++++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P +I   +LTVG+C+        ++ Q F G LA + +    +E+   + CL  C E L + + +E+L +            +++   +I ++     K+SYIN+
Sbjct:   47 SYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQ---ELPFEAVVLNKTSGEGRLRAKSPID-CELQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVT----EGKIYDSILQVEAIDEDCSPQYSQ----ICNYEIVTTD-VPFAIDRNGNIRNTEKLSY--DKQHQYEILVTAYDCGQ-KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF------PSIHLETCDGAVSSLQIVTELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLP-SPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDF--DQADTFRPAEFHWK-LDQICDKEWHYYVINVEFPVVTLYMDGATYEP---YLVTNDWPIHPSHI-AMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDI-NSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS 590          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q8VDA1|CSTN2_RAT (Calsyntenin-2 OS=Rattus norvegicus OX=10116 GN=Clstn2 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.931e-48
Identity = 166/583 (28.47%), Postives = 271/583 (46.48%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPH-----FSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARI----VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFG-------KRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINT 1798
            ++ G + EN   V L+P +  +  +  +  + EIC   IH +     PF   + +K  G  +++ K  ++  +L   YTF I+ YDC   P       S K  V +++  VN   P F E +Y   V     EG     I ++ A +     Q SQ    IC Y+I+  + VPF ID+ G++ +T+K+ Y  +  R Y+  V A DC + +P     LV VDV+  C   W+   K I+Y   SG MPLF      P +H+ + +    ++  TA +    +GK         C  +  S    + LC A SG ++LL  +P +  +   G    S   +   +         G        +F++T WMKHG +  +   K+ ILCNSD   MNRHH ++++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P +I   +LTVG+C+         + Q F G LA + +    +E+   + CL  C E L + + +E+L +            +++   +I ++     K+SYIN+
Sbjct:   49 SYHGVITENNDTVILDPTIVALDKDAPVPFAGEICAFKIHGQ---ELPFEAVVLNKTSGEGRLRAKSPID-CELQKEYTFIIQAYDCGAGPQEAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVT----EGKIYDSILQVEAIDEDCSPQYSQ----ICNYEIVTTD-VPFAIDRNGNIRNTEKLSY--DKQRQYEILVTAYDCGQ-KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF------PGIHLETCDGAVSSLQVTAELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLP-SPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDF--DQADTFRPAEFHWK-LDQICDKEWHYYVINVEFPVVTLYMDGATYEP---YLVTNDWPIHPSHI-AMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDI-NSLESLGRGIKYHFNPSQSILVMEGDDIGNINQALQKVSYINS 592          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q9ER65|CSTN2_MOUSE (Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 PE=1 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 4.274e-48
Identity = 167/583 (28.64%), Postives = 271/583 (46.48%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPH-----FSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARI----VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFG-------KRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINT 1798
            ++ G + EN   V L+P L  +  +  +  + EIC   IH +     PF   + +K  G  +++ K  ++  +L   YTF I+ YDC   P       S K  V +++  VN   P F E +Y   V     EG     I ++ A +     Q SQ    IC Y+I+  + VPF ID+ G++ +T+K+ Y  +    Y+  V A DC + +P     LV VDV+  C   W+   K I+Y   SG MPLF      PS+H+ + +    ++  TA +    +GK         C  +  S    + LC A SG ++LL  +P +  +   G    S   +   +         G        +F++T WMKHG +  +   K+ ILCNSD   MNRHH ++++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P +I   +LTVG+C+         + Q F G LA + +    +E+   + CL  C E L + + +E+L +            +++   +I ++     K+SYIN+
Sbjct:   49 SYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQ---ELPFEAVVLNKTSGEGRLRAKSPID-CELQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVT----EGKIYDSILQVEAIDEDCSPQYSQ----ICNYEIVTTD-VPFAIDRNGNIRNTEKLSY--DKQHQYEILVTAYDCGQ-KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF------PSIHLETCDGAVSSLQVTAELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLP-SPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDF--DQADTFRPAEFHWK-LDQICDKEWHYYVINVEFPVVTLYMDGATYEP---YLVTNDWPIHPSHI-AMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDI-NSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS 592          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|O94985|CSTN1_HUMAN (Calsyntenin-1 OS=Homo sapiens OX=9606 GN=CLSTN1 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 6.753e-47
Identity = 215/819 (26.25%), Postives = 346/819 (42.25%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRII-------LAEN----ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMK--------DHQIGGYRFSFSYVSVENTFDNTNYLFGKR-FSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKS-----NE--------------YTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVI--VRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGG-DNVLFKSCIVRPISYLL-------------RPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
             + G + EN+  V L+P L  +        AE+    ++   EICG  IH +     PF   + DK  G   I+ K+ ++  +L   Y+F I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG +   I   E      S Q +Q IC Y+I+    VPF +DK G + +T+K+ Y       YK  V A DC K +     VLV + ++ +CT  W+G    I+Y   +G + +F      P++H+ + +    ++  T  +   +I       C  D  S      LC A +G   LL     S+         +       F F+        D    +  K  F+++ WM+HG       K+ ILC+SD   MNRHH S+++H C+LI L R +   SE+ K+ P+E+ +  L QVCD EWHHY + +   +  L +DG    +P  V  +  L   P  I  T+L VG+C+   S     NE               TQ F G+LAG+ L    +     + CL TC E L L  ++E   +   +      ++  +   ++ +L      +SY+N+      P    R   IT  + I+C   A             +++ E   ISL  +   ++     E  E +      R ++        +   V+ +  G  D  + +S +   I + L                ES    +       I   ++  G+ F GV ++  Y+ ++  + Y       LLD R+F LIC+ L G+  +NE  V+V ++
Sbjct:   41 TYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIHGQN---VPFDAVVVDKSTGEGVIRSKEKLD-CELQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVI----EGKQYDSILRVEAVDADCSPQFSQ-ICSYEII-TPDVPFTVDKDGYIKNTEKLNY--GKEHQYKLTVTAYDCGKKR-ATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVF------PNIHLETCDEPVASVQATVELETSHIGKG----CDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGP--FGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQDP--SEEKKYRPAEFHWK-LNQVCDEEWHHYVLNVEFPSVTLYVDG-TSHEPFSVTEDYPLH--PSKIE-TQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDL-QVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQF---PTPGIRRLKIT--STIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIIS-------TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLD-RKFKLICSELNGRYISNEFKVEVNVI 813          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A4E0R9X6 (Calsyntenin-3 OS=Fasciola hepatica OX=6192 GN=D915_006402 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 9.060e-62
Identity = 191/630 (30.32%), Postives = 289/630 (45.87%), Query Frame = 2
Query:  104 FQSPIGVKDGWAFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDN--VNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDV-RDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCL----SFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGA-VNLLK----------------GAPDSMKDHQIGGYRFSFSYVSVEN------TFDNTNYLFGKRFSLTFWMKHGNMLLNDP-------KQQILCNSDLKVMNRHHTSVFLHNCKLILLI----RVENGGSEQDKFMPSEWRFGPLRQ-VCDN-EWHHYGITMN---------------DG-NPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEK 1816
            F +P    D  ++ G+L ++   V L P L+    +      EICG+  H    +  PF  E+ D+K G  +IKLK+N  +N+ +      F +E YDC +PP+FS++  V V I + +GP F   SY FTV+   P GT +G+++A      S+ S     IC Y I PVN +PF ID+YG +          V R Y F V A DC +  P  A V V V + +  C   WEGLP  I+Y   S V      ++  P L  C+  CL       +   + +    ++ A    C HD   ++R+  LC       +NLL                  AP  +   QI   RFS + +SV        T +N    F   F+L+FWM+      + P       ++ ++C+ D  +      S+    C+LI+ I    R  +G SE +    S+W F  L +  C   +WHHY IT N               DG NP L    EI S P  V +  + K  P      R+T+G+C+  ++    Q+    L GM L+ D VE+ + +RC+A CGESL +P++++ L  D +VT+ SD + +   NI  +  M + ++YI   P   K
Sbjct:   43 FYTPTNHPDAPSYRGYLWKDSNRVHLRPVLQAFADDVKGVKGEICGIVPHGFTGNNLPFYVEVLDRKTGLGEIKLKNNSSINFKE-EQTIAFDVEAYDCQEPPNFSKRAPVSVHILNRHGPVFDSLSYQFTVSQHSPTGTVVGQVAAIAEFN-SRDSDAATKICDYQISPVN-LPFSIDRYGVIRVGDGLEGLRVNRPYVFQVIAEDCHRPTPLRAWVDVQVGLLKQGCQQGWEGLPLDIEYQSPSDVSERLFWRA-KPVLETCTRKCLDPIIQLRLELRSAMDETLVQTANSRACLHDPEHLNRQRKLCRTNPNTMINLLPDPDQDLAAQLVRPSLGSAPRVLAPAQI--MRFSGASLSVWELDPKHLTTENGINAFDTNFTLSFWMRRHMGQTHPPTANSEDIEETVICSQDQNLAQWRFLSISFRGCQLIVRIMASFRPGDGVSEPEPRRASQWIFESLPEHYCSAMQWHHYVITFNRAPWALTTQLVSLLIDGYNPDLNDPTEILSVPNPVYIPSERKADP------RITIGACFDPETRLTRQHLNAELTGMTLLLDEVESPSVLRCMAQCGESLYVPNVLKFLRPDINVTLESDAITIIGQNIAHVTDMLTAITYIRPQPGISK 660          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: R7UQC1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_181561 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.721e-61
Identity = 216/760 (28.42%), Postives = 373/760 (49.08%), Query Frame = 2
Query:  158 ENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKD--NVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSS-NCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKG-APDSM---KDHQIGGYRFSFSYVS--VENTFDNTNYLFGKRFSLTFWMKHGNMLLNDP-KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENG-GSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEI---WSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFK-----SCIVRPISYLLRPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            E +  V L+ EL I+  +++    EICG Y  ++ +S  PF   + D+  G  +I L     +NY +   RY+FQ+  +DC    H + +++V +E+  VN   P F +SSY   VN  VPE   +  I   E      +S     IC Y +L  + VPF + K G L +T+ ++Y  +    Y   V+A DC   Q   A  +V ++V  +C   W+G+ +S+ Y   +G   L         L +C + +C+   +  T  +V  +I       C  D  SI  +  LC A  G+V+LL G   DS     D + G   F+    S  +E      +   G+ F+++ WMKH     N   K+ ILC+SD + MNRHH S+F+HNC+L+LL+R E G G + +KF P+EWR+  + QVCD +WH Y ++++     L IDG++       PEV+ +  L K  +++  T+L VG+C+        Q F G+LAG+ +++   E+   ++CL+ C E L   H +  +    S+++ S+   +++   NI++++ +  ++ YIN+  L   P      R++++ T+++C  GA+            IE ++ T L  + ++ +I      S+ G   +P+   + +    + G   + K     SC+V   + L    E  N+P N+     +        L   G  ++  Y+ ++R+I YV    +  L+ R F + C  L G+  +NE ++KV ++
Sbjct:   41 EEDGEVSLDQEL-IVHDKSMLVGEEICG-YTLYKSHSEMPFKVILLDRSSGLAKIVLARGYQLNY-ERRHRYSFQVAAHDCVTGTH-TGREWVYIEVKDVNEHSPVFTQSSY--IVN--VPEKQMVSNILTLEATD-QDTSDLFHRICSYYLLTAD-VPFAVSKEGVLSNTEPLDY--SFHHNYILAVQAEDCGGKQSERA--MVNIEVVQTCLPSWKGVEESVVYPAGTGQKTLLP----DAHLDLCDNPSCVPQQVTATVNLVTSHIGKG----CDRDTYSILSQRKLCGASEGSVDLLLGQTSDSALPTDDGKEGDQIFALDGKSNAMEIPITRMDPNLGEHFTISTWMKHEESKRNSGRKENILCHSDGENMNRHHYSLFVHNCRLVLLMRQEPGEGIDMNKFKPAEWRW-KIPQVCDGQWHLYAVSVDFPEVRLYIDGKLSVDAKTNPEVIDDWPLHK-AKSVHYTKLVVGACWQGGEQHLDQYFEGYLAGLSILKGQTESDRVLQCLSNCKEKLDF-HAMSEMETGMSISLNSEMTEIVISGHNIDEVEKLLHRVGYINSR-LFPTPGY----RTLSLSTQVQCLDGAV-----------NIEDVNTTILVQQAEQPII------SITGPEKQPLAEEALLHGHAVLGKISVVKEHYLDSCLVSIDAILTPDAEHFNYPTNLIAQLGLKVSEMEDSLQIAGADTISNYEAVLRQIKYVNRHPED-LNERTFTVKCTELNGRFVSNELVIKVSVI 752          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: V5GXS3 (Putative calsyntenin (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 2.252e-61
Identity = 180/620 (29.03%), Postives = 293/620 (47.26%), Query Frame = 2
Query:  152 LNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNC----LSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLL----------KGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKH----GNMLLNDP--KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDG---EIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHI-VEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIES 1930
            + EN R VK+ P +R++ A+       +C   I ++ ++  PF   ITD  +G  ++  K ++N  +    Y F I    C+     SE   V + +  VN   PR+ E SY  +V+   P   ++  + A +    +  +  N  ICKYDIL  + VPF ID  G+L  T+ +++   V   + F V A DC   Q R   V + V V   C V W+GL + ++Y   SG   LF        L +C  +C    L+  +    R VGK         C  D  S+  +  LC A S +V+LL          +G P          Y F  +  +V       ++     F++ FWM+H    G    N    K+ +LCNSD   M+RHHT++FL NC+LILL+R E    E +KF P+EWR+    +VCD+ WHHY +++N     L +DG   ++ +  PE++ +  L +  +NI  T   VG+C+  K N+   +F G+L G+ ++R   E+ + + CL  C E L +P    +A   + +       V V + + + L+ + S+++Y+N+      P +    R++ I T + C  G   K  T    + I+ +
Sbjct:   17 VKENSRNVKIMPRIRVLDAK-------VCRFLISNKHHTEAPFEVRITDDAKGEAELFAKKDLN-CEKHRNYKFDIAAVGCNG--LVSENVTVHLSVDDVNEFAPRWEEESYQGSVDEGRPPHERVLRVRALD----ADCTPKNSEICKYDILDAH-VPFSIDSEGTLWTTEPLDW--EVSSNHIFQVVAFDCSMKQSR--PVTITVRVNRVCRVGWKGLEERVEYTPGSGRRALFP----DAQLELCEGSCDPEQLTARLTLATRHVGKG--------CDRDTYSVDSQRKLCGASSDSVDLLPSPGVGAEWTQGLPTDEGRESDQIYEFDGATNAVVIPESTVSHNLTNTFTVGFWMRHKAPTGGAAHNASHLKEHVLCNSDDHRMSRHHTALFLRNCRLILLLRREPIQEEANKFTPAEWRWK-TPEVCDDRWHHYAVSVNFPEASLYVDGRPFKVTANNPEIVDDWPLHQT-KNI-NTTFVVGACWQGKDNKMAFHFRGYLTGLSVLRGRTESPDVLSCLHRCKEWLDVPPADAQATGTEVASNAERSEVTVMARDQDTLEDLVSRVAYVNSRDFP-TPGR----RTVHIATTVMCSNGKAQKVPTEESWVTILAA 597          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: V5H8Z8 (Putative calsyntenin OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 5.468e-61
Identity = 180/620 (29.03%), Postives = 293/620 (47.26%), Query Frame = 2
Query:  152 LNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNC----LSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLL----------KGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKH----GNMLLNDP--KQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDG---EIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHI-VEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIES 1930
            + EN R VK+ P +R++ A+       +C   I ++ ++  PF   ITD  +G  ++  K ++N  +    Y F I    C+     SE   V + +  VN   PR+ E SY  +V+   P   ++  + A +    +  +  N  ICKYDIL  + VPF ID  G+L  T+ +++   V   + F V A DC   Q R   V + V V   C V W+GL + ++Y   SG   LF        L +C  +C    L+  +    R VGK         C  D  S+  +  LC A S +V+LL          +G P          Y F  +  +V       ++     F++ FWM+H    G    N    K+ +LCNSD   M+RHHT++FL NC+LILL+R E    E +KF P+EWR+    +VCD+ WHHY +++N     L +DG   ++ +  PE++ +  L +  +NI  T   VG+C+  K N+   +F G+L G+ ++R   E+ + + CL  C E L +P    +A   + +       V V + + + L+ + S+++Y+N+      P +    R++ I T + C  G   K  T    + I+ +
Sbjct:   37 VKENSRNVKIMPRIRVLDAK-------VCRFLISNKHHTEAPFEVRITDDAKGEAELFAKKDLN-CEKHRNYKFDIAAVGCNG--LVSENVTVHLSVDDVNEFAPRWEEESYQGSVDEGRPPHERVLRVRALD----ADCTPKNSEICKYDILDAH-VPFSIDSEGTLWTTEPLDW--EVSSNHIFQVVAFDCSMKQSR--PVTITVRVNRVCRVGWKGLEERVEYTPGSGRRALFP----DAQLELCEGSCDPEQLTARLTLATRHVGKG--------CDRDTYSVDSQRKLCGASSDSVDLLPSPGVGAEWTQGLPTDEGRESDQIYEFDGATNAVVIPESTVSHNLTNTFTVGFWMRHKAPTGGAAHNASHLKEHVLCNSDDHRMSRHHTALFLRNCRLILLLRREPIQEEANKFTPAEWRWK-TPEVCDDRWHHYAVSVNFPEASLYVDGRPFKVTANNPEIVDDWPLHQT-KNINTT-FVVGACWQGKDNKMAFHFRGYLTGLSVLRGRTESPDVLSCLHRCKEWLDVPPADAQATGTEVASNAERSEVTVMARDQDTLEDLVSRVAYVNSRDFP-TPGR----RTVHIATTVMCSNGKAQKVPTEESWVTILAA 617          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A183A6Y3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 5.975e-60
Identity = 203/719 (28.23%), Postives = 313/719 (43.53%), Query Frame = 2
Query:  179 LNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYA-DLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDV-RDSCTVHWEGLPKSIKYIRNS-GVMPLFSMQSTSPSLHVCSSNC----LSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAY-SGAVNLLK----------------GAPDSMKDHQIGGYRFSFSYVSVEN------TFDNTNYLFGKRFSLTFWMKH--GNML-----LNDPKQQILCNSDLKVMNRHHTSVFLHNCKLIL-----------LIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGIT---------------MNDG-NPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEK--PNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVN-------GQLNKPIYLFSNVQFK--------------RIGGDNVL 2074
            L P L+ +  ++     EICG+  H  I    PF  E+ D+K G  +IKLK N N   +      F++E YDC +PP+FS++  V V I + +GP F   SY FTV+   P GT +G+++A       +  +  + IC Y + PV+ VPF ID+YG +         N  + Y F V A DC +  P  ASV V V + +  C   W+GL   I+Y   S     LF      P L  C+ +C    +   +   + + G  I  A P+ C HD   ++R+  LC    S  VNLL                   P  M   Q    RFS S +SV        + ++    F   F+L+FWM+   G  L       D ++ ++C+ D  +      SV    C+LI+           LI  E  G+ Q  F P   R+        ++WHHY IT               M DG +P L    EI + P    V    +  P      R+TVG+C+  +++   Q+    L GM L+ D VE+ + +RC+A CGESL +P++++ L  D +VT+ SD + +   NI+ +  M + + YI   P           + R + + T  +C     I      ISL +   L + + G  + ES   +D++ + +        Q N+P    + ++ K              RI G NV+
Sbjct:    1 LRPALQAVADDHNGKKGEICGIVPHGFIEDDLPFKIEVLDRKTGIAEIKLKKNSNIRFEEESTIGFEVEAYDCQEPPNFSKRVPVRVYILNRHGPVFDSLSYQFTVSQHSPTGTVVGQVAAIAEFNSREDDKATK-ICDYRVSPVD-VPFTIDRYGVIRVGTGLEALNANKPYVFQVIAEDCHRPIPLSASVDVQVTLLKQGCQQGWKGLAPDIEYRGTSDSTHRLF--WPAKPVLETCTRDCPDPTIRLQLELKSAVDGNLIPTATPQACLHDPEHLNRQRSLCKTNPSTLVNLLPNPDLDLATQLVRPSLGSTPRVMAPSQT--MRFSASSLSVWELDPKHLSTESGINAFDTNFTLSFWMRRNMGQTLGPTATPEDREETVICSQDQNIARWRFLSVSFRGCQLIVRMMASFRPGASLIESEARGASQWIFEPLPERYCSPNMHSQSQWHHYAITFSRAPWAATTQLISLMIDGQDPGLNGPDEILTTPIPAYVPSARRADP------RITVGACFDPETHLTRQHLNAELTGMTLLFDEVESPSILRCMAQCGESLFVPNVLKYLLADINVTLGSDVITITGQNISHVTDMLTAIMYIRPQPGISNGYTTTVAQSRKLELKTWYQCPNEMAISLPVTVISLNV---LPEEREGDHRVESSHPLDANDAGSVWLPEDESQFNRPSAAAAEMERKAKEQQLSRSTVPTLRISGPNVI 704          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:103033297])

HSP 1 Score: 213.001 bits (541), Expect = 1.598e-56
Identity = 238/840 (28.33%), Postives = 375/840 (44.64%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN--ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSF--NIFFTARIVGKNIKFAAPELCKHDL---NSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESL--LLPHIVEALAK------DSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIV-RPISYLLR-------------PWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIG 2467
             + G + EN+  V L+P L I L ++  + ++ EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G++ +T+K+ Y  +  R YK  V A DC K +     VLV ++++ +C   W+G  K I+Y   +G + LF     S  L  C     S   +I      +GK         C  D     S+HR   LC A +G V LL  AP S  +  +G     G+     F F+    + V     +T+      F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+L+LL+R +   +E + + P+E+ +  L QVCD EWHHY + +      L +DG   S  P ++ E     L  +   T+LT+G+C+   S   TQ F G+LAG+ +    +E    + CL TC E L   LP  V +  K       SS+T+  D       +I   + +   +SY+N+      P    R   +T  T ++C                 +++ E   ISL  I+  ++     E  E +      R V+        +   V+ +  G D+   +  +V   I + L                ES    +       +   +++ G+V  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +N+  V+V +    ++T   ++   +    P    QV HA  D  G
Sbjct:   44 TYHGIVTENDDKVLLDPPL-IALDKDAPLRYAGEICGFRIHGQN---VPFEAVMLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGTNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATV----IEGKKYDSIMKVEAVDADCSFQFSQ-ICSYEIVTPD-VPFSIDKDGNIKNTEKLNY--SKERMYKLTVTAYDCGKNRAS-EDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALFP----SVRLETCEEPITSIQASIEVETNHIGKG--------CDRDTYSEKSLHR---LCGASTGTVELLP-APSSATNWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTS--LKDPFTVSVWMRHGPG--GREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQD--PTESENYKPAEFHW-KLDQVCDKEWHHYVLNIEFPAVALFVDGA--SFEPFLVTEDY--PLHASKIETQLTIGACWQGGSARMTQYFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLTLEGD-------DIESFEKVMQHISYLNSRQF---PTPGIRHLRVT--TTVKCFNEETCISVPDAEGYVMVLQPEEPKISLSGIDHFARGAADFESAEGVTLFPELRIVS-------TITREVEAEAEGEDDPTVQETVVSEEIMHNLDMCEVTVVGDDLDGDHESLEVDLAQVQQRGLEISSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFD-RKFKLVCSELNGRYVSNDFKVEVNV----IHTANPMEHANNAMWQPQFINQVKHASVDLSG 818          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:103033297])

HSP 1 Score: 202.216 bits (513), Expect = 6.306e-53
Identity = 238/857 (27.77%), Postives = 375/857 (43.76%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN--ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSF--NIFFTARIVGKNIKFAAPELCKHDL---NSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYH-----------------SKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESL--LLPHIVEALAK------DSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGA-------------IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIV-RPISYLLR-------------PWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIG 2467
             + G + EN+  V L+P L I L ++  + ++ EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  VN   P F E SY  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G++ +T+K+ Y  +  R YK  V A DC K +     VLV ++++ +C   W+G  K I+Y   +G + LF     S  L  C     S   +I      +GK         C  D     S+HR   LC A +G V LL  AP S  +  +G     G+     F F+    + V     +T+      F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+L+LL+R +   +E + + P+E+ +  L QVCD EWHHY + +      L +DG   S  P ++ E     L  +   T+LT+G+C+                    S   TQ F G+LAG+ +    +E    + CL TC E L   LP  V +  K       SS+T+  D       +I   + +   +SY+N+      P    R   +T  T ++C                 +++ E   ISL  I+  ++     E  E +      R V+        +   V+ +  G D+   +  +V   I + L                ES    +       +   +++ G+V  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +N+  V+V +    ++T   ++   +    P    QV HA  D  G
Sbjct:   44 TYHGIVTENDDKVLLDPPL-IALDKDAPLRYAGEICGFRIHGQN---VPFEAVMLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGTNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATV----IEGKKYDSIMKVEAVDADCSFQFSQ-ICSYEIVTPD-VPFSIDKDGNIKNTEKLNY--SKERMYKLTVTAYDCGKNRAS-EDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALFP----SVRLETCEEPITSIQASIEVETNHIGKG--------CDRDTYSEKSLHR---LCGASTGTVELLP-APSSATNWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTS--LKDPFTVSVWMRHGPG--GREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQD--PTESENYKPAEFHW-KLDQVCDKEWHHYVLNIEFPAVALFVDGA--SFEPFLVTEDY--PLHASKIETQLTIGACWQDLSGHDNDTETVSEPLTGGSARMTQYFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLTLEGD-------DIESFEKVMQHISYLNSRQF---PTPGIRHLRVT--TTVKCFNEETCISVPDAEGYVMVLQPEEPKISLSGIDHFARGAADFESAEGVTLFPELRIVS-------TITREVEAEAEGEDDPTVQETVVSEEIMHNLDMCEVTVVGDDLDGDHESLEVDLAQVQQRGLEISSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFD-RKFKLVCSELNGRYVSNDFKVEVNV----IHTANPMEHANNAMWQPQFINQVKHASVDLSG 835          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 182.185 bits (461), Expect = 1.460e-46
Identity = 209/797 (26.22%), Postives = 349/797 (43.79%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPP-----HFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSFNIFFTARI--VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSFSYVSVENTFDNT-NYLFGKRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKP--IYLFSNVQ-FKRIGGDNVLFKS---------------CIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYT-NEHLVKVQIL 2362
            ++ G + EN   V L+P L  +  +  + ++ EIC   IH +     PF  E+ ++  G   ++ +  ++  +    YTF I+ YDC   P       S K  V +++  VN   P F E  Y  TV     EG     I ++ A+++    Q SQ    IC Y+I+     PF ID+ G++ +T+++ +  +  + YK  V A DC + +    SV V +DV+  C   W+G    + Y   +G   LF      P +H+  C     S       +   +GK         C  +  S    + LC A SG+ +LL  AP            DS +D  +    F F      N  +         +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +   ++ D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P  I   +LTVG+C+      +  +TQ F G L+G+ +    +E    + CL  C E L + + +E+L K            +++   +++ +    +K+SYIN+      P    R+  +T  T ++C        E   IS+  I+++      SE   ++  ++       +L  P  I LF +++    I   +  F S               C V  I   L P  ES     +  +  H+ + N++ G+   GV S+  Y+  +R++ Y   +    L  R F L C+    RYT NE  +++ +L
Sbjct:   35 SYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKIHGQ---EAPFEAEVLNRTSGEGVLRARGPID-CEQQKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVT----EGKIYDSILQVEAWDQDCSPQYSQ----ICNYEIV-TQDTPFAIDRNGNIRNTERLSF--DKQQHYKILVTAYDCGQKRAS-ESVPVHIDVKPVCKPGWQGWNNRVDYEPGTGSKQLF------PKMHLETCDGPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLP-APSASTNWTASLLTDSGRDSDL---IFRFDGRQAANIPERVVPQNLTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--TQMDTFRPAEFHWK-LEQICDKEWHYYVINVEFPAVTLFVDGVTYEP---YLVTDDWPIHPSQID-VQLTVGACWQGGEVTTPRFTQYFRGSLSGLTIRPGKIETQKVISCLQACKEGLDI-NSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYINSRQF---PTPGLRKLRVT--TTVQC------FGEDTCISIPDIKAVVMVLPPSEPRITIAGVERATWPASELRTPAGITLFKDIRIISTITKSDNAFSSGHRPGILEVMHNLDYCDVLVIGEELNPEHESLEIHHSSLLGKHLDATNSTSGISIYGVDSMAHYEQAIRQVRY-RNRRPAGLSERRFRLSCSELNGRYTSNEFNLEIGVL 777          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 181.8 bits (460), Expect = 1.536e-46
Identity = 209/797 (26.22%), Postives = 349/797 (43.79%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPP-----HFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSFNIFFTARI--VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSFSYVSVENTFDNT-NYLFGKRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKP--IYLFSNVQ-FKRIGGDNVLFKS---------------CIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYT-NEHLVKVQIL 2362
            ++ G + EN   V L+P L  +  +  + ++ EIC   IH +     PF  E+ ++  G   ++ +  ++  +    YTF I+ YDC   P       S K  V +++  VN   P F E  Y  TV     EG     I ++ A+++    Q SQ    IC Y+I+     PF ID+ G++ +T+++ +  +  + YK  V A DC + +    SV V +DV+  C   W+G    + Y   +G   LF      P +H+  C     S       +   +GK         C  +  S    + LC A SG+ +LL  AP            DS +D  +    F F      N  +         +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +   ++ D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P  I   +LTVG+C+      +  +TQ F G L+G+ +    +E    + CL  C E L + + +E+L K            +++   +++ +    +K+SYIN+      P    R+  +T  T ++C        E   IS+  I+++      SE   ++  ++       +L  P  I LF +++    I   +  F S               C V  I   L P  ES     +  +  H+ + N++ G+   GV S+  Y+  +R++ Y   +    L  R F L C+    RYT NE  +++ +L
Sbjct:   16 SYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKIHGQ---EAPFEAEVLNRTSGEGVLRARGPID-CEQQKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVT----EGKIYDSILQVEAWDQDCSPQYSQ----ICNYEIV-TQDTPFAIDRNGNIRNTERLSF--DKQQHYKILVTAYDCGQKRAS-ESVPVHIDVKPVCKPGWQGWNNRVDYEPGTGSKQLF------PKMHLETCDGPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLP-APSASTNWTASLLTDSGRDSDL---IFRFDGRQAANIPERVVPQNLTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--TQMDTFRPAEFHWK-LEQICDKEWHYYVINVEFPAVTLFVDGVTYEP---YLVTDDWPIHPSQID-VQLTVGACWQGGEVTTPRFTQYFRGSLSGLTIRPGKIETQKVISCLQACKEGLDI-NSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYINSRQF---PTPGLRKLRVT--TTVQC------FGEDTCISIPDIKAVVMVLPPSEPRITIAGVERATWPASELRTPAGITLFKDIRIISTITKSDNAFSSGHRPGILEVMHNLDYCDVLVIGEELNPEHESLEIHHSSLLGKHLDATNSTSGISIYGVDSMAHYEQAIRQVRY-RNRRPAGLSERRFRLSCSELNGRYTSNEFNLEIGVL 758          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 180.644 bits (457), Expect = 3.436e-46
Identity = 208/798 (26.07%), Postives = 350/798 (43.86%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPP-----HFSEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGT---KIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHV--CSSNCLSFNIFFTARI--VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSFSYVSVENTFDNT-NYLFGKRFSLTFWMKHG-NMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTM--FSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKP--IYLFSNVQ-FKRIGGDNVLFKS----------------CIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            ++ G + EN   V L+P L  +  +  + ++ EIC   IH +     PF  E+ ++  G   ++ +  ++  +    YTF I+ YDC   P       S K  V +++  VN   P F E  Y  TV     EG     I ++ A+++    Q SQ    IC Y+I+     PF ID+ G++ +T+++ +  +  + YK  V A DC + +    SV V +DV+  C   W+G    + Y   +G   LF      P +H+  C     S       +   +GK         C  +  S    + LC A SG+ +LL  AP            DS +D  +    F F      N  +         +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +   ++ D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P  I   +LTVG+C+      +  +TQ F G L+G+ +    +E    + CL  C E L + + +E+L K            +++   +++ +    +K+SYIN+      P    R+  +T  T ++C        E   IS+  I+++      SE   ++  ++       +L  P  I LF +++    I   +  F S                C V  I   L P  ES     +  +  H+ + N++ G+   GV S+  Y+  +R++ Y   +    L  R F L C+ L G+  +NE  +++ +L
Sbjct:   19 SYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKIHGQ---EAPFEAEVLNRTSGEGVLRARGPID-CEQQKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVT----EGKIYDSILQVEAWDQDCSPQYSQ----ICNYEIV-TQDTPFAIDRNGNIRNTERLSF--DKQQHYKILVTAYDCGQKRAS-ESVPVHIDVKPVCKPGWQGWNNRVDYEPGTGSKQLF------PKMHLETCDGPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLP-APSASTNWTASLLTDSGRDSDL---IFRFDGRQAANIPERVVPQNLTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--TQMDTFRPAEFHWK-LEQICDKEWHYYVINVEFPAVTLFVDGVTYEP---YLVTDDWPIHPSQI-DVQLTVGACWQGGEVTTPRFTQYFRGSLSGLTIRPGKIETQKVISCLQACKEGLDI-NSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYINSRQF---PTPGLRKLRVT--TTVQC------FGEDTCISIPDIKAVVMVLPPSEPRITIAGVERATWPASELRTPAGITLFKDIRIISTITKSDNAFSSGTAVPGILEVMHNLDYCDVLVIGEELNPEHESLEIHHSSLLGKHLDATNSTSGISIYGVDSMAHYEQAIRQVRY-RNRRPAGLSERRFRLSCSELNGRYTSNEFNLEIGVL 762          
BLAST of Calsyntenin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004811.1 (pep scaffold:Pmarinus_7.0:GL480969:15004:24793:1 gene:ENSPMAG00000004373.1 transcript:ENSPMAT00000004811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 4.576e-23
Identity = 80/277 (28.88%), Postives = 118/277 (42.60%), Query Frame = 2
Query:  584 ICKYDILPVNSVPFFIDKYGSLH-TQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSF--NIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLL----------KGAPDSMKD--HQIGGYRFSFSYVSVENTFDNTNYL-FGKRFSLTFWMKHGNM---LLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRF 1357
            +C Y IL   + PF ID  G +  T+++ Y   +    +  V A DC K +      LV + VR  C   W+G  K ++Y   SG   LF        L  C     S    +      +GK         C  +  + + R  LC A +G V+LL          +G P  + +     G   F F         D         RF+L  W++HG +        K+ ILCNSD   MNRHH S+++HNC+L+ L+R E   S+ D F P+E+ +
Sbjct:   54 VCDYQILTAGA-PFSIDSDGVIRATERLSY--ELHGEQQLTVAAYDCGKRR-SAEDALVTIGVRPVCRPGWQGWNKRVEYDPGSGGRALFP----GARLETCGRRVASARATVELQTAHIGKG--------CDRETYAENSRRKLCGASTGGVDLLPSPELPGSWTQGLPTEVPEGPDSTGERVFLFDGTRAALVPDAAVPANLTHRFTLAAWLRHGPLSGPAQRSEKEAILCNSDKAGMNRHHYSLYIHNCRLVFLLRSEF--SQTDTFRPAEFHW 312          
BLAST of Calsyntenin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009762.1 (pep scaffold:Pmarinus_7.0:GL478664:4830:30598:1 gene:ENSPMAG00000008824.1 transcript:ENSPMAT00000009762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.661e-14
Identity = 87/353 (24.65%), Postives = 148/353 (41.93%), Query Frame = 2
Query: 1370 QVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSV-------TMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC----QTGA---IIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNK-PIYLFSNVQFKRIGGDNVL--FKSCIVRPISYLLR-PWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            QVCD EWHHY IT++     L +DG  +      LV       P   + ++L +G+C+H     S  + Q F G +AG  ++   VE    V CL  C ESL LP    AL   SS        T  +  + V   ++  L     +++Y+NT        +D    ++    E  C    +  A   +++ E  +I L   +S ++     E  + ++     R V+    + P  + S+   + +  + +L     C V  +   L  P E    P +      +   +   G+   GV+SL  Y+ ++R + Y+    D L + R F L C+ L G+  +N   + V +L
Sbjct:    1 QVCDKEWHHYVITVDTPTVTLYVDGVSYQP---YLVTDDWPIRPGK-SQSQLAIGACWHGGEQPSPRFAQFFRGDIAGFTVLPGHVETQAVVACLHACKESLDLP----ALPNASSAVKVHFNPTRLTLTLEVEGHDLEQLTEAVKRVAYVNTRQFPTPGPRDLHLATVLHCVEEGCPDVPEVSAYVMVLQPEDPHIVLSGADSFARP--AGEFPDGVVLFPDLRVVSSVTREVPSDVRSSPGQEAVVSEEILHNLDRCEVAALGDPLEGPQERFEVPADQLSPQGLEVTSGPQGITISGVESLASYERVLRTVRYLHNNPDSLFERR-FRLTCSELNGRYASNSLPLDVTVL 342          
BLAST of Calsyntenin 1 vs. Ensembl Nematostella
Match: EDO40379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7D3])

HSP 1 Score: 82.8037 bits (203), Expect = 4.548e-16
Identity = 100/400 (25.00%), Postives = 175/400 (43.75%), Query Frame = 2
Query: 1145 FGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLI-RVENGGSEQDKFMPSEWRFGP---LRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLK--KLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESL----LLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINT--NPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLI---EIDSDRSVNGQLNKPI-----YLFSNVQFKRIGG-DNVLFKSCIVRPISYLLRPWESTNWXXXXXXXX-----XXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTK 2266
             G+ F+++FWM   +       Q IL +SD  + NR H +V L N   + +I R+E+   +Q++F  S + + P      + D +WHH+ I++N     L IDG+       V   R +   +L  + T +   VG+ +  K  +Y ++F G L+GM +  + + +  T+RCL  C E +     LPH   A     ++  F+  VI  +    D + +   L Y N    P +         R+  IDT    Q G  ++  + +I L   E  +K K+       LI   ++ +D      +  P+       F   + KR    +NV+F    V  +   L   ES N+P+ +  +       + +     G+V  GV   + Y+ ++R++ YV  K
Sbjct:  463 LGEEFTISFWMATKDKKKRKSDQVILDSSDANLHNRIHFAVTLKNHNQLFIIHRLESWQGKQNEFFKSTFLYRPDLWKINIADTKWHHFTISVNRSLVSLHIDGQ------HVGPHRTIPNFRLHASNTKSHAVVGAVWKGKDKKYEKHFRGFLSGMTVRPNKLTSKQTIRCLMGCREHINIGTSLPHGFTA-----TMPRFNTMVIKGTGRPVDFQKILQNLEYQNDLFTPTSGV-------RNFQIDT---TQNGVKLEKISVDIEL---EKNTKPKI------VLIGCGDVQADEERIAGVGVPVCRTLTLRFEGCKAKRESPVNNVMFLDEAVIKVEPALSQHESLNFPVGVRGSTILDDLELEASKTDDGVVIRGVADYKAYERVLREMTYVNKK 832          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:101174913])

HSP 1 Score: 211.46 bits (537), Expect = 4.353e-56
Identity = 224/796 (28.14%), Postives = 364/796 (45.73%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRIILAEN--ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTG--AIIKTETHNISLKIIESLSKTKLGSEKDESLI-------------EIDSD---RSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLR-PWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            + G + EN+  V L+P L I L ++  + ++ EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  +N   P F E +Y  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G + +T+K+ Y    M  YK  V A DC K +     VLV + V+ +C   W+G  K I+Y   +G + LF      PS+H+ + +    +I  +  +   +I       C  D  S      LC A SG V LL  AP S  +  IG     G+     F F+    + V N   +TN    + F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+LI L+R +   SE + + P+E+ +  L QVCD EWHHY + +      L +DG  +    E  +  +   L      T+LT+G+C+   +    Q F G+LAG+ +    +E    + CL TC E L +  + E +A    V    +   + V   +I+    +   +SY+N+      P      R + + T ++C             G   +++ E   ISL  I+  +++    E  E +              E+++D    + +G  + P    + V  + +   N+ F  C V  +   L    ES     +      +   +++ GL+  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +N+  V+V ++
Sbjct:   39 YHGIVTENDDKVLLDPPL-IALDKDAPLRYAGEICGFRIHGQN---VPFEAVVLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDINEYSPVFKEKTYKATV----LEGKKYDSILKVEAVDADCSFQFSQ-ICNYEIVTPD-VPFTIDKDGFIKNTEKLSYGKEHM--YKLTVTAYDCGKNRAS-EDVLVKISVKPTCKPSWQGFNKRIEYEPGTGSLALF------PSMHLETCDEPVSSIRASVELETNHIGKG----CDRDTYSEKSLHKLCGATSGTVELLP-APSSSANWTIGLPTDNGHDSDQVFEFNGTQAIKVPNGVVSTN--LKEPFTISVWMRHGPGAHE--KETILCNSDKTDMNRHHYSLYVHNCRLIFLLRQD--PSEAETYKPAEFHW-KLDQVCDKEWHHYVLNVEFPTASLFVDGTTF----EPFLVTEDYPLHATKIETQLTIGACWQGGNARMAQFFRGNLAGLIIRSGKLENKKVIDCLYTCKEGLDV-QLPEEVASSVKVEFNPNQSSLTVEGEDIDAFDKVMQHISYLNSRQFP-TPGI----RHLRVATTVKCFNEDACVSVPDAEGYVMVLQPEEPKISLSGIDHFARSAAEFESQEGVTLFPELRIVSTITREVEADTEPEAADGADDDPTVQETVVSEEIM--HNLDF--CEVSVMGEELDGEHESLEMDPSQLQQRALEMSSSNLGLIITGVNTMANYEQVLHLIRYKNWHTEALFD-RKFKLVCSELNGRYISNDFKVEVNVI 787          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:101174913])

HSP 1 Score: 199.904 bits (507), Expect = 3.129e-52
Identity = 227/822 (27.62%), Postives = 365/822 (44.40%), Query Frame = 2
Query:  140 FLGHLNENERIVKLNPELRII-------LAEN----ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHF-----SEKKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG-----GYR----FSFS---YVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKS---NE--------------YTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRC-----------QTG--AIIKTETHNISLKIIESLSKTKLGSEKDESLI-------------EIDSD---RSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLR-PWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQIL 2362
            + G + EN+  V L+P L  +        AE+    ++   EICG  IH +     PF   + DK  G   I+ KD ++  +L   +TF I+ YDC + P       S K  V +++  +N   P F E +Y  TV     EG K   I   E      S Q +Q IC Y+I+  + VPF IDK G + +T+K+ Y    M  YK  V A DC K +     VLV + V+ +C   W+G  K I+Y   +G + LF      PS+H+ + +    +I  +  +   +I       C  D  S      LC A SG V LL  AP S  +  IG     G+     F F+    + V N   +TN    + F+++ WM+HG       K+ ILCNSD   MNRHH S+++HNC+LI L+R +   SE + + P+E+ +  L QVCD EWHHY + +      L +DG  +    E  +  +   L      T+LT+G+C+   S   NE                Q F G+LAG+ +    +E    + CL TC E L +  + E +A    V    +   + V   +I+    +   +SY+N+      P      R + + T ++C             G   +++ E   ISL  I+  +++    E  E +              E+++D    + +G  + P    + V  + +   N+ F  C V  +   L    ES     +      +   +++ GL+  GV ++  Y+ ++  I Y     + L D R+F L+C+ L G+  +N+  V+V ++
Sbjct:   39 YHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTLTKEGEICGFRIHGQN---VPFEAVVLDKSTGEGVIRAKDKLD-CELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDINEYSPVFKEKTYKATV----LEGKKYDSILKVEAVDADCSFQFSQ-ICNYEIVTPD-VPFTIDKDGFIKNTEKLSYGKEHM--YKLTVTAYDCGKNRAS-EDVLVKISVKPTCKPSWQGFNKRIEYEPGTGSLALF------PSMHLETCDEPVSSIRASVELETNHIGKG----CDRDTYSEKSLHKLCGATSGTVELLP-APSSSANWTIGLPTDNGHDSDQVFEFNGTQAIKVPNGVVSTN--LKEPFTISVWMRHGPGAHE--KETILCNSDKTDMNRHHYSLYVHNCRLIFLLRQD--PSEAETYKPAEFHW-KLDQVCDKEWHHYVLNVEFPTASLFVDGTTF----EPFLVTEDYPLHATKIETQLTIGACWQENSGHDNETETAPEPTSGGNARMAQFFRGNLAGLIIRSGKLENKKVIDCLYTCKEGLDV-QLPEEVASSVKVEFNPNQSSLTVEGEDIDAFDKVMQHISYLNSRQFP-TPGI----RHLRVATTVKCFNEDACVSVPDAEGYVMVLQPEEPKISLSGIDHFARSAAEFESQEGVTLFPELRIVSTITREVEADTEPEAADGADDDPTVQETVVSEEIM--HNLDF--CEVSVMGEELDGEHESLEMDPSQLQQRALEMSSSNLGLIITGVNTMANYEQVLHLIRYKNWHTEALFD-RKFKLVCSELNGRYISNDFKVEVNVI 814          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: ENSORLT00000019547.3 (calsyntenin 2 [Source:NCBI gene;Acc:101159373])

HSP 1 Score: 189.504 bits (480), Expect = 5.738e-49
Identity = 211/797 (26.47%), Postives = 357/797 (44.79%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSE-----KKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSF-------SYVSVENTFDNTNYLFGKRFSLTFWMKHGNML-LNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMF----SDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQ--LNKPIYLFSNVQFKRIGGDNVL------FKSCIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYV 2389
            ++ G + EN  +V L+P L  +  +  + ++ EIC   IH       PF   + +   G  Q++ +  V+  +L   YTF I+ +DC   P  +E     K  V +++  VN   P F E  YH  V     EG     I   E      S Q +Q IC Y I   NS PF ID+ G++ +T+K+ Y  +  + Y+  V A DC + +  +  V V +DV+  C   W+GL K + Y   +G   LF      P +H+ +      ++  T  +   +I       C  +  S    + LC A SG+ +LL  AP            D+ +D  +  +RF          +V  +N  D        +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P  I   +LTVG+C+         +TQ F G L+G+ +    +E+   + CL  C E L + + +E+L  D S+          +++ + ++ ++     K++YIN+      P      R + + T ++C       T     ++ ++   S+ ++     E L    +D   +G   L + +++ S V      G  VL         C V  +   L P  ES     +  +  H+ + N++ G+   GV S+  Y+ ++R++ Y   K +   + R F L C+ L G+  +NE  ++V +L    N  +V
Sbjct:   39 SYHGVITENTDVVLLDPPLVALDKDAPVPYAGEICAFNIHGLDA---PFEAVVLNGTSGEGQLRARSLVD-CELQKEYTFIIQAHDCGSGPRGTEGKKSHKAVVHIQVDDVNEFAPVFREPQYHAAVT----EGKIYDSILQVEATDQDCSPQYSQ-ICNYQITTTNS-PFAIDRNGNIRNTEKLSY--DSQQHYEILVTAWDCGQKRA-LHPVPVHIDVKPVCKPGWQGLNKRVDYEPGTGSKQLF------PKMHLETCGEPLSSVRTTVELQTSHIGKG----CDRETYSEKSLQKLCGASSGSTDLLP-APSAATNWTASLLSDNGRDSDLI-FRFDGHQAAKIPDWVVPQNLTD--------QFTIATWMKHGPIPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--IQADAFRPAEFHWK-LEQICDKEWHYYVINVEFPAVTLFVDGVTYDP---YLVTDDWPIHPSQI-DVQLTVGACWQGGEVTKPRFTQYFRGSLSGLTVRPGKIESQKVISCLQACKEGLDI-NSLESL--DKSIKFHFNPAQSILVMEADDLQNMNTAVRKVAYINSRQFP-TPGI----RRLKVSTAVQCFGEDTCITIPDMDAVVMVLQPSEPRITISGAERLSRPAADFRASGGIFLFQDLHIISTVTRADTTG-GVLEEIIHNLDYCDVLVLGEELSPEHESLQLHRSSMLGKHLDATNSTSGMSIYGVDSMSTYEQVIRQVRYYNWKPEQQTERR-FRLTCSELNGRYTSNEFNLEVSVLHRSANMEHV 785          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: ENSORLT00000036418.1 (calsyntenin 2 [Source:NCBI gene;Acc:101159373])

HSP 1 Score: 186.422 bits (472), Expect = 4.089e-48
Identity = 212/819 (25.89%), Postives = 360/819 (43.96%), Query Frame = 2
Query:   98 VKFQSPIGVKDGW---AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSE-----KKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSF-------SYVSVENTFDNTNYLFGKRFSLTFWMKHGNML-LNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMF----SDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQ--LNKPIYLFSNVQFKRIGGDNVLFKS------------CIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYV 2389
            V F S +     W   ++ G + EN  +V L+P L  +  +  + ++ EIC   IH       PF   + +   G  Q++ +  V+  +L   YTF I+ +DC   P  +E     K  V +++  VN   P F E  YH  V     EG     I   E      S Q +Q IC Y I   NS PF ID+ G++ +T+K+ Y  +  + Y+  V A DC + +  +  V V +DV+  C   W+GL K + Y   +G   LF      P +H+ +      ++  T  +   +I       C  +  S    + LC A SG+ +LL  AP            D+ +D  +  +RF          +V  +N  D        +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P  I   +LTVG+C+         +TQ F G L+G+ +    +E+   + CL  C E L + + +E+L  D S+          +++ + ++ ++     K++YIN+      P      R + + T ++C       T     ++ ++   S+ ++     E L    +D   +G   L + +++ S V            +             C V  +   L P  ES     +  +  H+ + N++ G+   GV S+  Y+ ++R++ Y   K +   + R F L C+ L G+  +NE  ++V +L    N  +V
Sbjct:   25 VIFVSTVNKHKPWIETSYHGVITENTDVVLLDPPLVALDKDAPVPYAGEICAFNIHGLDA---PFEAVVLNGTSGEGQLRARSLVD-CELQKEYTFIIQAHDCGSGPRGTEGKKSHKAVVHIQVDDVNEFAPVFREPQYHAAVT----EGKIYDSILQVEATDQDCSPQYSQ-ICNYQITTTNS-PFAIDRNGNIRNTEKLSY--DSQQHYEILVTAWDCGQKRA-LHPVPVHIDVKPVCKPGWQGLNKRVDYEPGTGSKQLF------PKMHLETCGEPLSSVRTTVELQTSHIGKG----CDRETYSEKSLQKLCGASSGSTDLLP-APSAATNWTASLLSDNGRDSDLI-FRFDGHQAAKIPDWVVPQNLTD--------QFTIATWMKHGPIPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--IQADAFRPAEFHWK-LEQICDKEWHYYVINVEFPAVTLFVDGVTYDP---YLVTDDWPIHPSQI-DVQLTVGACWQGGEVTKPRFTQYFRGSLSGLTVRPGKIESQKVISCLQACKEGLDI-NSLESL--DKSIKFHFNPAQSILVMEADDLQNMNTAVRKVAYINSRQFP-TPGI----RRLKVSTAVQCFGEDTCITIPDMDAVVMVLQPSEPRITISGAERLSRPAADFRASGGIFLFQDLHIISTVTRADTTAHRTAHQGGVLEEIIHNLDYCDVLVLGEELSPEHESLQLHRSSMLGKHLDATNSTSGMSIYGVDSMSTYEQVIRQVRYYNWKPEQQTE-RRFRLTCSELNGRYTSNEFNLEVSVLHRSANMEHV 794          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: ENSORLT00000043712.1 (calsyntenin 2 [Source:NCBI gene;Acc:101159373])

HSP 1 Score: 186.422 bits (472), Expect = 4.440e-48
Identity = 208/803 (25.90%), Postives = 355/803 (44.21%), Query Frame = 2
Query:  137 AFLGHLNENERIVKLNPELRIILAEN-ISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSE-----KKYVLVEIGSVN--GPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSL-HTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAP------------DSMKDHQIGGYRFSF-------SYVSVENTFDNTNYLFGKRFSLTFWMKHGNML-LNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHS---KSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMF----SDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQ--LNKPIYLFSNVQFKRIGGDNVLFKS------------CIVRPISYLLRP-WESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICA-LKGKRYTNEHLVKVQILADDLNTYYV 2389
            ++ G + EN  +V L+P L  +  +  + ++ EIC   IH       PF   + +   G  Q++ +  V+  +L   YTF I+ +DC   P  +E     K  V +++  VN   P F E  YH  V     EG     I   E      S Q +Q IC Y I   NS PF ID+ G++ +T+K+ Y  +  + Y+  V A DC + +  +  V V +DV+  C   W+GL K + Y   +G   LF      P +H+ +      ++  T  +   +I       C  +  S    + LC A SG+ +LL  AP            D+ +D  +  +RF          +V  +N  D        +F++  WMKHG +  L   K+ +LCNSD   MNRHH S+++HNC+L+ L+R +    + D F P+E+ +  L Q+CD EWH+Y I +      L +DG  +      LV       P  I   +LTVG+C+         +TQ F G L+G+ +    +E+   + CL  C E L + + +E+L  D S+          +++ + ++ ++     K++YIN+      P      R + + T ++C       T     ++ ++   S+ ++     E L    +D   +G   L + +++ S V            +             C V  +   L P  ES     +  +  H+ + N++ G+   GV S+  Y+ ++R++ Y   K +   + R F L C+ L G+  +NE  ++V +L    N  +V
Sbjct:   32 SYHGVITENTDVVLLDPPLVALDKDAPVPYAGEICAFNIHGLDA---PFEAVVLNGTSGEGQLRARSLVD-CELQKEYTFIIQAHDCGSGPRGTEGKKSHKAVVHIQVDDVNEFAPVFREPQYHAAVT----EGKIYDSILQVEATDQDCSPQYSQ-ICNYQITTTNS-PFAIDRNGNIRNTEKLSY--DSQQHYEILVTAWDCGQKRA-LHPVPVHIDVKPVCKPGWQGLNKRVDYEPGTGSKQLF------PKMHLETCGEPLSSVRTTVELQTSHIGKG----CDRETYSEKSLQKLCGASSGSTDLLP-APSAATNWTASLLSDNGRDSDLI-FRFDGHQAAKIPDWVVPQNLTD--------QFTIATWMKHGPIPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF--IQADAFRPAEFHWK-LEQICDKEWHYYVINVEFPAVTLFVDGVTYDP---YLVTDDWPIHPSQI-DVQLTVGACWQGGEVTKPRFTQYFRGSLSGLTVRPGKIESQKVISCLQACKEGLDI-NSLESL--DKSIKFHFNPAQSILVMEADDLQNMNTAVRKVAYINSRQFP-TPGI----RRLKVSTAVQCFGEDTCITIPDMDAVVMVLQPSEPRITISGAERLSRPAADFRASGGIFLFQDLHIISTVTRADTTAHRTAHQGGVLEEIIHNLDYCDVLVLGEELSPEHESLQLHRSSMLGKHLDATNSTSGMSIYGVDSMSTYEQVIRQVRYYNWKPEQQTE-RRFRLTCSELNGRYTSNEFNLEVSVLHRSANMEHV 785          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000002834.1 (SMESG000002834.1)

HSP 1 Score: 1271.53 bits (3289), Expect = 0.000e+0
Identity = 608/612 (99.35%), Postives = 610/612 (99.67%), Query Frame = 2
Query:   32 MYIHKCLIIFLCFYEYRALEYNVKFQSPIGVKDGWAFLGHLNENERIVKLNPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIGGYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIR 1867
            MYIHKCLIIFLCFYEYRALEYNVKFQSPIGVKDGWAFLGHLNENERIVKL PELRIILAENISHSMEICGVYIHHEIYSLFPFV+EITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAY GAVNLLKGAPDSMKDHQIGG+RFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIR
Sbjct:    1 MYIHKCLIIFLCFYEYRALEYNVKFQSPIGVKDGWAFLGHLNENERIVKLTPELRIILAENISHSMEICGVYIHHEIYSLFPFVHEITDKKRGSIQIKLKDNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYPGAVNLLKGAPDSMKDHQIGGHRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDERERSITIDTEIR 612          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000002830.1 (SMESG000002830.1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 346/349 (99.14%), Postives = 347/349 (99.43%), Query Frame = 2
Query: 1865 RCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIXXXXXXXXXXXXXXXXXYYRKKIFVKSALAMKSGFKLSPKLMKLASKKPENGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 2911
            RCQTGAIIKTETHNISLKIIESLSKTKL SEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWESTNWPINIPINHHISSINNSHGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIV+LSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSP LMKLASKKPENGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV
Sbjct:   52 RCQTGAIIKTETHNISLKIIESLSKTKLSSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWESTNWPINIPINHHISSINNSHGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIVILSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSPNLMKLASKKPENGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 400          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000002830.1 (SMESG000002830.1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 343/350 (98.00%), Postives = 344/350 (98.29%), Query Frame = 2
Query: 1865 RCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWESTNWXXXXXXXXXXXXXXXXXGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIXXXXXXXXXXXXXXXXXYYRKKIFVKSALAMKSGFKLSPKLMKLASKKPE-NGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 2911
            RCQTGAIIKTETHNISLKIIESLSKTKL SEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWESTNWPINIPINHHISSINNSHGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIV+LSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSP LMKLASKKPE    PLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV
Sbjct:   52 RCQTGAIIKTETHNISLKIIESLSKTKLSSEKDESLIEIDSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWESTNWPINIPINHHISSINNSHGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIVILSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSPNLMKLASKKPEVRKCPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 401          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000002830.1 (SMESG000002830.1)

HSP 1 Score: 406.371 bits (1043), Expect = 4.986e-135
Identity = 225/227 (99.12%), Postives = 226/227 (99.56%), Query Frame = 2
Query: 2231 MLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIXXXXXXXXXXXXXXXXXYYRKKIFVKSALAMKSGFKLSPKLMKLASKKPENGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 2911
            MLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIV+LSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSP LMKLASKKPENGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV
Sbjct:    1 MLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIVILSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSPNLMKLASKKPENGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 227          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000002830.1 (SMESG000002830.1)

HSP 1 Score: 394.045 bits (1011), Expect = 2.230e-130
Identity = 222/228 (97.37%), Postives = 223/228 (97.81%), Query Frame = 2
Query: 2231 MLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIXXXXXXXXXXXXXXXXXYYRKKIFVKSALAMKSGFKLSPKLMKLASKKPE-NGSPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 2911
            MLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIV+LSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSP LMKLASKKPE    PLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV
Sbjct:    1 MLMRKIYYVTTKVDPLLDNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDNGQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIVILSVLVVASVVLSLVVYYRKKIFVKSALAMKSGFKLSPNLMKLASKKPEVRKCPLPNVYDDVNSINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAWVNKFNHPVDV 228          
The following BLAST results are available for this feature:
BLAST of Calsyntenin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLSTN29.852e-5029.16calsyntenin 2 [Source:HGNC Symbol;Acc:HGNC:17448][more]
CLSTN13.088e-4826.54calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
CLSTN11.406e-4726.25calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
CLSTN15.307e-3925.75calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
CLSTN32.249e-3428.01calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
casy-15.843e-4026.19CAlSYntenin/Alcadein homolog; Calsyntenin [Source... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cals9.464e-3725.62gene:FBgn0039928 transcript:FBtr0333700[more]
Cals1.143e-3625.62gene:FBgn0039928 transcript:FBtr0089207[more]
Cals1.143e-3625.62gene:FBgn0039928 transcript:FBtr0089208[more]
Cals1.143e-3625.62gene:FBgn0039928 transcript:FBtr0345193[more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn19.736e-5927.75calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
clstn14.751e-5727.46calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
clstn13.957e-5527.20calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
clstn21.080e-4626.62calsyntenin 2 [Source:ZFIN;Acc:ZDB-GENE-070911-2][more]
BX001019.12.447e-3827.75calsyntenin 3 [Source:NCBI gene;Acc:555627][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLSTN17.692e-5127.03calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN11.712e-5027.00calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN15.412e-5027.07calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN15.858e-4927.14calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN13.592e-4826.97calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clstn26.110e-4928.64calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897][more]
Clstn26.982e-4928.64calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897][more]
Clstn12.084e-4826.78calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895][more]
Clstn11.976e-4726.94calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895][more]
Clstn31.222e-3427.47calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323][more]
back to top
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Q0N0|CSTN1_RAT5.966e-5127.27Calsyntenin-1 OS=Rattus norvegicus OX=10116 GN=Cls... [more]
sp|Q9H4D0|CSTN2_HUMAN4.731e-4929.16Calsyntenin-2 OS=Homo sapiens OX=9606 GN=CLSTN2 PE... [more]
sp|Q8VDA1|CSTN2_RAT2.931e-4828.47Calsyntenin-2 OS=Rattus norvegicus OX=10116 GN=Cls... [more]
sp|Q9ER65|CSTN2_MOUSE4.274e-4828.64Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 P... [more]
sp|O94985|CSTN1_HUMAN6.753e-4726.25Calsyntenin-1 OS=Homo sapiens OX=9606 GN=CLSTN1 PE... [more]
back to top
BLAST of Calsyntenin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R9X69.060e-6230.32Calsyntenin-3 OS=Fasciola hepatica OX=6192 GN=D915... [more]
R7UQC11.721e-6128.42Uncharacterized protein OS=Capitella teleta OX=283... [more]
V5GXS32.252e-6129.03Putative calsyntenin (Fragment) OS=Ixodes ricinus ... [more]
V5H8Z85.468e-6129.03Putative calsyntenin OS=Ixodes ricinus OX=34613 PE... [more]
A0A183A6Y35.975e-6028.23Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn11.598e-5628.33calsyntenin 1 [Source:NCBI gene;Acc:103033297][more]
clstn16.306e-5327.77calsyntenin 1 [Source:NCBI gene;Acc:103033297][more]
clstn21.460e-4626.22calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
clstn21.536e-4626.22calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
clstn23.436e-4626.07calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004811.14.576e-2328.88pep scaffold:Pmarinus_7.0:GL480969:15004:24793:1 g... [more]
ENSPMAT00000009762.11.661e-1424.65pep scaffold:Pmarinus_7.0:GL478664:4830:30598:1 ge... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calsyntenin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403794.548e-1625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn14.353e-5628.14calsyntenin 1 [Source:NCBI gene;Acc:101174913][more]
clstn13.129e-5227.62calsyntenin 1 [Source:NCBI gene;Acc:101174913][more]
ENSORLT00000019547.35.738e-4926.47calsyntenin 2 [Source:NCBI gene;Acc:101159373][more]
ENSORLT00000036418.14.089e-4825.89calsyntenin 2 [Source:NCBI gene;Acc:101159373][more]
ENSORLT00000043712.14.440e-4825.90calsyntenin 2 [Source:NCBI gene;Acc:101159373][more]
back to top
BLAST of Calsyntenin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002834.10.000e+099.35SMESG000002834.1[more]
SMESG000002830.10.000e+099.14SMESG000002830.1[more]
SMESG000002830.10.000e+098.00SMESG000002830.1[more]
SMESG000002830.14.986e-13599.12SMESG000002830.1[more]
SMESG000002830.12.230e-13097.37SMESG000002830.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002038 ID=SMED30002038|Name=Calsyntenin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3075bp
CAAGGTTATACTAACTTGATTAATTGAAATAATGTATATTCACAAATGTT
TAATTATTTTTCTATGTTTTTATGAGTATCGCGCCCTTGAATATAATGTA
AAATTTCAATCTCCAATCGGCGTTAAAGACGGCTGGGCTTTCCTTGGTCA
TTTAAATGAAAATGAAAGAATTGTCAAATTAAATCCCGAACTAAGGATAA
TTCTTGCAGAAAATATTAGCCATTCCATGGAGATTTGCGGTGTCTACATA
CATCATGAAATCTATTCATTGTTTCCATTTGTAAATGAAATTACTGATAA
GAAACGAGGAAGTATTCAAATTAAATTAAAAGATAATGTGAATTATGCCG
ATTTGATGGATCGATATACATTTCAAATAGAGGTCTACGATTGCGATCAG
CCACCACATTTCAGTGAAAAGAAATATGTTCTAGTAGAAATTGGGTCTGT
CAACGGTCCGAGATTTCTTGAATCATCGTATCATTTCACAGTGAACTATT
CCGTCCCAGAAGGCACCAAGATCGGAGAAATTTCTGCCTATGAGCGGCCT
GGTATTAGCCAATCCAGCCAGCCTAATCAAGGGATATGCAAATACGATAT
TTTGCCAGTGAATTCTGTTCCATTTTTCATTGATAAATATGGTTCTCTGC
ATACTCAGAAAGTTGAATACCTTCCTAATGTTATGCGAACATACAAATTC
TATGTGCGAGCCACTGATTGTGATAAATATCAACCCCGTATCGCATCAGT
TTTAGTTATTGTCGATGTCAGGGACTCATGCACTGTCCACTGGGAAGGGT
TACCGAAGAGTATCAAGTATATTCGCAACAGTGGAGTTATGCCATTATTT
TCAATGCAATCTACCTCTCCTAGTTTGCATGTTTGCTCAAGCAACTGTCT
TAGTTTCAATATCTTTTTCACGGCTCGGATTGTCGGAAAGAATATAAAAT
TTGCAGCACCGGAACTATGCAAGCATGATCTAAACTCAATCCATAGGCGA
GAGGTTCTCTGTGATGCATATTCTGGAGCGGTTAATCTCTTAAAAGGAGC
TCCTGATTCAATGAAAGATCATCAAATTGGCGGATATCGCTTTTCGTTCT
CTTACGTTTCTGTCGAAAATACTTTTGATAATACAAACTATCTCTTTGGA
AAAAGATTTTCACTCACTTTTTGGATGAAGCATGGAAATATGCTTCTAAA
CGACCCAAAACAGCAAATTCTATGCAATTCCGATTTGAAAGTGATGAACA
GGCATCACACCAGTGTGTTCCTGCATAATTGCAAACTCATTTTGCTAATC
CGAGTAGAGAATGGAGGATCTGAACAAGATAAATTTATGCCTTCTGAATG
GAGATTTGGACCATTGAGACAAGTTTGTGACAACGAATGGCATCATTATG
GAATTACAATGAATGATGGCAATCCTATACTTCAAATAGATGGTGAAATC
TGGTCGAAACCTCCTGAAGTTCTTGTGGAAAGACAACTAAAGAAGTTGCC
TGAGAATATTACTGGTACCCGTTTAACGGTCGGAAGTTGCTATCATTCTA
AGTCCAATGAATATACGCAGAATTTCTTTGGACATCTGGCTGGAATGAGA
TTGATACGGGACTTTGTAGAAGCTGTAAACACAGTTCGTTGTCTGGCAAC
TTGTGGAGAATCTTTACTCTTGCCTCATATTGTAGAAGCATTAGCAAAGG
ATTCGTCAGTAACAATGTTCAGTGATTACGTTATAGTCAGAAGCATTAAT
ATCAATGATTTAAAGCTCATGTTCTCAAAACTATCGTATATCAACACGAA
CCCGTTGACCGAGAAACCAAATAAAGACGAAAGAGAAAGAAGCATTACAA
TTGATACAGAAATCAGATGCCAGACTGGGGCAATCATTAAAACCGAGACA
CATAACATTTCTTTAAAAATTATAGAATCGTTGTCAAAGACAAAATTAGG
TTCCGAGAAAGATGAATCTTTGATCGAGATTGATTCAGATCGAAGCGTAA
ACGGGCAATTGAATAAACCTATCTATCTATTCTCTAATGTCCAATTCAAG
AGAATAGGTGGGGATAACGTTCTATTCAAGTCATGCATAGTACGTCCTAT
TTCCTACCTCCTGCGACCTTGGGAATCCACCAATTGGCCAATAAATATTC
CCATTAATCACCATATATCGAGCATTAACAATTCTCATGGACTGGTATTT
GAAGGCGTTCAATCTTTGGAAGTTTATCAAATGTTAATGAGGAAAATTTA
TTATGTCACGACAAAAGTTGATCCTCTACTCGACAATAGGGAATTCGGAT
TGATATGTGCATTGAAAGGAAAAAGATATACAAATGAGCATCTAGTTAAG
GTGCAAATATTAGCGGACGACCTGAACACGTATTACGTTGTGGATGATCA
AACAAGTGGGAAAAGCGATCCGAGTGACAACGGTCAAGTTCTACATGCGG
GAAATGATAGGATCGGATTTACGGATAAAACATTTATTGATAAAAAAAGA
AAATCTTCGTCAAGCAAAAATCCTTTTCTTTTGCCTATCATTGTAGTTCT
TTCAGTTCTCGTTGTTGCTAGTGTCGTACTTTCCTTAGTGGTATACTATC
GAAAAAAGATATTTGTCAAATCAGCACTCGCTATGAAATCGGGCTTCAAA
TTGAGTCCCAAGTTAATGAAATTGGCATCCAAAAAACCTGAAAATGGCAG
CCCGTTGCCCAATGTATATGATGATGTTAACAGTATTAATAGTGACTGCC
CAGAATCAGGGGATGAGCAAGATATAGACGAAACAGAGCAGTTGCGTCCG
GATGATGACGAGAATTCCAATGAGAGTATTAGTGGTAGAATAGAGATTCC
AGCCTACATGAATTTGTCCAGCAAAGCCTGGGTCAATAAATTTAACCACC
CAGTTGATGTTTAAAACAAAATACATTCAAAGTTTATTAAAATTTCACTA
TCGATTTGTTTTAACACTTTCACTTTTAAATTTGTTTTGCTTTATAATTT
ATTGAATGTTATGATTTGCAAATCGTCATGCACTTGCTATTTTATTTGTT
ATCAATAAATATTTTATCACCGAAA
back to top

protein sequence of SMED30002038-orf-1

>SMED30002038-orf-1 ID=SMED30002038-orf-1|Name=SMED30002038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=961bp
MYIHKCLIIFLCFYEYRALEYNVKFQSPIGVKDGWAFLGHLNENERIVKL
NPELRIILAENISHSMEICGVYIHHEIYSLFPFVNEITDKKRGSIQIKLK
DNVNYADLMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSY
HFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFI
DKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSC
TVHWEGLPKSIKYIRNSGVMPLFSMQSTSPSLHVCSSNCLSFNIFFTARI
VGKNIKFAAPELCKHDLNSIHRREVLCDAYSGAVNLLKGAPDSMKDHQIG
GYRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNS
DLKVMNRHHTSVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCD
NEWHHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTV
GSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHI
VEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYINTNPLTEKPNKDE
RERSITIDTEIRCQTGAIIKTETHNISLKIIESLSKTKLGSEKDESLIEI
DSDRSVNGQLNKPIYLFSNVQFKRIGGDNVLFKSCIVRPISYLLRPWEST
NWPINIPINHHISSINNSHGLVFEGVQSLEVYQMLMRKIYYVTTKVDPLL
DNREFGLICALKGKRYTNEHLVKVQILADDLNTYYVVDDQTSGKSDPSDN
GQVLHAGNDRIGFTDKTFIDKKRKSSSSKNPFLLPIIVVLSVLVVASVVL
SLVVYYRKKIFVKSALAMKSGFKLSPKLMKLASKKPENGSPLPNVYDDVN
SINSDCPESGDEQDIDETEQLRPDDDENSNESISGRIEIPAYMNLSSKAW
VNKFNHPVDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR026914Calsyntenin
IPR002126Cadherin-like_dom
IPR013320ConA-like_dom_sf
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0048670regulation of collateral sprouting
GO:1990126retrograde transport, endosome to plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 141..252
e-value: 8.6E-9
score: 37.8
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 337..520
e-value: 5.4E-9
score: 38.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 909..924
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 906..934
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 149..248
e-value: 9.31704E-7
score: 46.1526
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.483
NoneNo IPR availableTMHMMTMhelixcoord: 832..854
IPR026914CalsynteninPANTHERPTHR14139CALSYNTENINcoord: 710..849
coord: 43..616
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 368..541
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 141..248