Trans-aconitate 2-methyltransferase

Overview
NameTrans-aconitate 2-methyltransferase
Smed IDSMED30002026
Length (bp)973
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Trans-aconitate 2-methyltransferase (SMED30002026) t-SNE clustered cells

Violin plots show distribution of expression levels for Trans-aconitate 2-methyltransferase (SMED30002026) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Trans-aconitate 2-methyltransferase (SMED30002026) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Trans-aconitate 2-methyltransferase (SMED30002026) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002026

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30002026SMESG000038731.1 SmedASXL_011160SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002026SMESG000038731.1 dd_Smed_v6_14219_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002026SMESG000038731.1 dd_Smed_v4_14219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002026SMESG000038731.1 dd_Smed_v4_14219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Trans-aconitate 2-methyltransferase vs. UniProt/SwissProt
Match: sp|Q91FT7|235L_IIV6 (Putative methyltransferase 235L OS=Invertebrate iridescent virus 6 OX=176652 GN=IIV6-235L PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.148e-10
Identity = 54/218 (24.77%), Postives = 103/218 (47.25%), Query Frame = 1
Query:  181 ATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVD-PIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFLLPFLNFIPCHLREEFMKEFLSD 831
            A+ K ++++GCG G IT++     K  S +GID+    ++YA+E          Y   D   M+   E + K  D+  V+S F L W+ +    F  IS+ +  G + + ++ +  +   + L+        WK+++ +       L+ +   IY ++  I+    ++F++Y    +P T  F+  +    F+  +LP LN +    RE F+ E L+D
Sbjct:   44 ASNKTVIDIGCGNGKITNYISSLVKDGSVIGIDKDSSMIKYAKE---------TYPNVDFKVMDIQNENIDKKYDI--VVSFFCLPWIVNKQASFHHISNMMKSGSKLYILAAI-METNHVTLINNLMKKDHWKLFFVNYSSPFDYLNDIQYDIYANQSGIE---QKKFKVY---NIPYT--FKDRQSLHKFNLAILPQLNQLSIEHREIFITELLND 241          
BLAST of Trans-aconitate 2-methyltransferase vs. UniProt/SwissProt
Match: sp|B3PTJ5|TAM_RHIE6 (Trans-aconitate 2-methyltransferase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=tam PE=3 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.930e-8
Identity = 51/234 (21.79%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  184 TYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEEL-----IDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLV---PVTNHFESVEMGKLFHRFLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDD 861
            + ++ ++LGCG G  T+  IE F  E   G+D   + LE AR+    ++    + + DL + +  +         DL+ ++ V  W+ D +++F  +   L+PG     +  V   + L     + + E+    P WK  +++         R  P+ P   +   ++ +  +I +   +   P+ +  + VE  K     L+P+L       RE F+ ++L    KA   + D
Sbjct:   30 SLRRAVDLGCGPGNSTELIIERFGAEGVSGLDSDVNMLEAARKRLPGTA----FVEADLGSWQPTEP-------ADLLFANAVFQWLPDHLDIFDRLMDGLSPG----GVLAVQMPDNLGEASHLAMEESAHAGP-WKAAFEEKS------VRRQPLAPPSAYYSRLIGKAARIDIWHTIYNHPMADAADIVEWVK--GTGLMPYLAHAGEAYREAFLADYLERIEKAYPKMSD 239          
BLAST of Trans-aconitate 2-methyltransferase vs. UniProt/SwissProt
Match: sp|C0Z787|BIOC_BREBN (Malonyl-[acyl-carrier protein] O-methyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) OX=358681 GN=bioC PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.879e-7
Identity = 32/136 (23.53%), Postives = 60/136 (44.12%), Query Frame = 1
Query:   91 ALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGV 498
            A+S  +Y L  K    ++S+M+    + N+   + +LE+GCGTG +T     YF    +  ++  +  LE A+ N  +  +   + + D       ++   K    DL++S     W   P    + ++  L PG 
Sbjct:   14 AVSYEKYALVQKKMADHLSQMVTE--ITNENDVRSILEIGCGTGGLTRVIRSYFSAAHYEAVEIAQGMLEQAKNNLEQHGLICSFSQADAEEWVWEQQAKSK----DLIVSGACFQWFARPAHTLRGLARILKPGA 143          
BLAST of Trans-aconitate 2-methyltransferase vs. UniProt/SwissProt
Match: sp|C5BMZ8|BIOHC_TERTT (Biotin biosynthesis bifunctional protein BioHC OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) OX=377629 GN=bioC PE=3 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.884e-6
Identity = 43/168 (25.60%), Postives = 80/168 (47.62%), Query Frame = 1
Query:   82 SFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYF----KPESFL-GIDEVEHYLEYARENHSKSSI--EIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYE 564
            SFS+ +  EY+   +  K  V  +++  +    +  + LL+LGCGTG   +  ++ F    +PE  +  +D  E  L+ A++   +  +  +I +   D+ ++  + E        D  ISS  + W E+P++LF  +   L PG   F +S +   E L +L  A+ 
Sbjct:  302 SFSS-AAQEYDTLARLQKRVVDSLVEFSLGTGGSVGQTLLDLGCGTGYCIERLLQQFPEITQPEGRIHALDIAEGMLDRAQQKFDELGVAEQINWHLGDMESLPFVDE------SFDGCISSLTVQWSENPLQLFSEMYRALKPG-GWFALSTLG-PETLFELRSAWR 460          
BLAST of Trans-aconitate 2-methyltransferase vs. TrEMBL
Match: A0A443S2W9 (Juvenile hormone acid methyltransferase-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_14090 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 6.040e-12
Identity = 64/246 (26.02%), Postives = 116/246 (47.15%), Query Frame = 1
Query:  106 EYELCGKNTKLYVSKM--IQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDL-NNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDIC-KLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFL------LPFLNFIPCHLREEFM 813
            +Y  C +  +   +K+  I + V+     +  ++++GCGTG +T  +++  K +  +  D+ E  +E+A EN+  S  EI Y+  D+ ++ ++LK  L      DLV S +  HWV D  + F  IS  L PG + F I +  +  +L      +  +  W  Y++++  K+  L      + P  D  +    Q  + +  +   +T   E V   K F+ F+       PF+ +IP   R+EFM
Sbjct:    7 QYNDCNELQRYEAAKLFSIITQVVGPSPKFGIVVDIGCGTGNVTLDFLQLVKCDQLIAFDKSEFMIEFATENNKSS--EINYKVADIRDDFQKLKFDLNIVERADLVFSVYCFHWVVDKSKAFHNISQLLKPGGKCFLIFI--YWSDLFAYQRQFVLNSKWSEYFENLDEKMSSLAPAYTAVLPDIDHTRKKWTQLLESFGFEKCKITVE-EDVHFFKEFNVFMYDFQSVCPFIYYIPTAKRDEFM 247          
BLAST of Trans-aconitate 2-methyltransferase vs. TrEMBL
Match: A0A443SDF5 (Methyltransf_25 domain-containing protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_03586 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 7.913e-12
Identity = 67/253 (26.48%), Postives = 123/253 (48.62%), Query Frame = 1
Query:  151 MIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDL-NNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLE-QLVPVTNHFESVEMGKL----FHRFLL------PFLNFIPCHLREEFMKEFLSDSRK----ACRSVDD 861
            MIQ    P+ A +  ++++GCGTG +T  ++   + +  +  D+ +  +E+ARE     S E+ YE  D+ +N +ELK  +K +   DLV S + LHWV++  + F+ I+  L PG + + + +  +  +L      +     WK Y   I  +  +LS   P + +   +  I D   ++    ++   T    +++  K     F+ F+L      P++NF+P   R EF K++    RK      ++VDD
Sbjct:   25 MIQHDFGPS-AKFGTVVDIGCGTGNVTLDFLNSSQCDQLIAFDKNKSMIEFARE--INKSDEVNYEVADISDNFDELKYNIKLSKKADLVFSVYCLHWVQNKTKAFENINRFLKPGGKCYLLFM--YWSDLYMCDNEFILSSKWKKY---IPNIDEMLSTSAPFHKAS--LPNIADSTKKLKESMEIAGFTKCEVTIKQEKYFFEEFNHFMLDFHSVCPYVNFVPASERNEFFKDYFDFLRKNYNTGSKNVDD 267          
BLAST of Trans-aconitate 2-methyltransferase vs. TrEMBL
Match: A0A1U7N2F8 (SAM-dependent methyltransferase OS=Moorea bouillonii PNG OX=568701 GN=BJP37_15010 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.469e-11
Identity = 58/208 (27.88%), Postives = 94/208 (45.19%), Query Frame = 1
Query:  196 LLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNP-GVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFL-LPFLNFIPCHLREEFM 813
            LL++GCG G IT  +       S LGID  +  +E AR    K+   ++Y   D   M+     +  N   D++ S+ VLHW+ D   + K++ ++L P G   F +       EL+  ++     P WK Y+ D    P         Y  +++ +W+ +  F+    QL+P     +  E  K + R    P+ N IP  LRE F+
Sbjct:   38 LLDIGCGDGKITAEFASILNKGSVLGIDSSKTMVELAR----KTFPGVEYPNLDFKLMDATA--INLNHGFDVIFSNAVLHWINDHGSVLKSVRNHLKPHGKLLFQMGGKGNARELLLFIDEIITAPDWKEYFIDF-NFPY------SFYGIEEYQRWLPENGFKAQRVQLIPKDMQHQGKERLKGWLRTTWFPYTNRIPQKLRETFL 232          
BLAST of Trans-aconitate 2-methyltransferase vs. TrEMBL
Match: A0A443S391 (Phosphomethylethanolamine N-methyltransferase-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_05567 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.236e-11
Identity = 64/253 (25.30%), Postives = 113/253 (44.66%), Query Frame = 1
Query:  190 KKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEK-CDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQ----------DICKLPPLLSRVD----PIYPSKD----FIQW--ILD----QRFQIYLEQLVPVTNHFESV--EMGKLFHRFLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDDKV 867
            K ++++GCGTG +T   + +   +  +  D+ +  +E+AR+ H  + I  +    CD     +LK  +  N +VD+V S   LHW+ D  +  + IS  L PG + +  +++ F  +++ L E     P W  Y+           D C  P    R      P+Y   D      +W  + D       Q+ +++ V   + F     E+  L H     FL +IP  L++EF+ ++  D  K C + D K+
Sbjct:   36 KSVIDVGCGTGNVTADILRFTDCDKLIAFDKSDSMIEFARQRHRNAKISFQIADICD--EWSKLKSDINLNEEVDVVFSVHCLHWITDKAKAIENISKMLKPGGQCY--ALLFFWSDILPLQEQITHFPKWNKYFSHLEKSDVTTTDKCLSPGKQRRRSSAPFPVYLRSDEQATINEWKSLCDSSGFSETQVSVKKSVFCFDDFTGFKDEVTSLCH-----FLRYIPDTLKQEFLNDYF-DHVKNCYTSDQKI 278          
BLAST of Trans-aconitate 2-methyltransferase vs. TrEMBL
Match: A0A1D9G3E6 (SAM-dependent methyltransferase OS=Moorea producens JHB OX=1454205 GN=BJP36_21820 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.695e-11
Identity = 59/208 (28.37%), Postives = 94/208 (45.19%), Query Frame = 1
Query:  196 LLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNP-GVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFL-LPFLNFIPCHLREEFM 813
            LL++GCG G IT  +    K  S LGID  +  +E AR    K+   +KY   +   M+     +  N   D+V S+ VLHW+ D   + K + ++L P G   F +       EL+ ++E    +  WK Y+ D    P         Y  +D+  W+ +  F+    QL+P     +  E  K + R    P+ N +P  L+E F+
Sbjct:   38 LLDIGCGDGKITAEFASIIKNGSVLGIDSSQTMVELAR----KTFPAVKYPNLEFKFMDATS--INLNHSFDVVFSNAVLHWINDHGSVLKGVRNHLKPHGKLLFQMGGKGNARELLLIIEEVITYTDWKEYFIDFT-FPY------SFYGIEDYQTWLPENGFKAERLQLIPKDMQHQGKEGLKGWLRTTWFPYTNRLPQELKETFL 232          
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Yeast
Match: CRG1 (S-AdoMet-dependent methyltransferase involved in lipid homeostasis; mediates resistance to a drug cantharidin [Source:SGD;Acc:S000001252])

HSP 1 Score: 45.4394 bits (106), Expect = 5.317e-6
Identity = 41/128 (32.03%), Postives = 63/128 (49.22%), Query Frame = 1
Query:  178 KATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNL-NPGVEHFHISVVNFQEELIDLVEA 558
            K T K L+++GCGTG  T     YFK    +GID     L  A +  ++  ++ K    +    E+L  I  ++  VD+VIS+  +HW  +   LF+ +SS L + G   F   +   Q E +D  EA
Sbjct:   36 KGTRKSLVDIGCGTGKATFVVEPYFK--EVIGIDPSSAMLSIAEKETNERRLDKKIRFINAPG-EDLSSIRPES--VDMVISAEAIHWC-NLERLFQQVSSILRSDGTFAFWFYI---QPEFVDFPEA 154          
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Nematostella
Match: EDO27174 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9Z7])

HSP 1 Score: 58.151 bits (139), Expect = 6.620e-10
Identity = 36/106 (33.96%), Postives = 56/106 (52.83%), Query Frame = 1
Query:  181 ATYKKLLELGCGTGTITDFYIEYFKPE-SFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPG 495
            AT K +L+LGCGTG +T      F  + S +GID  ++ +E A+ NH  +   +++ +    +   L E        DLV S+FVLHW+    + F+ I  +L PG
Sbjct:   34 ATAKFVLDLGCGTGDVTGAMAANFSNDASIIGIDPDKYRVELAKSNHCSN---VQFLQGSAESFPHLGEEY-----YDLVFSNFVLHWIPQRTKAFRDIYDSLKPG 131          
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Nematostella
Match: EDO30845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN3])

HSP 1 Score: 58.151 bits (139), Expect = 7.134e-10
Identity = 36/106 (33.96%), Postives = 56/106 (52.83%), Query Frame = 1
Query:  181 ATYKKLLELGCGTGTITDFYIEYFKPE-SFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPG 495
            AT K +L+LGCGTG +T      F  + S +GID  ++ +E A+ NH  +   +++ +    +   L E        DLV S+FVLHW+    + F+ I  +L PG
Sbjct:   34 ATAKFVLDLGCGTGDVTGAMAANFSNDASIIGIDPDKYRVELAKSNHCSN---VQFLQGSAESFPHLGEEY-----YDLVFSNFVLHWIPQRTKAFRDIYDSLKPG 131          
BLAST of Trans-aconitate 2-methyltransferase vs. Planmine SMEST
Match: SMESG000038731.1 (SMESG000038731.1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 273/276 (98.91%), Postives = 276/276 (100.00%), Query Frame = 1
Query:   79 MSFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDDKVTWKYNLFLFHTKN 906
            MSFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHW+EDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMG+LFH+FLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDDKVTWKYNLFLFHTKN
Sbjct:    1 MSFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWLEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGELFHKFLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDDKVTWKYNLFLFHTKN 276          
BLAST of Trans-aconitate 2-methyltransferase vs. Planmine SMEST
Match: SMESG000038734.1 (SMESG000038734.1)

HSP 1 Score: 305.449 bits (781), Expect = 1.025e-103
Identity = 144/276 (52.17%), Postives = 202/276 (73.19%), Query Frame = 1
Query:   79 MSFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDDKVTWKYNLFLFHTKN 906
            MSF AL+  +Y+  G+ T+ +V  M+  +V+P K TYKK+L+LGCGTG ITDF+IE+FKPESF+GID  E +L + R+    S+IEIKYEKC+LN+MEELKEILK + D+DLV+SSFVLHW+ DPI LF+T+S  LN  VEH HISV N   +LIDL+  YE HP WK YY+D C++PPL +R++PI+ SK+F + ILD +F+IYL+  +P+ + F + E+  +F +F+LPF   IP HL +EF+ EF+++S    R+ + +  W Y+ F+ H KN
Sbjct:    1 MSFLALTEEDYDKYGQITQSFVKGMMTKFVIPKKKTYKKMLDLGCGTGNITDFFIEFFKPESFIGIDTNESFLNFGRQRPYISTIEIKYEKCNLNDMEELKEILKNHPDIDLVVSSFVLHWINDPITLFQTLSLCLNGHVEHAHISVRNIPIDLIDLIGEYENHPKWKTYYEDKCQIPPLFNRIEPIFSSKEFYEKILDHKFEIYLQTSIPICHQFVTDELFTIFIKFILPFTKHIPKHLHDEFINEFVNNSSGFYRNDNGRYAWDYDFFVCHAKN 276          
BLAST of Trans-aconitate 2-methyltransferase vs. Planmine SMEST
Match: SMESG000038735.1 (SMESG000038735.1)

HSP 1 Score: 253.832 bits (647), Expect = 2.058e-83
Identity = 120/275 (43.64%), Postives = 185/275 (67.27%), Query Frame = 1
Query:   79 MSFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTITDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEELKEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNFQEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQRFQIYLEQLVPVTNHFESVEMGKLFHRFLLPFLNFIPCHLREEFMKEFLSDSRKACRSVDDKVTWKYNLFLFHTK 903
            M F A++G EY+             I+  V+P K +Y KLL++G GTG+ TDF ++++ P+SFLG+D+ E +LEYAR+   KSS+EI YEKCD  + ++LK++L+K+ D+DLV+SS  +H++ DPI+LF+T  S L   VEH H+SV    +ELID VE Y  H  WK+Y++   ++ P+ S  + +YPS+  ++ +LD  ++I+LE+  PV+N F S E  K  +R LLP +  IP HL+ EF+ EF+++SR  CR+ ++KV W+Y+LF+ H K
Sbjct:    1 MHFFAINGDEYDEFMGYVNKTSKNAIKYNVVPLKKSYNKLLDIGSGTGSFTDFLVDFYHPKSFLGLDQSEGFLEYARQRTYKSSVEINYEKCDFGDPKQLKKVLRKHPDIDLVVSSHSIHFLNDPIKLFETFISCLTGDVEHVHVSVRKLSQELIDFVENYRNHQEWKIYFEKDYQVSPMFSSDETVYPSEKSLRQLLDLNYKIHLEKFFPVSNEFYSYEQLKYVYRSLLPLMQIIPDHLKNEFIDEFMAESRNLCRNTENKVFWQYDLFILHAK 275          
The following BLAST results are available for this feature:
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q91FT7|235L_IIV65.148e-1024.77Putative methyltransferase 235L OS=Invertebrate ir... [more]
sp|B3PTJ5|TAM_RHIE61.930e-821.79Trans-aconitate 2-methyltransferase OS=Rhizobium e... [more]
sp|C0Z787|BIOC_BREBN4.879e-723.53Malonyl-[acyl-carrier protein] O-methyltransferase... [more]
sp|C5BMZ8|BIOHC_TERTT2.884e-625.60Biotin biosynthesis bifunctional protein BioHC OS=... [more]
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443S2W96.040e-1226.02Juvenile hormone acid methyltransferase-like prote... [more]
A0A443SDF57.913e-1226.48Methyltransf_25 domain-containing protein OS=Lepto... [more]
A0A1U7N2F81.469e-1127.88SAM-dependent methyltransferase OS=Moorea bouillon... [more]
A0A443S3912.236e-1125.30Phosphomethylethanolamine N-methyltransferase-like... [more]
A0A1D9G3E62.695e-1128.37SAM-dependent methyltransferase OS=Moorea producen... [more]
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CRG15.317e-632.03S-AdoMet-dependent methyltransferase involved in l... [more]
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO271746.620e-1033.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308457.134e-1033.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trans-aconitate 2-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000038731.10.000e+098.91SMESG000038731.1[more]
SMESG000038734.11.025e-10352.17SMESG000038734.1[more]
SMESG000038735.12.058e-8343.64SMESG000038735.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002026 ID=SMED30002026|Name=Trans-aconitate 2-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=973bp
CACGGACTTTAGGTTTTGCTTTTTATATTTGTTTGTTATCTCGCAAAGAA
ATAATTTTTTTTAATTTTAAAATTTCTAATGAGTTTCTCAGCTTTATCTG
GTAGTGAATATGAGCTTTGTGGAAAGAACACAAAACTCTATGTTAGCAAG
ATGATTCAAAGTTATGTGATGCCAAACAAAGCAACTTACAAAAAGTTGCT
GGAACTCGGTTGCGGAACGGGAACAATTACAGATTTCTACATAGAATATT
TCAAGCCAGAAAGTTTCCTTGGAATTGACGAGGTTGAGCATTATCTAGAA
TATGCCAGAGAGAACCATAGTAAATCATCCATAGAAATAAAATATGAGAA
ATGTGACCTGAACAACATGGAGGAACTAAAGGAAATACTTAAAAAGAATC
TCGACGTTGACCTTGTTATCAGTTCGTTTGTTTTGCATTGGGTCGAAGAT
CCAATTGAATTATTCAAAACTATTTCGTCCAATTTGAATCCAGGCGTGGA
GCATTTTCACATTTCTGTGGTCAATTTTCAAGAAGAATTGATAGATTTGG
TTGAAGCCTACGAAGGTCATCCAACCTGGAAGGTTTATTATCAGGATATT
TGTAAACTTCCTCCGCTATTATCTCGAGTGGATCCAATATATCCTTCAAA
AGATTTTATCCAGTGGATTTTAGACCAAAGGTTTCAGATATATTTAGAAC
AATTGGTTCCAGTTACAAATCATTTTGAATCTGTTGAAATGGGGAAATTA
TTTCATAGATTTCTTTTACCATTCTTAAATTTTATTCCTTGTCATTTGCG
AGAAGAGTTTATGAAAGAATTTTTATCCGATTCCAGGAAGGCTTGCCGAA
GTGTTGATGATAAAGTCACTTGGAAGTACAATTTGTTTCTCTTTCATACG
AAAAATTAGTATTGTTTACAATTTAGATTGTGAAATTTAAATTTGAATTT
AGTTTATTTTATGTAGTACCTGC
back to top

protein sequence of SMED30002026-orf-1

>SMED30002026-orf-1 ID=SMED30002026-orf-1|Name=SMED30002026-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MSFSALSGSEYELCGKNTKLYVSKMIQSYVMPNKATYKKLLELGCGTGTI
TDFYIEYFKPESFLGIDEVEHYLEYARENHSKSSIEIKYEKCDLNNMEEL
KEILKKNLDVDLVISSFVLHWVEDPIELFKTISSNLNPGVEHFHISVVNF
QEELIDLVEAYEGHPTWKVYYQDICKLPPLLSRVDPIYPSKDFIQWILDQ
RFQIYLEQLVPVTNHFESVEMGKLFHRFLLPFLNFIPCHLREEFMKEFLS
DSRKACRSVDDKVTWKYNLFLFHTKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR041698Methyltransf_25
IPR029063SAM-dependent_MTases
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0030798trans-aconitate 2-methyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 16..177
e-value: 2.6E-21
score: 77.9
NoneNo IPR availablePANTHERPTHR43464FAMILY NOT NAMEDcoord: 38..142
NoneNo IPR availablePANTHERPTHR43464:SF31coord: 38..142
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 39..139
e-value: 8.01872E-10
score: 53.2027
IPR041698Methyltransferase domain 25PFAMPF13649Methyltransf_25coord: 41..139
e-value: 2.2E-13
score: 50.7
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 36..268