ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30002023
Length (bp)2705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30002023) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30002023) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30002023) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30002023) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002023

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002023SMESG000020576.1 SmedASXL_015551SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002023SMESG000020576.1 dd_Smed_v4_13360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002023SMESG000020576.1 dd_Smed_v6_13360_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002023SMESG000020576.1 dd_Smed_v4_13360_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 111.309 bits (277), Expect = 4.250e-24
Identity = 81/279 (29.03%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ EL+    +  LED D    T L+ A     + +V  LLK G +    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G  E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMIAAEQGNLEIVKELIKNGANCNLEDLD--NWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 110.923 bits (276), Expect = 5.021e-24
Identity = 81/279 (29.03%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ EL+    +  LED D    T L+ A     + +V  LLK G +    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G  E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMIAAEQGNLEIVKELIKNGANCNLEDLD--NWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 108.612 bits (270), Expect = 2.611e-23
Identity = 81/279 (29.03%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ EL+    +  LED D    T L+ A     + +V  LLK G +    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G  E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMIAAEQGNLEIVKELIKNGANCNLEDLD--NWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD55 (ankyrin repeat domain 55 [Source:HGNC Symbol;Acc:HGNC:25681])

HSP 1 Score: 104.375 bits (259), Expect = 1.923e-22
Identity = 87/322 (27.02%), Postives = 139/322 (43.17%), Query Frame = 3
Query:  462 FSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFE--TKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLEC---LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQE 1412
            F Q+       ++   V+ AA+ GD   L  ++ +   +LE  D  G TPLM+AV   + + V+ LLK GA+ N  D    TSL  A + G++     LL  GA  N  D  GR   H A     +  L +L++    +++N  D  G+TP  WA   +   H  +L           D    D++ +T +HW+++    + C   L +      +   D+ GKT + +AA  G  +    +  +     ++ +D  DRT L  A   G  E V  LLE G +   +D N ++ +      Y  YC       +   E R E
Sbjct:   15 FDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGANINMQDAYGRTSLCLATYLGWLEGCVSLLRNGAKHNIPDKNGRLPLHAATAEPDMRLLTVLLQQSNISEINHQDNEGMTPLHWAAFHNQPQHTQMLLK------KGADPTLVDKDFKTALHWAVQSGNRILCSIILSHHQGPSIINYDDESGKTCVHIAAAAGFSDIIHELA-RVPECNLQALDVDDRTPLHWAAAAGKAECVQSLLELGMDSNLRDINESTPL-----AYALYCGHTACVKLLSQESRTE 324          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: INVS (inversin [Source:HGNC Symbol;Acc:HGNC:17870])

HSP 1 Score: 105.145 bits (261), Expect = 2.881e-22
Identity = 87/286 (30.42%), Postives = 134/286 (46.85%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFET--KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLP-----LEC-LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLE-NGANIKFKDRNGASCVDIA 1340
            VH AA  GD   L  L++    + + +D  GRTPLMY V  D+++    LLK GAD N  D S+ T+LH A  KG    ++LLL   AN   +D    +  H    + + + L LL++F    +V+  D+N  T   W+   ++  H+ +L  +K+     I   E    G+  +HW+   + P     + C L     E  +  +D EG+T L  A   G +    V+   + S  I   D+  RT L  A   GH ++V+ LLE N +     D  GA+ +  A
Sbjct:   18 VHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLTTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLL--IKHDSNIGIPDVE----GKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTS-YESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYA 296          

HSP 2 Score: 97.0561 bits (240), Expect = 8.838e-20
Identity = 77/268 (28.73%), Postives = 121/268 (45.15%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGY--VALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFER----DRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            P+H+AA  G  ++++ LL + K      D  G TPL YA   +  E V+  LK  +  +  DL   TS  WA  KG   V    L L +  +IN  D +G +A H A     V  ++LL+E   +V+  D    TP   AC + H   +  L          I G  R    D++G +++HW+        C   + N+    ++D  G+T L  AA  G +    V++E      I+  D + RT+L  + N G+ + +  LL+  A
Sbjct:  258 PLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTL----------IKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQ--DKEGRTALHWSCNNGYLDAIKLLLDFAA 513          

HSP 3 Score: 80.8777 bits (198), Expect = 8.377e-15
Identity = 78/322 (24.22%), Postives = 131/322 (40.68%), Query Frame = 3
Query:  345 TLSRSSEALSPM-----TPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            T+   S+  +P+     + + E  + F  H +V D+   + R SF                 +AA KG  ++L  +L  K D+ +   D  G T L  A     +  V+ LL+  A  ++ D+ + T L  AC  G+  +I+ L+  GA ++  D  G S  HWA      +  Q+LIE +   N  D  G TP   A    +++ + VL        ++ D   +D+ GRT +HWS                                    G L+  K++++        + +++  T L  A  G   EV+ F+LE+GA
Sbjct:  282 TIPSDSQGATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFM----------------WAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLME------NNADPNIQDKEGRTALHWSC---------------------------------NNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFMLEHGA 548          

HSP 4 Score: 75.8702 bits (185), Expect = 2.783e-13
Identity = 68/254 (26.77%), Postives = 111/254 (43.70%), Query Frame = 3
Query:  579 LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACF---KGYVALIELLLDAGAN---INTQDSFGRSACHWACTYNTVEPLQLLIEFET-KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDD---EGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKD 1310
            ++ QD   +T L ++ YY+  E V+ L+K  ++    D+     LHWA        V  +  +LDA      +N QD  GR+  H+A     V  + +L  +E+  +  +D    TP  WA  L H   +++L      E +       D  G T +H++ +     E +K  +   +V  KDD   EG+T  + AA +G+ +  + ++       I   D    T+L  A   GH   V  LLEN A +   D
Sbjct:  142 VDTQDKNKQTALHWSAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLL-----ERNKSGTIPSDSQGATPLHYAAQSNF-AETVKVFLKHPSV--KDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATD 387          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: T28D6.4 (pep chromosome:WBcel235:III:11360456:11366214:1 gene:WBGene00012124.1 transcript:T28D6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28D6.4)

HSP 1 Score: 110.538 bits (275), Expect = 2.003e-24
Identity = 84/284 (29.58%), Postives = 139/284 (48.94%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQE--------IDH-IDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G+ E+   L      ++    C     L  A  Y ++E++  LL++G D + C  S+ T+L  A + G +A ++LLL  GA ++ +DS  R+A   A      + + ++I++   VN  D++G T            HLN+    K +E        ++H  D    D NGR  +H +     P  CL+ ++ +H  V + D+ G+T L+LAA QG LE  +  + K     ++ +D+  RT+L  A   GH EVV FL   G++   KD +GA  +  A
Sbjct:  431 AAARGNIEMCRFLADHFPHLVASSCCGEWNALRSAACYGQLEILHLLLEKGVDVDECGHSDRTALRAAAWSGQLAAVQLLLQTGAEVDRRDSEQRTALMAAAFMCHKDVVSVIIQYGADVNAIDKSGATAL----------HLNLSNGSKQEENSETTKLLLEHNADCKIEDANGRVALHLAAYHGDP--CLQLILEKHPIVDVMDNMGQTPLMLAASQGQLEAVQ-FLTKTAKADVDAIDNNGRTALQWAAINGHPEVVEFLCSVGSDEGHKDNDGAVALHYA 701          

HSP 2 Score: 99.3673 bits (246), Expect = 5.887e-21
Identity = 89/306 (29.08%), Postives = 143/306 (46.73%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRG-ADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWAC---RLDHLSHLNVLANVKNQE-------------------IDHI-----DGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN-GANIKFKDRNGASCVDIA 1340
            +H AA  GD  L  +L+L+K  +++  D +G+TPLM A    ++E V++L K   AD ++ D +  T+L WA   G+  ++E L   G++   +D+ G  A H+A T++ VE ++ L    T V   DR G  P M A     L  L +L  ++++ NQ                    ID I     D  +RD +G  + H  I   L      YL +       D  G+T + + A    +   K ++++ G    E VD   RT+L+ A    H  +  FLL++ G +    DR GA+ + IA
Sbjct:  599 LHLAAYHGDPCL--QLILEKHPIVDVMDNMGQTPLMLAASQGQLEAVQFLTKTAKADVDAIDNNGRTALQWAAINGHPEVVEFLCSVGSDEGHKDNDGAVALHYAVTHDHVELVKHLTNQHT-VEAKDRYGQHPMMIAAANGNLKVLEYLMGISDIINQPDHEGRTALSLASMAAHTSIIDLISPRITDWSQRDHDGTPLAHTLILSNLIFVAEVYLGHGANSSDSDAHGRTCVHVVASTNDVAAAK-MLKRIGGVNFEAVDRGGRTALMTAVWAKHVAISVFLLDSCGVDPNRTDRQGATALSIA 900          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 90.5077 bits (223), Expect = 5.434e-18
Identity = 88/299 (29.43%), Postives = 131/299 (43.81%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCL---GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRR-QLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLI 1373
            N  P+H AA +G  E+   LL    D   D+  L   G TPL  A  Y  +EVVR LL+RG   +    +++T LH A       +  LLL+ GA+       G +  H A   N +E    L++F+   N   R G TP   + +  H     +L  ++N      D   +  NG T +H   +   +P+  + Y  N   +  K + G T L +A   G L   K ++E        DV ++ R   T L  A   GH   V +LLENGA+   +   G + + IA  Q L Y  ++
Sbjct:  524 NYSPLHIAAKEGQEEVAGILL----DHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL--IENGS----DVGAKANNGLTAMHLCAQEDHVPVAQILYN-NGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA-----DVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA--QRLGYVSVV 804          

HSP 2 Score: 79.7221 bits (195), Expect = 9.096e-15
Identity = 75/305 (24.59%), Postives = 136/305 (44.59%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGF----------ERD------RNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGK----------TVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            P+H AA  G  ++++ L++Q   +   +   G  PL  A   D ++  R LL   A  +   +  +T LH A   G+V + +LLLD  A+ N++   G +  H AC  N ++ ++LL+++   +     +GLTP   A  +  ++  + +L    N +++ + G           + D      RNG  +   +   Q PL     L N   V L    G           + L +AA++G  E   ++++    K +  +  +  T L LA+  G+ EVV  LLE G  +  + +N  + + +A
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL--LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 3 Score: 79.337 bits (194), Expect = 1.233e-14
Identity = 76/295 (25.76%), Postives = 130/295 (44.07%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQ--KKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDI-ARNQYLFYCQLI 1373
            P+H AA  G   ++  LL Q    DV   +   G TPL  A   ++ +VVR L++ GA  ++      T LH A   G   ++ LLL AGAN N       S  H A      E   +L++         + G TP   A +  +L  + +L   +   +D I+G    +N  T +H +         +  L N  + +     G T L +AA++  +E    ++     ++  D + + R   T L L+   GH E+   L+ENG+++  K  NG + + + A+  ++   Q++
Sbjct:  428 PLHVAAFMGAINIVIYLLQQGANPDV---ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLE-RGTPVD-IEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 76.2554 bits (186), Expect = 1.179e-13
Identity = 75/284 (26.41%), Postives = 118/284 (41.55%), Query Frame = 3
Query:  483 PGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRT---IVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRN 1316
            PGR+  +     AA  GD E + ELL    D+    +  G   L  A      EVVR L+KR A  ++      T+LH A   G   ++ +L++ GAN+N Q   G +  + A   N  E ++ L++          +G TP   A +  H   + VL              E D  G+     +H + ++         L NEH   +    G T L +AA  G     ++++EK       +V+ Q R   + L +AT  G   + N LL  GA I  + ++
Sbjct:   28 PGRAEGSASFLRAARAGDLEKVLELLRAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL-------------LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGA-----NVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKD 292          

HSP 5 Score: 74.3294 bits (181), Expect = 3.756e-13
Identity = 81/318 (25.47%), Postives = 136/318 (42.77%), Query Frame = 3
Query:  471 ENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVL----ANVKNQEIDHI-----------------------DGFERDRNGRTIVHWSIRRQLPLECLKYLVN-EHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            EN S G+ +  P +H AA K D      LLLQ +   +     G TPL  A +Y    V + LL++GA+ N      I+ LH A   G   +  LLL  GA I+++     +  H A      + + LL+     ++   +NGL P   A + DH+     L    A V +  +D++                       D   R  NG T +H + ++   ++ ++ L+     ++   + G T L +AA  GA+     ++++  +  +E V  +  T L LA      +VV  L+ NGA +  + R   + + IA
Sbjct:  186 ENDSKGK-VRLPALHIAAKKDDTTAAT-LLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNR-IKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV--RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIA 498          

HSP 6 Score: 65.4698 bits (158), Expect = 2.019e-10
Identity = 52/197 (26.40%), Postives = 90/197 (45.69%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLV------NEHTVQLKDDEGKTVLLLAAEQGALETCKVI 1172
            G TPL  A   +++E+   LL+  ADPN+   +  T LH +  +G+  +  LL++ G+++  + + G +A H     + V   Q+L     ++N     G TP   AC    L+ +  L  V+N      D  E+ R   T +H +  +Q    C++YL+      NE T       G+T L +A   G +   + +
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL--VENG----ADVGEKTRASYTPLHQAA-QQGHNNCVRYLLENGASPNEQTAT-----GQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 90.5077 bits (223), Expect = 5.434e-18
Identity = 88/299 (29.43%), Postives = 131/299 (43.81%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCL---GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRR-QLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLI 1373
            N  P+H AA +G  E+   LL    D   D+  L   G TPL  A  Y  +EVVR LL+RG   +    +++T LH A       +  LLL+ GA+       G +  H A   N +E    L++F+   N   R G TP   + +  H     +L  ++N      D   +  NG T +H   +   +P+  + Y  N   +  K + G T L +A   G L   K ++E        DV ++ R   T L  A   GH   V +LLENGA+   +   G + + IA  Q L Y  ++
Sbjct:  524 NYSPLHIAAKEGQEEVAGILL----DHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL--IENGS----DVGAKANNGLTAMHLCAQEDHVPVAQILYN-NGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA-----DVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA--QRLGYVSVV 804          

HSP 2 Score: 79.7221 bits (195), Expect = 9.096e-15
Identity = 75/305 (24.59%), Postives = 136/305 (44.59%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGF----------ERD------RNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGK----------TVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            P+H AA  G  ++++ L++Q   +   +   G  PL  A   D ++  R LL   A  +   +  +T LH A   G+V + +LLLD  A+ N++   G +  H AC  N ++ ++LL+++   +     +GLTP   A  +  ++  + +L    N +++ + G           + D      RNG  +   +   Q PL     L N   V L    G           + L +AA++G  E   ++++    K +  +  +  T L LA+  G+ EVV  LLE G  +  + +N  + + +A
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL--LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 3 Score: 79.337 bits (194), Expect = 1.233e-14
Identity = 76/295 (25.76%), Postives = 130/295 (44.07%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQ--KKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDI-ARNQYLFYCQLI 1373
            P+H AA  G   ++  LL Q    DV   +   G TPL  A   ++ +VVR L++ GA  ++      T LH A   G   ++ LLL AGAN N       S  H A      E   +L++         + G TP   A +  +L  + +L   +   +D I+G    +N  T +H +         +  L N  + +     G T L +AA++  +E    ++     ++  D + + R   T L L+   GH E+   L+ENG+++  K  NG + + + A+  ++   Q++
Sbjct:  428 PLHVAAFMGAINIVIYLLQQGANPDV---ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLE-RGTPVD-IEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 76.2554 bits (186), Expect = 1.179e-13
Identity = 75/284 (26.41%), Postives = 118/284 (41.55%), Query Frame = 3
Query:  483 PGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRT---IVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRN 1316
            PGR+  +     AA  GD E + ELL    D+    +  G   L  A      EVVR L+KR A  ++      T+LH A   G   ++ +L++ GAN+N Q   G +  + A   N  E ++ L++          +G TP   A +  H   + VL              E D  G+     +H + ++         L NEH   +    G T L +AA  G     ++++EK       +V+ Q R   + L +AT  G   + N LL  GA I  + ++
Sbjct:   28 PGRAEGSASFLRAARAGDLEKVLELLRAGTDI-NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL-------------LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGA-----NVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKD 292          

HSP 5 Score: 74.3294 bits (181), Expect = 3.756e-13
Identity = 81/318 (25.47%), Postives = 136/318 (42.77%), Query Frame = 3
Query:  471 ENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVL----ANVKNQEIDHI-----------------------DGFERDRNGRTIVHWSIRRQLPLECLKYLVN-EHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            EN S G+ +  P +H AA K D      LLLQ +   +     G TPL  A +Y    V + LL++GA+ N      I+ LH A   G   +  LLL  GA I+++     +  H A      + + LL+     ++   +NGL P   A + DH+     L    A V +  +D++                       D   R  NG T +H + ++   ++ ++ L+     ++   + G T L +AA  GA+     ++++  +  +E V  +  T L LA      +VV  L+ NGA +  + R   + + IA
Sbjct:  186 ENDSKGK-VRLPALHIAAKKDDTTAAT-LLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNR-IKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV--RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIA 498          

HSP 6 Score: 65.4698 bits (158), Expect = 2.019e-10
Identity = 52/197 (26.40%), Postives = 90/197 (45.69%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLV------NEHTVQLKDDEGKTVLLLAAEQGALETCKVI 1172
            G TPL  A   +++E+   LL+  ADPN+   +  T LH +  +G+  +  LL++ G+++  + + G +A H     + V   Q+L     ++N     G TP   AC    L+ +  L  V+N      D  E+ R   T +H +  +Q    C++YL+      NE T       G+T L +A   G +   + +
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL--VENG----ADVGEKTRASYTPLHQAA-QQGHNNCVRYLLENGASPNEQTAT-----GQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: nphp-2 (NePHronoPhthisis (Human kidney disease) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVZ6])

HSP 1 Score: 89.3521 bits (220), Expect = 5.736e-18
Identity = 75/282 (26.60%), Postives = 122/282 (43.26%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGR-SACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQL-KDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            +HYAA  GD + L  + L  + +L+ +D  G+TPL+ A+   KIE   +L   GAD    D     +LHWA   G +  +   ++    +N +D + R +  H+A     + P         +V+Q        A+    L H +  N +                D + RT +HW       LE +K L N     L +D E  T+L  AA  G  E  +  ++     +I+++D    T+L  A + GH E    LL+N AN   +D+  A+    A ++
Sbjct:   40 IHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYATCSEDIAP---------EVSQ--------AILITLLKHGADPNAI----------------DADDRTPIHW-CSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASK 287          

HSP 2 Score: 57.7658 bits (138), Expect = 3.423e-8
Identity = 75/305 (24.59%), Postives = 124/305 (40.66%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIE------VVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETK--VNQHDRNGLTPAMWACRLDHL-SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSI-----------------------RRQLPL---------ECLKYL--VNEHTVQLKDDEGKTVLLLAAEQGALE------TCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFL 1277
            +H+A   G  + LN  + +  +V         TPL YA   + I       ++  LLK GADPN+ D  + T +HW    G +  I+ L ++G ++  +D    +  H A ++   E ++  ++   K  +++ DR G T   +A    H  S L +L N  N   +H     +D+   T  H +                        R  LP          + +++L  V+E  + + +  G+T + LAA  G LE      T K  ++   S+  E       T L LAT   H  VV +L
Sbjct:  107 LHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYATCSEDIAPEVSQAILITLLKHGADPNAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQN--NANPNH-----QDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLAVDESVLDIPNHNGRTAIHLAASVGNLEMVILLCTKKCFVDPLCSREKEIF-----TPLDLATKQNHVVVVEYL 399          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: nphp-2 (NePHronoPhthisis (Human kidney disease) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVZ6])

HSP 1 Score: 89.3521 bits (220), Expect = 6.123e-18
Identity = 75/282 (26.60%), Postives = 122/282 (43.26%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGR-SACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQL-KDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            +HYAA  GD + L  + L  + +L+ +D  G+TPL+ A+   KIE   +L   GAD    D     +LHWA   G +  +   ++    +N +D + R +  H+A     + P         +V+Q        A+    L H +  N +                D + RT +HW       LE +K L N     L +D E  T+L  AA  G  E  +  ++     +I+++D    T+L  A + GH E    LL+N AN   +D+  A+    A ++
Sbjct:   40 IHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYATCSEDIAP---------EVSQ--------AILITLLKHGADPNAI----------------DADDRTPIHW-CSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASK 287          

HSP 2 Score: 57.7658 bits (138), Expect = 3.371e-8
Identity = 75/305 (24.59%), Postives = 124/305 (40.66%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIE------VVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETK--VNQHDRNGLTPAMWACRLDHL-SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSI-----------------------RRQLPL---------ECLKYL--VNEHTVQLKDDEGKTVLLLAAEQGALE------TCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFL 1277
            +H+A   G  + LN  + +  +V         TPL YA   + I       ++  LLK GADPN+ D  + T +HW    G +  I+ L ++G ++  +D    +  H A ++   E ++  ++   K  +++ DR G T   +A    H  S L +L N  N   +H     +D+   T  H +                        R  LP          + +++L  V+E  + + +  G+T + LAA  G LE      T K  ++   S+  E       T L LAT   H  VV +L
Sbjct:  107 LHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYATCSEDIAPEVSQAILITLLKHGADPNAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQN--NANPNH-----QDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLAVDESVLDIPNHNGRTAIHLAASVGNLEMVILLCTKKCFVDPLCSREKEIF-----TPLDLATKQNHVVVVEYL 399          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0344189)

HSP 1 Score: 97.4413 bits (241), Expect = 3.315e-20
Identity = 83/329 (25.23%), Postives = 151/329 (45.90%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIE-DVDDQDR-TSLILATNGGHGEVVNFLLENGANIKFKDRNG-ASCVDIARNQYLFYCQLIISSHIREMERRQESIPSD-----CVELIEKANSRHNSISEA 1481
            A+  G  +++ +LLL     +E +D  G T LM+A Y    E+VR LL +GAD N+     + +L WA  +GY  ++ELL+  GA +N  D +G +A  WAC    VE +  L++    V+       TP + A    H   ++ +   K   ++ +     D++G T +  + R          +     + ++D    T L+ A + G     + ++E    K+ + D+  +DR T++  A   GH  +V  LL    +++   ++G    +   RN+ L    L+       ++R+ +   SD     C+ +  +A S+  +I EA
Sbjct:  243 ASRNGHLDVV-QLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILE-KKPNVNAL-----DKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGH----RTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLL-------LDRKAKVTASDKRGDTCLHIAMRARSK--TIVEA 551          

HSP 2 Score: 96.6709 bits (239), Expect = 6.494e-20
Identity = 81/279 (29.03%), Postives = 126/279 (45.16%), Query Frame = 3
Query:  522 ATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPL---------ECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA--NIKFKDRNGA 1322
            A +G    + E L +  DV + +D    T L+ A     ++VV+ LL  GA+    D+   TSL WA ++G+  L+ LLLD GA+ N   ++   A  WA      + ++LL++   KVN  D+ G T  +WACR  ++  ++ L            G   D  G  +  W+     PL         +C+  ++ +   V   D +G T L +A+ +G  +    +I      YI   D    T LI A   GH  VV  LL+  A  +I+ KDR  A
Sbjct:  211 AGRGLTAFVREFLARGADV-QAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKA---------GANVDTAG--MYSWT-----PLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIA--AGAYINIQDRGADTPLIHAVKAGHRTVVEALLKKHADVDIQGKDRKTA 470          

HSP 3 Score: 78.9518 bits (193), Expect = 1.709e-14
Identity = 76/318 (23.90%), Postives = 126/318 (39.62%), Query Frame = 3
Query:  534 DFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYL--FYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEA 1481
            D   L  +L  +   ++D+D    T LM          VR  L RGAD  + DL   T+L  A   G++ +++LLLD GA +  +D  G ++  WA      E ++LL++     N H    L   +WA                             R  + IV   ++R               V + D  G T L+ A  +G +E    ++ K G+  ++       T L++A  GGH + V+ +LE   N+   D++G + + IA  +        LI +     ++ R    P     LI    + H ++ EA
Sbjct:  181 DISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAA---------------------------GRGYKDIVELLVQRG------------AKVNVGDKYGTTALVWACRRGNVEIVDTLL-KAGAN-VDTAGMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTP-----LIHAVKAGHRTVVEA 452          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0344188)

HSP 1 Score: 97.4413 bits (241), Expect = 4.205e-20
Identity = 81/318 (25.47%), Postives = 145/318 (45.60%), Query Frame = 3
Query:  552 ELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIE-DVDDQDR-TSLILATNGGHGEVVNFLLENGANIKFKDRNG-ASCVDIARNQYLFYCQLIISSHIREMERRQESIPSD-----CVELIEKANSRHNSISEA 1481
            +LLL     +E +D  G T LM+A Y    E+VR LL +GAD N+     + +L WA  +GY  ++ELL+  GA +N  D +G +A  WAC    VE +  L++    V+       TP + A    H   ++ +   K   ++ +     D++G T +  + R          +     + ++D    T L+ A + G     + ++E    K+ + D+  +DR T++  A   GH  +V  LL    +++   ++G    +   RN+ L    L+       ++R+ +   SD     C+ +  +A S+  +I EA
Sbjct:  253 QLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILE-KKPNVNAL-----DKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGH----RTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLL-------LDRKAKVTASDKRGDTCLHIAMRARSK--TIVEA 551          

HSP 2 Score: 96.2857 bits (238), Expect = 7.829e-20
Identity = 82/286 (28.67%), Postives = 128/286 (44.76%), Query Frame = 3
Query:  501 TPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPL---------ECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA--NIKFKDRNGA 1322
            T  +   A +G    + E L +  DV + +D    T L+ A     ++VV+ LL  GA+    D+   TSL WA ++G+  L+ LLLD GA+ N   ++   A  WA      + ++LL++   KVN  D+ G T  +WACR  ++  ++ L            G   D  G  +  W+     PL         +C+  ++ +   V   D +G T L +A+ +G  +    +I      YI   D    T LI A   GH  VV  LL+  A  +I+ KDR  A
Sbjct:  204 TTVLMVVAGRGLTAFVREFLARGADV-QAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKA---------GANVDTAG--MYSWT-----PLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIA--AGAYINIQDRGADTPLIHAVKAGHRTVVEALLKKHADVDIQGKDRKTA 470          

HSP 3 Score: 78.9518 bits (193), Expect = 1.876e-14
Identity = 76/318 (23.90%), Postives = 126/318 (39.62%), Query Frame = 3
Query:  534 DFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYL--FYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEA 1481
            D   L  +L  +   ++D+D    T LM          VR  L RGAD  + DL   T+L  A   G++ +++LLLD GA +  +D  G ++  WA      E ++LL++     N H    L   +WA                             R  + IV   ++R               V + D  G T L+ A  +G +E    ++ K G+  ++       T L++A  GGH + V+ +LE   N+   D++G + + IA  +        LI +     ++ R    P     LI    + H ++ EA
Sbjct:  181 DISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAA---------------------------GRGYKDIVELLVQRG------------AKVNVGDKYGTTALVWACRRGNVEIVDTLL-KAGAN-VDTAGMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTP-----LIHAVKAGHRTVVEA 452          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302707)

HSP 1 Score: 96.2857 bits (238), Expect = 7.881e-20
Identity = 81/318 (25.47%), Postives = 145/318 (45.60%), Query Frame = 3
Query:  552 ELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIE-DVDDQDR-TSLILATNGGHGEVVNFLLENGANIKFKDRNG-ASCVDIARNQYLFYCQLIISSHIREMERRQESIPSD-----CVELIEKANSRHNSISEA 1481
            +LLL     +E +D  G T LM+A Y    E+VR LL +GAD N+     + +L WA  +GY  ++ELL+  GA +N  D +G +A  WAC    VE +  L++    V+       TP + A    H   ++ +   K   ++ +     D++G T +  + R          +     + ++D    T L+ A + G     + ++E    K+ + D+  +DR T++  A   GH  +V  LL    +++   ++G    +   RN+ L    L+       ++R+ +   SD     C+ +  +A S+  +I EA
Sbjct:  163 QLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILE-KKPNVNAL-----DKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGH----RTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLL-------LDRKAKVTASDKRGDTCLHIAMRARSK--TIVEA 461          

HSP 2 Score: 95.5153 bits (236), Expect = 1.336e-19
Identity = 82/286 (28.67%), Postives = 128/286 (44.76%), Query Frame = 3
Query:  501 TPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPL---------ECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA--NIKFKDRNGA 1322
            T  +   A +G    + E L +  DV + +D    T L+ A     ++VV+ LL  GA+    D+   TSL WA ++G+  L+ LLLD GA+ N   ++   A  WA      + ++LL++   KVN  D+ G T  +WACR  ++  ++ L            G   D  G  +  W+     PL         +C+  ++ +   V   D +G T L +A+ +G  +    +I      YI   D    T LI A   GH  VV  LL+  A  +I+ KDR  A
Sbjct:  114 TTVLMVVAGRGLTAFVREFLARGADV-QAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKA---------GANVDTAG--MYSWT-----PLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIA--AGAYINIQDRGADTPLIHAVKAGHRTVVEALLKKHADVDIQGKDRKTA 380          

HSP 3 Score: 77.7962 bits (190), Expect = 3.381e-14
Identity = 70/265 (26.42%), Postives = 116/265 (43.77%), Query Frame = 3
Query:  534 DFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRR---QLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            D   L  +L  +   ++D+D    T LM          VR  L RGAD  + DL   T+L  A   G++ +++LLLD GA +  +D  G ++  WA      E ++LL++     N H    L   +WA    +   + +L   +  +++       D+ G T + W+ RR   ++    LK   N  T  +      T LL+AA  G  +    I+EK     +  +D    T+L +A+  G  ++   L+  GA I  +DR  
Sbjct:   91 DISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQ-RGAKVN-----VGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYS---WTPLLVAAAGGHTDCVSSILEK--KPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGA 344          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302703)

HSP 1 Score: 96.2857 bits (238), Expect = 7.945e-20
Identity = 90/367 (24.52%), Postives = 166/367 (45.23%), Query Frame = 3
Query:  423 TVLDEKSDQIRKSFSQENFSPGRSI------NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIE-DVDDQDR-TSLILATNGGHGEVVNFLLENGANIKFKDRNGAS-CVDIARNQYLFYCQLIISSHIREMERRQESIPSD-----CVELIEKANSRHNSISEA 1481
            TVL   + +   +F +E  + G  +      N   +  A+  G  +++ +LLL     +E +D  G T LM+A Y    E+VR LL +GAD N+     + +L WA  +GY  ++ELL+  GA +N  D +G +A  WAC    VE +  L++    V+       TP + A    H   ++ +   K   ++ +     D++G T +  + R          +     + ++D    T L+ A + G     + ++E    K+ + D+  +DR T++  A   GH  +V  LL    +++   ++G +  +   RN+ L    L+       ++R+ +   SD     C+ +  +A S+  +I EA
Sbjct:  115 TVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVV-QLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILE-KKPNVNAL-----DKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGH----RTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLL-------LDRKAKVTASDKRGDTCLHIAMRARSK--TIVEA 461          

HSP 2 Score: 78.1814 bits (191), Expect = 3.185e-14
Identity = 76/318 (23.90%), Postives = 126/318 (39.62%), Query Frame = 3
Query:  534 DFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYL--FYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEA 1481
            D   L  +L  +   ++D+D    T LM          VR  L RGAD  + DL   T+L  A   G++ +++LLLD GA +  +D  G ++  WA      E ++LL++     N H    L   +WA                             R  + IV   ++R               V + D  G T L+ A  +G +E    ++ K G+  ++       T L++A  GGH + V+ +LE   N+   D++G + + IA  +        LI +     ++ R    P     LI    + H ++ EA
Sbjct:   91 DISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAA---------------------------GRGYKDIVELLVQRG------------AKVNVGDKYGTTALVWACRRGNVEIVDTLL-KAGAN-VDTAGMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTP-----LIHAVKAGHRTVVEA 362          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302706)

HSP 1 Score: 96.2857 bits (238), Expect = 8.193e-20
Identity = 90/367 (24.52%), Postives = 165/367 (44.96%), Query Frame = 3
Query:  423 TVLDEKSDQIRKSFSQENFSPGRSI------NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIE-DVDDQDR-TSLILATNGGHGEVVNFLLENGANIKFKDRNG-ASCVDIARNQYLFYCQLIISSHIREMERRQESIPSD-----CVELIEKANSRHNSISEA 1481
            TVL   + +   +F +E  + G  +      N   +  A+  G  +++ +LLL     +E +D  G T LM+A Y    E+VR LL +GAD N+     + +L WA  +GY  ++ELL+  GA +N  D +G +A  WAC    VE +  L++    V+       TP + A    H   ++ +   K   ++ +     D++G T +  + R          +     + ++D    T L+ A + G     + ++E    K+ + D+  +DR T++  A   GH  +V  LL    +++   ++G    +   RN+ L    L+       ++R+ +   SD     C+ +  +A S+  +I EA
Sbjct:   63 TVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVV-QLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILE-KKPNVNAL-----DKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGH----RTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLL-------LDRKAKVTASDKRGDTCLHIAMRARSK--TIVEA 409          

HSP 2 Score: 77.7962 bits (190), Expect = 3.525e-14
Identity = 76/318 (23.90%), Postives = 126/318 (39.62%), Query Frame = 3
Query:  534 DFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYL--FYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEA 1481
            D   L  +L  +   ++D+D    T LM          VR  L RGAD  + DL   T+L  A   G++ +++LLLD GA +  +D  G ++  WA      E ++LL++     N H    L   +WA                             R  + IV   ++R               V + D  G T L+ A  +G +E    ++ K G+  ++       T L++A  GGH + V+ +LE   N+   D++G + + IA  +        LI +     ++ R    P     LI    + H ++ EA
Sbjct:   39 DISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAA---------------------------GRGYKDIVELLVQRG------------AKVNVGDKYGTTALVWACRRGNVEIVDTLL-KAGAN-VDTAGMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTP-----LIHAVKAGHRTVVEA 310          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: kidins220a (kinase D-interacting substrate 220a [Source:ZFIN;Acc:ZDB-GENE-041014-170])

HSP 1 Score: 114.775 bits (286), Expect = 2.088e-25
Identity = 84/274 (30.66%), Postives = 137/274 (50.00%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            A+ +G  E++ EL+ +  ++ L+D DC   T L+ A      +VV+ LL+  A+    D+   ++L WA +KG V +  LLL+ GAN N    +      WA      E +QLL++ E KVN  D+ G TP +WA R  H    +++L N  N +       +   N  T +  ++R     E +K L+  +  V + D +G T L++AA +G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  K ++G + +
Sbjct:   53 ASEQGSLEIVQELIRRGANIHLDDIDCW--TALISAAKEGHTDVVKELLENNANVEHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYPIIWAAGRGHAEIVQLLLQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGANVD-------QEGANSMTALIVAVRGGF-TEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLNKYADIDVKGQDGKTAL 314          

HSP 2 Score: 100.523 bits (249), Expect = 5.428e-21
Identity = 82/304 (26.97%), Postives = 145/304 (47.70%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR------LDHLSHLNVLANVKNQE------IDHIDGFER---------------DRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIE--KFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  +++ ELL    +V E +D  G + LM+A Y  ++EV   LL++GA+PN      +  + WA  +G+  +++LLL   A +N  D +G +   WA      + +  L+E    V+Q   N +T  + A R      +  L   N   N+ +++      I  I+G+                 DR+G T++  ++R    +E ++ L+N++  + +K  +GKT L  A E+G     + I++       Y +D +    T LI AT   + E+V  LL+ GA +   D+ G + + IA
Sbjct:   86 AAKEGHTDVVKELLENNANV-EHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYPIIWAAGRGHAEIVQLLLQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGANVDQEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGG-HVEIVRALLNKYADIDVKGQDGKTALYWAVEKGNATMVRDILQCNPDTEAYTKDAE----TPLIKATKMRNMEIVELLLDKGAKVSAVDKKGDTPLHIA 383          

HSP 3 Score: 73.9442 bits (180), Expect = 8.871e-13
Identity = 63/247 (25.51%), Postives = 105/247 (42.51%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            G+T LM A     +E+V+ L++RGA+ +  D+   T+L  A  +G+  +++ LL+  AN+  +D  G SA  WA     VE   LL+E     N   +  + P +WA    H   + +L                                       L +E  V   D  G T L+ A+ +G  +    ++E   +  ++       T+LI+A  GG  EVV  LL+   N+   D++G + + IA
Sbjct:   46 GQTALMLASEQGSLEIVQELIRRGANIHLDDIDCWTALISAAKEGHTDVVKELLENNANVEHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYPIIWAAGRGHAEIVQLL---------------------------------------LQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGAN--VDQEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIA 251          

HSP 4 Score: 60.8474 bits (146), Expect = 7.799e-9
Identity = 64/263 (24.33%), Postives = 113/263 (42.97%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +A+ KG ++ +  LL    +V + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +GY  +++ LLDAG  +N                                   DR+G T  + A R  H+  +  L N K  +ID      + ++G+T ++W++ +         L      +    + +T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWASRKGHYDCVMHLLENGANV-DQEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLDAGTYVNIP---------------------------------DRSGDTVLIGAVRGGHVEIVRALLN-KYADID-----VKGQDGKTALYWAVEKGNATMVRDILQCNPDTEAYTKDAETPLIKATKMRNMEIVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 58.151 bits (139), Expect = 5.073e-8
Identity = 31/80 (38.75%), Postives = 51/80 (63.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + + G+T L+LA+EQG+LE  + +I +  + +++D+D    T+LI A   GH +VV  LLEN AN++ +D  G S +
Sbjct:   39 VDTRSENGQTALMLASEQGSLEIVQELIRRGANIHLDDIDCW--TALISAAKEGHTDVVKELLENNANVEHRDMGGWSAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: kidins220a (kinase D-interacting substrate 220a [Source:ZFIN;Acc:ZDB-GENE-041014-170])

HSP 1 Score: 114.39 bits (285), Expect = 3.058e-25
Identity = 82/273 (30.04%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            A+ +G  E++ EL+ +  ++ L+D DC   T L+ A      +VV+ LL+  A+    D+   ++L WA +KG V +  LLL+ GAN N    +      WA      E +QLL++ E KVN  D+ G TP +WA R  H    +++L N  N +       +   N  T +  ++R        + L     V + D +G T L++AA +G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  K ++G + +
Sbjct:   53 ASEQGSLEIVQELIRRGANIHLDDIDCW--TALISAAKEGHTDVVKELLENNANVEHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYPIIWAAGRGHAEIVQLLLQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGANVD-------QEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLNKYADIDVKGQDGKTAL 314          

HSP 2 Score: 99.7525 bits (247), Expect = 8.737e-21
Identity = 82/304 (26.97%), Postives = 145/304 (47.70%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR------LDHLSHLNVLANVKNQE------IDHIDGFER---------------DRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIE--KFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  +++ ELL    +V E +D  G + LM+A Y  ++EV   LL++GA+PN      +  + WA  +G+  +++LLL   A +N  D +G +   WA      + +  L+E    V+Q   N +T  + A R      +  L   N   N+ +++      I  I+G+                 DR+G T++  ++R    +E ++ L+N++  + +K  +GKT L  A E+G     + I++       Y +D +    T LI AT   + E+V  LL+ GA +   D+ G + + IA
Sbjct:   86 AAKEGHTDVVKELLENNANV-EHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYPIIWAAGRGHAEIVQLLLQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGANVDQEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGG-HVEIVRALLNKYADIDVKGQDGKTALYWAVEKGNATMVRDILQCNPDTEAYTKDAE----TPLIKATKMRNMEIVELLLDKGAKVSAVDKKGDTPLHIA 383          

HSP 3 Score: 73.1738 bits (178), Expect = 1.314e-12
Identity = 63/247 (25.51%), Postives = 105/247 (42.51%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            G+T LM A     +E+V+ L++RGA+ +  D+   T+L  A  +G+  +++ LL+  AN+  +D  G SA  WA     VE   LL+E     N   +  + P +WA    H   + +L                                       L +E  V   D  G T L+ A+ +G  +    ++E   +  ++       T+LI+A  GG  EVV  LL+   N+   D++G + + IA
Sbjct:   46 GQTALMLASEQGSLEIVQELIRRGANIHLDDIDCWTALISAAKEGHTDVVKELLENNANVEHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYPIIWAAGRGHAEIVQLL---------------------------------------LQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGAN--VDQEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIA 251          

HSP 4 Score: 60.4622 bits (145), Expect = 1.044e-8
Identity = 64/263 (24.33%), Postives = 113/263 (42.97%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +A+ KG ++ +  LL    +V + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +GY  +++ LLDAG  +N                                   DR+G T  + A R  H+  +  L N K  +ID      + ++G+T ++W++ +         L      +    + +T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWASRKGHYDCVMHLLENGANV-DQEGANSMTALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLDAGTYVNIP---------------------------------DRSGDTVLIGAVRGGHVEIVRALLN-KYADID-----VKGQDGKTALYWAVEKGNATMVRDILQCNPDTEAYTKDAETPLIKATKMRNMEIVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 58.151 bits (139), Expect = 5.686e-8
Identity = 31/80 (38.75%), Postives = 51/80 (63.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + + G+T L+LA+EQG+LE  + +I +  + +++D+D    T+LI A   GH +VV  LLEN AN++ +D  G S +
Sbjct:   39 VDTRSENGQTALMLASEQGSLEIVQELIRRGANIHLDDIDCW--TALISAAKEGHTDVVKELLENNANVEHRDMGGWSAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: kidins220b (kinase D-interacting substrate 220b [Source:NCBI gene;Acc:335881])

HSP 1 Score: 108.612 bits (270), Expect = 1.919e-23
Identity = 87/279 (31.18%), Postives = 140/279 (50.18%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDS-FGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFK 1307
            GRS N   P+  A+ +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL+  A     D+   T+L WA +KG V +  +LL+ GAN NT    +      WA      E ++LL+E   KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  +
Sbjct:   41 GRSDNGQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIR 307          

HSP 2 Score: 93.2041 bits (230), Expect = 9.904e-19
Identity = 80/303 (26.40%), Postives = 141/303 (46.53%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLS-EITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR------LDHLSHLNVLANVKNQE------IDHIDGFER---------------DRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL +    +E +D  G T L +A Y  ++EV   LL+ GA+PN+      +  + WA  +G+  +++LLL+ GA +N  D +G +   WA      + +  L+E    V+Q   N +T  + A +      +  L   N   N+ +++      I   +G+                 DR+G T++  ++R    +E ++ L++++  + ++  E KT L  A E+G     + I++   S   E       T LI AT     EVV  LL+ GA +   D+ G + + IA
Sbjct:   86 AAKEGHVEVVKELL-ENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGG-HVEIVRALLHKYADIDIRGQENKTALYWAVEKGNATMVRDILQ--CSPDTETTTKDSETPLIKATKMRSIEVVELLLDKGAKVSAVDKRGDTPLHIA 384          

HSP 3 Score: 81.6481 bits (200), Expect = 3.836e-15
Identity = 78/296 (26.35%), Postives = 135/296 (45.61%), Query Frame = 3
Query:  420 WTVLDEKSDQIRKSFSQENFSPGRSINTP-------PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            WT L   S + R   +      G + NT        P+ +AA +G  E++ +LLL+    +   D  G TPL++A      + V  LL+ GAD +    + +T+L  A   GY  +++ LL    N+N  D  G +A   A      E +Q L++  T VN  DR+G T  + A R  H+  +  L + K  +ID      R +  +T ++W++ +         L      +    + +T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G    +   LL N
Sbjct:  113 WTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIV-KLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLH-KYADIDI-----RGQENKTALYWAVEKGNATMVRDILQCSPDTETTTKDSETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKRGDTPLHIAIRGRSRRLAELLLRN 399          

HSP 4 Score: 73.1738 bits (178), Expect = 1.286e-12
Identity = 68/253 (26.88%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRN-GLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQL--KDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            G+TPLM A     +E+V+ L++RGA+ N  D+   ++L  A  +G+V +++ LL+  A I  +D  G +A  WA     VE   +L+E     N   +   + P +WA    H                                         E +K L+ EH  ++   D  G T L+ AA +G  +    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA
Sbjct:   46 GQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHA----------------------------------------EIVKLLL-EHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIA 252          

HSP 5 Score: 53.9138 bits (128), Expect = 9.258e-7
Identity = 33/83 (39.76%), Postives = 50/83 (60.24%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            V  + D G+T L+LA+EQG+LE  + +I +  +  ++DVD    ++LI A   GH EVV  LLEN A I+ +D  G + +  A
Sbjct:   39 VDGRSDNGQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWA 119          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd55 (ankyrin repeat domain 55 [Source:ZFIN;Acc:ZDB-GENE-080104-7])

HSP 1 Score: 105.145 bits (261), Expect = 1.033e-22
Identity = 86/309 (27.83%), Postives = 134/309 (43.37%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFET--KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLEC---LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIE--KFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQES 1415
            V+ AA  GD   L  ++ +   +LE  D  G TPLM+AV   +++ V+ LLK GA  N+ D    TSL    + G++     LL  GA  N  D  GR   H A        + +L++  T  ++N  D  G+T   WAC  +   H   L           D    D++ +T +HW+++    L C   L++ +    +   D+ GKT + +AA  G  +   +I E  +     ++ +D  +RT L  A   G  + V  LLE G     +D N  + +      Y  YC       +   E R ES
Sbjct:   24 VYQAAANGDVNTLTTVIREDPSILECCDGEGSTPLMHAVSGRQVDTVKLLLKMGASINTQDACGRTSLSLGTYLGWLEGCVCLLRNGAKQNIPDKNGRLPIHAATAETDFRLMAVLLQQSTLCEINHQDNEGMTALHWACFHNRPEHSQALLQ------KGADPTLVDKDFKTALHWAVQSGSRLMCSLILEHNLGSSVINYDDENGKTCVHIAAAAGFSD---IIYELSRISETNLQALDVDERTPLHWAAAAGKDDCVQVLLELGVEPSPRDINENTPL-----TYAMYCGHTACIKLLSTENRSES 318          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd55 (ankyrin repeat domain 55 [Source:ZFIN;Acc:ZDB-GENE-080104-7])

HSP 1 Score: 104.76 bits (260), Expect = 1.237e-22
Identity = 86/309 (27.83%), Postives = 134/309 (43.37%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFET--KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLEC---LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIE--KFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQES 1415
            V+ AA  GD   L  ++ +   +LE  D  G TPLM+AV   +++ V+ LLK GA  N+ D    TSL    + G++     LL  GA  N  D  GR   H A        + +L++  T  ++N  D  G+T   WAC  +   H   L           D    D++ +T +HW+++    L C   L++ +    +   D+ GKT + +AA  G  +   +I E  +     ++ +D  +RT L  A   G  + V  LLE G     +D N  + +      Y  YC       +   E R ES
Sbjct:   24 VYQAAANGDVNTLTTVIREDPSILECCDGEGSTPLMHAVSGRQVDTVKLLLKMGASINTQDACGRTSLSLGTYLGWLEGCVCLLRNGAKQNIPDKNGRLPIHAATAETDFRLMAVLLQQSTLCEINHQDNEGMTALHWACFHNRPEHSQALLQ------KGADPTLVDKDFKTALHWAVQSGSRLMCSLILEHNLGSSVINYDDENGKTCVHIAAAAGFSD---IIYELSRISETNLQALDVDERTPLHWAAAAGKDDCVQVLLELGVEPSPRDINENTPL-----TYAMYCGHTACIKLLSTENRSES 318          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 106.686 bits (265), Expect = 9.415e-23
Identity = 81/273 (29.67%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN-TQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            AA +G+ E++ ELL  + +  LED D    T L+ A     +E+VR LL   A+    D+   T+L WA +KG + +++LLL  GAN N T   +      WA      + ++LL+++  KVN  D+ G TP +WA R  HL  +  L  +   ++D     +   N  T +  +++        + L     V L D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   45 AAEQGNLEIVQELLRNRANCNLEDVD--NWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQM-GADVD-----QEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLD--AGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTAL 307          

HSP 2 Score: 95.5153 bits (236), Expect = 3.176e-19
Identity = 75/260 (28.85%), Postives = 129/260 (49.62%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            PV +AA +G  +++ +LLLQ    +   D  G TPL++A     +E V++LL+ GAD +    + IT+L  A   GY   ++ +L    N+N  D  G +A   A      E +Q L++  T VN  DRNG T  + A R  H+  +  L N K  +ID      R ++ +T ++W++ +         L      +    +G+T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  141 PVIWAAGRGHSDIV-KLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLN-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 391          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 106.686 bits (265), Expect = 9.745e-23
Identity = 81/273 (29.67%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN-TQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            AA +G+ E++ ELL  + +  LED D    T L+ A     +E+VR LL   A+    D+   T+L WA +KG + +++LLL  GAN N T   +      WA      + ++LL+++  KVN  D+ G TP +WA R  HL  +  L  +   ++D     +   N  T +  +++        + L     V L D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   45 AAEQGNLEIVQELLRNRANCNLEDVD--NWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQM-GADVD-----QEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLD--AGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTAL 307          

HSP 2 Score: 95.1301 bits (235), Expect = 3.640e-19
Identity = 75/260 (28.85%), Postives = 129/260 (49.62%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            PV +AA +G  +++ +LLLQ    +   D  G TPL++A     +E V++LL+ GAD +    + IT+L  A   GY   ++ +L    N+N  D  G +A   A      E +Q L++  T VN  DRNG T  + A R  H+  +  L N K  +ID      R ++ +T ++W++ +         L      +    +G+T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  141 PVIWAAGRGHSDIV-KLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLN-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 391          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 106.686 bits (265), Expect = 1.066e-22
Identity = 81/273 (29.67%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN-TQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            AA +G+ E++ ELL  + +  LED D    T L+ A     +E+VR LL   A+    D+   T+L WA +KG + +++LLL  GAN N T   +      WA      + ++LL+++  KVN  D+ G TP +WA R  HL  +  L  +   ++D     +   N  T +  +++        + L     V L D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   45 AAEQGNLEIVQELLRNRANCNLEDVD--NWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQM-GADVD-----QEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLD--AGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTAL 307          

HSP 2 Score: 95.1301 bits (235), Expect = 3.659e-19
Identity = 75/260 (28.85%), Postives = 129/260 (49.62%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            PV +AA +G  +++ +LLLQ    +   D  G TPL++A     +E V++LL+ GAD +    + IT+L  A   GY   ++ +L    N+N  D  G +A   A      E +Q L++  T VN  DRNG T  + A R  H+  +  L N K  +ID      R ++ +T ++W++ +         L      +    +G+T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  141 PVIWAAGRGHSDIV-KLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLN-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 391          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 106.686 bits (265), Expect = 1.067e-22
Identity = 81/273 (29.67%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN-TQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            AA +G+ E++ ELL  + +  LED D    T L+ A     +E+VR LL   A+    D+   T+L WA +KG + +++LLL  GAN N T   +      WA      + ++LL+++  KVN  D+ G TP +WA R  HL  +  L  +   ++D     +   N  T +  +++        + L     V L D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   45 AAEQGNLEIVQELLRNRANCNLEDVD--NWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQM-GADVD-----QEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLD--AGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTAL 307          

HSP 2 Score: 95.1301 bits (235), Expect = 3.600e-19
Identity = 75/260 (28.85%), Postives = 129/260 (49.62%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            PV +AA +G  +++ +LLLQ    +   D  G TPL++A     +E V++LL+ GAD +    + IT+L  A   GY   ++ +L    N+N  D  G +A   A      E +Q L++  T VN  DRNG T  + A R  H+  +  L N K  +ID      R ++ +T ++W++ +         L      +    +G+T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  141 PVIWAAGRGHSDIV-KLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLN-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 391          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 106.301 bits (264), Expect = 1.168e-22
Identity = 81/273 (29.67%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN-TQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            AA +G+ E++ ELL  + +  LED D    T L+ A     +E+VR LL   A+    D+   T+L WA +KG + +++LLL  GAN N T   +      WA      + ++LL+++  KVN  D+ G TP +WA R  HL  +  L  +   ++D     +   N  T +  +++        + L     V L D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   45 AAEQGNLEIVQELLRNRANCNLEDVD--NWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQM-GADVD-----QEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLD--AGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTAL 307          

HSP 2 Score: 95.1301 bits (235), Expect = 4.021e-19
Identity = 75/260 (28.85%), Postives = 129/260 (49.62%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            PV +AA +G  +++ +LLLQ    +   D  G TPL++A     +E V++LL+ GAD +    + IT+L  A   GY   ++ +L    N+N  D  G +A   A      E +Q L++  T VN  DRNG T  + A R  H+  +  L N K  +ID      R ++ +T ++W++ +         L      +    +G+T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  141 PVIWAAGRGHSDIV-KLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLN-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKKGDTPLHIAIRGRSRKLAELLLRN 391          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 114.005 bits (284), Expect = 3.979e-25
Identity = 83/279 (29.75%), Postives = 133/279 (47.67%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ EL+    +  LED D    T L+ A     I +V  LLK GA+    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G +E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMIAAEQGNVEIVKELIKNGANCNLEDLD--NWTALISASKEGHIHIVEELLKCGANLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          

HSP 2 Score: 83.5741 bits (205), Expect = 1.019e-15
Identity = 70/260 (26.92%), Postives = 126/260 (48.46%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            P+ +AA +G  ++++ LLLQ    +   D  G TPL++A     +E V+ LL  GAD +    + +T+L  A   GY   ++ +L    N+N  D  G +A   A     +E +Q L++  T VN  DR+G T  + A R  H+  +  L   K  +ID      R ++ +T ++W++ +         L      ++   +G+T L+ A +   +E  +++++K G++ +  VD +  T L +A  G    +   LL N
Sbjct:  140 PIIWAAGRGHADIVH-LLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQ-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDK-GAR-VSAVDKKGDTPLHVAIRGRSRRLAELLLRN 390          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 114.005 bits (284), Expect = 4.343e-25
Identity = 83/279 (29.75%), Postives = 133/279 (47.67%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ EL+    +  LED D    T L+ A     I +V  LLK GA+    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G +E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMIAAEQGNVEIVKELIKNGANCNLEDLD--NWTALISASKEGHIHIVEELLKCGANLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          

HSP 2 Score: 83.1889 bits (204), Expect = 1.123e-15
Identity = 70/260 (26.92%), Postives = 126/260 (48.46%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            P+ +AA +G  ++++ LLLQ    +   D  G TPL++A     +E V+ LL  GAD +    + +T+L  A   GY   ++ +L    N+N  D  G +A   A     +E +Q L++  T VN  DR+G T  + A R  H+  +  L   K  +ID      R ++ +T ++W++ +         L      ++   +G+T L+ A +   +E  +++++K G++ +  VD +  T L +A  G    +   LL N
Sbjct:  140 PIIWAAGRGHADIVH-LLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQ-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDK-GAR-VSAVDKKGDTPLHVAIRGRSRRLAELLLRN 390          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 110.923 bits (276), Expect = 3.358e-24
Identity = 82/275 (29.82%), Postives = 131/275 (47.64%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            AA +G+ E++ EL+    +  LED D    T L+ A     I +V  LLK GA+    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G +E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:    3 AAEQGNVEIVKELIKNGANCNLEDLD--NWTALISASKEGHIHIVEELLKCGANLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 264          

HSP 2 Score: 56.9954 bits (136), Expect = 1.264e-7
Identity = 62/263 (23.57%), Postives = 111/263 (42.21%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +AA KG  E +  LL    DV + +     T L+ AV     + V+ +LKR  + N  D    T+L  A  +G++ +++ LLDAG  +N                                   DR+G T  + A R  H+  +  L   K  +ID      R ++ +T ++W++ +         L      ++   +G+T L+ A +   +E  +++++K G++ +  VD +  T L +A  G    +   LL N
Sbjct:  128 GTTPLVWAARKGHLECVKHLLAMGADV-DQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLDAGTYVNIP---------------------------------DRSGDTVLIGAVRGGHVEIVRALLQ-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDK-GAR-VSAVDKKGDTPLHVAIRGRSRRLAELLLRN 348          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Invs (inversin [Source:MGI Symbol;Acc:MGI:1335082])

HSP 1 Score: 107.071 bits (266), Expect = 4.295e-23
Identity = 91/297 (30.64%), Postives = 139/297 (46.80%), Query Frame = 3
Query:  462 FSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFET--KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLP-----LEC-LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLE-NGANIKFKDRNGAS 1325
             S++  S G S+ +  VH AA  GD   L  L++    + + +D  GRTPLMY V  D+++    LLK GAD N  D S  T+LH A  KG    ++LLL   AN   +D    +  H +  + + + L LL++F    +V+  D+N  T   W+   ++  H  +L  +K+     I   E    G+  +HW+   + P     + C L     E  +  +D EG+T L  A   G L    V+   + S  I   D+  RT L  A   GH ++V+ LLE N +     D  GA+
Sbjct:    3 ISEDVLSTGSSLASQ-VHAAAVNGDKGALQRLIVGNSALRDKEDRFGRTPLMYCVLADRVDCADALLKAGADVNKTDHSRRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHAKLL--IKHDSNIGIPDVE----GKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTS-YESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGAT 291          

HSP 2 Score: 94.7449 bits (234), Expect = 3.022e-19
Identity = 75/268 (27.99%), Postives = 122/268 (45.52%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGY--VALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFER----DRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            P+H+AA  G  ++++ LL + K      D  G TPL YA   +  E V+  L+  +  +  DL   TS  WA  KG   V    L L +  +IN  D +G +A H A     V  ++LL++ + +V+  D    TP   AC + H   +  L          I G  R    D++G +++HW+        C   + N+    ++D  G+T L  AA  G +    V++E      I+  D + RT+L  + N G+ + +  LL+  A
Sbjct:  258 PLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTL----------IKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQ--DKEGRTALHWSCNNGYLDAIKLLLDFAA 513          

HSP 3 Score: 80.8777 bits (198), Expect = 6.255e-15
Identity = 80/302 (26.49%), Postives = 130/302 (43.05%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNEL-----LLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEI-----TSLHWACFKGYVALIELLLDAG-ANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLI-LATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLII 1376
            P+H+AA   D   ++ +         + +L  QD  GRTPL +AV    + VV  L        SC+++       T LHWA   G+  ++ LLL+   +     DS G +  H+A   N  E +++ ++  +  +  D  G T  MWA    +   L  + ++K+     ID    D+ G T +H +            L N+  V   D    T L  A E G  +  + +I K G++   D+ DQD  SL+  A  GG+ +V   L+EN  N   +D  G + +  A       C  ++
Sbjct:  185 PLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTSY----ESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSD----IDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTLI-KGGARV--DLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVL 475          

HSP 4 Score: 79.7221 bits (195), Expect = 1.107e-14
Identity = 78/322 (24.22%), Postives = 131/322 (40.68%), Query Frame = 3
Query:  345 TLSRSSEALSPM-----TPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            T+   S+  +P+     + + E  + F  H +V D+   + R SF                 +AA KG+ ++L  +L  K D+ +   D  G T L  A     +  V+ LL   A  ++ D+ + T L  AC  G+  +I+ L+  GA ++  D  G S  HWA      +  Q+LIE +   N  D  G TP   A    +++ + VL        ++ D   +D+ GRT +HWS                                    G L+  K++++        + +++  T L  A  G   EV+ F+LE+GA
Sbjct:  282 TIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFM----------------WAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLME------NNADPNIQDKEGRTALHWSC---------------------------------NNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFMLEHGA 548          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd55 (ankyrin repeat domain 55 [Source:MGI Symbol;Acc:MGI:1924568])

HSP 1 Score: 104.76 bits (260), Expect = 1.255e-22
Identity = 88/322 (27.33%), Postives = 140/322 (43.48%), Query Frame = 3
Query:  462 FSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFE--TKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLEC---LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQE 1412
            F Q        ++   V+ AA+ GD   L  ++ +   +LE  D  G TPLM+AV   +++ V+ LLK GA+ N+ D    TSL  A + G++     LL  GA  N  D  GR   H A     V  L +L++    +++N  D  G+TP  WA   +   H  +L           D    D++ +T +HW+++    + C   L +      +   D+ GKT + +AA  G  +     + K     ++ +D  DRT L  A   G  E V  LL+ G +   +D N ++ +      Y  YC       +   E R E
Sbjct:   14 FDQHKGDSSEEVDLAMVYQAASNGDVNSLTSVIREDPSILECCDSEGCTPLMHAVSGRQVDTVKLLLKMGANINTQDAYGRTSLCLATYLGWLEGCVSLLRNGAKHNIPDKNGRLPLHAATAEPDVRLLIVLLQQSSLSEINHQDTEGMTPLHWAAFHNRPQHTQMLLK------KGADPTLVDKDFKTALHWAVQSGNRILCSIILSHRQGPSIINYDDESGKTCVHIAAASGFGDIIN-DLAKVPECNLQALDVDDRTPLHWAAASGKAECVQSLLDLGMDSNLRDINESTPL-----AYALYCGHTACVRLLSREGRAE 323          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EQG6|KDIS_RAT (Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 9.592e-25
Identity = 84/279 (30.11%), Postives = 132/279 (47.31%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ ELL    +  LED D    T L+ A     I +V  LLK GA     D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G +E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMLAAEQGNVEIVKELLKNGANCNLEDLD--NWTALISASKEGHIHIVEELLKSGASLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          

HSP 2 Score: 84.3445 bits (207), Expect = 3.566e-15
Identity = 71/260 (27.31%), Postives = 126/260 (48.46%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            P+ +AA +G  ++++ LLLQ    +   D  G TPL++A     +E V+ LL  GAD +    + +T+L  A   GY   ++ +L    N+N  D  G +A   A     +E +Q L++  T VN  DR+G T  + A R  H+  +  L   K  +ID      R ++ +T ++W++ +         L      ++   +G+T L+ A +   +E  +++++K G+K +  VD +  T L +A  G    +   LL N
Sbjct:  140 PIIWAAGRGHADIVH-LLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQ-KYADIDI-----RGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDK-GAK-VSAVDKKGDTPLHVAIRGRSRRLAELLLRN 390          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ULH0|KDIS_HUMAN (Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 2.041e-23
Identity = 81/279 (29.03%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHL---SHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA +G+ E++ EL+    +  LED D    T L+ A     + +V  LLK G +    D+   T+L WAC+KG   ++ELLL  GAN +    +      WA      + + LL++   KVN  D+ G TP +WA R  HL    HL  +    +QE           N  T +  +++        + L     V L D +G T L++A+++G  E  + +++     Y+   D    T LI A  GGH E+V  LL+  A+I  + ++  + +
Sbjct:   41 PLMIAAEQGNLEIVKELIKNGANCNLEDLD--NWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQE---------GANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTAL 306          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7T163|KDISB_DANRE (Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3)

HSP 1 Score: 108.612 bits (270), Expect = 1.524e-22
Identity = 87/279 (31.18%), Postives = 140/279 (50.18%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDS-FGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFK 1307
            GRS N   P+  A+ +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL+  A     D+   T+L WA +KG V +  +LL+ GAN NT    +      WA      E ++LL+E   KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  +
Sbjct:   41 GRSDNGQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIR 307          

HSP 2 Score: 91.6633 bits (226), Expect = 2.439e-17
Identity = 79/303 (26.07%), Postives = 141/303 (46.53%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLS-EITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR------LDHLSHLNVLANVKNQE------IDHIDGFER---------------DRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL +    +E +D  G T L +A Y  ++EV   LL+ GA+PN+      +  + WA  +G+  +++LLL+ GA +N  D +G +   WA      + +  L+E    V+Q   N +T  + A +      +  L   N   N+ +++      I   +G+                 DR+G T++  ++R    +E ++ L++++  + ++  E KT L  A E+G     + I++   +   E       T LI AT     EVV  LL+ GA +   D+ G + + IA
Sbjct:   86 AAKEGHVEVVKELL-ENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGG-HVEIVRALLHKYADIDIRGQENKTALYWAVEKGNATMVRDILQ--CNPDTETTTKDSETPLIKATKMRSIEVVELLLDKGAKVSAVDKRGDTPLHIA 384          

HSP 3 Score: 81.2629 bits (199), Expect = 3.612e-14
Identity = 78/296 (26.35%), Postives = 135/296 (45.61%), Query Frame = 3
Query:  420 WTVLDEKSDQIRKSFSQENFSPGRSINTP-------PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            WT L   S + R   +      G + NT        P+ +AA +G  E++ +LLL+    +   D  G TPL++A      + V  LL+ GAD +    + +T+L  A   GY  +++ LL    N+N  D  G +A   A      E +Q L++  T VN  DR+G T  + A R  H+  +  L + K  +ID      R +  +T ++W++ +         L      +    + +T L+ A +  ++E  +++++K G+K +  VD +  T L +A  G    +   LL N
Sbjct:  113 WTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIV-KLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLH-KYADIDI-----RGQENKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRSIEVVELLLDK-GAK-VSAVDKRGDTPLHIAIRGRSRRLAELLLRN 399          

HSP 4 Score: 73.1738 bits (178), Expect = 1.013e-11
Identity = 68/253 (26.88%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRN-GLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQL--KDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            G+TPLM A     +E+V+ L++RGA+ N  D+   ++L  A  +G+V +++ LL+  A I  +D  G +A  WA     VE   +L+E     N   +   + P +WA    H                                         E +K L+ EH  ++   D  G T L+ AA +G  +    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA
Sbjct:   46 GQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHA----------------------------------------EIVKLLL-EHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIA 252          

HSP 5 Score: 53.9138 bits (128), Expect = 7.169e-6
Identity = 33/83 (39.76%), Postives = 50/83 (60.24%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            V  + D G+T L+LA+EQG+LE  + +I +  +  ++DVD    ++LI A   GH EVV  LLEN A I+ +D  G + +  A
Sbjct:   39 VDGRSDNGQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWA 119          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O89019|INVS_MOUSE (Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 2.688e-22
Identity = 91/297 (30.64%), Postives = 139/297 (46.80%), Query Frame = 3
Query:  462 FSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFET--KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLP-----LEC-LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLE-NGANIKFKDRNGAS 1325
             S++  S G S+ +  VH AA  GD   L  L++    + + +D  GRTPLMY V  D+++    LLK GAD N  D S  T+LH A  KG    ++LLL   AN   +D    +  H +  + + + L LL++F    +V+  D+N  T   W+   ++  H  +L  +K+     I   E    G+  +HW+   + P     + C L     E  +  +D EG+T L  A   G L    V+   + S  I   D+  RT L  A   GH ++V+ LLE N +     D  GA+
Sbjct:    3 ISEDVLSTGSSLASQ-VHAAAVNGDKGALQRLIVGNSALRDKEDRFGRTPLMYCVLADRVDCADALLKAGADVNKTDHSRRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHAKLL--IKHDSNIGIPDVE----GKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTS-YESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGAT 291          

HSP 2 Score: 94.7449 bits (234), Expect = 2.043e-18
Identity = 75/268 (27.99%), Postives = 122/268 (45.52%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGY--VALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFER----DRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            P+H+AA  G  ++++ LL + K      D  G TPL YA   +  E V+  L+  +  +  DL   TS  WA  KG   V    L L +  +IN  D +G +A H A     V  ++LL++ + +V+  D    TP   AC + H   +  L          I G  R    D++G +++HW+        C   + N+    ++D  G+T L  AA  G +    V++E      I+  D + RT+L  + N G+ + +  LL+  A
Sbjct:  258 PLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTL----------IKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQ--DKEGRTALHWSCNNGYLDAIKLLLDFAA 513          

HSP 3 Score: 80.8777 bits (198), Expect = 4.228e-14
Identity = 80/302 (26.49%), Postives = 130/302 (43.05%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNEL-----LLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEI-----TSLHWACFKGYVALIELLLDAG-ANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLI-LATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLII 1376
            P+H+AA   D   ++ +         + +L  QD  GRTPL +AV    + VV  L        SC+++       T LHWA   G+  ++ LLL+   +     DS G +  H+A   N  E +++ ++  +  +  D  G T  MWA    +   L  + ++K+     ID    D+ G T +H +            L N+  V   D    T L  A E G  +  + +I K G++   D+ DQD  SL+  A  GG+ +V   L+EN  N   +D  G + +  A       C  ++
Sbjct:  185 PLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTSY----ESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSD----IDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTLI-KGGARV--DLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVL 475          

HSP 4 Score: 80.1073 bits (196), Expect = 6.477e-14
Identity = 78/322 (24.22%), Postives = 131/322 (40.68%), Query Frame = 3
Query:  345 TLSRSSEALSPM-----TPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            T+   S+  +P+     + + E  + F  H +V D+   + R SF                 +AA KG+ ++L  +L  K D+ +   D  G T L  A     +  V+ LL   A  ++ D+ + T L  AC  G+  +I+ L+  GA ++  D  G S  HWA      +  Q+LIE +   N  D  G TP   A    +++ + VL        ++ D   +D+ GRT +HWS                                    G L+  K++++        + +++  T L  A  G   EV+ F+LE+GA
Sbjct:  282 TIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFM----------------WAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLME------NNADPNIQDKEGRTALHWSC---------------------------------NNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFMLEHGA 548          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6JAN1|INVS_CANLF (Inversin OS=Canis lupus familiaris OX=9615 GN=INVS PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.869e-22
Identity = 92/301 (30.56%), Postives = 143/301 (47.51%), Query Frame = 3
Query:  465 SQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFET--KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLP-----LEC-LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLE-NGANIKFKDRNGASCVDIA 1340
            S+  F  G S+ +  VH AA  GD   L+ L++    + + +D  GRTPLMY V  D+++    LLK GAD N  D S+ T+LH A  KG    ++LLL   AN   +D    +  H A  + + + L LL++F    +V+  D+N  T   W+   ++  H+ +L  +K+     I   E    G+  +HW+   + P     + C L     E  +  +D EG+T L  A   G +    V+   + S  I   D+  RT L  A   GH ++V+ LLE N +     D  GA+ +  A
Sbjct:    4 SENLFFSGSSLASQ-VHAAAINGDKGALHRLIIGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLATRHKSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLL--IKHDSNIGIPDVE----GKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTS-YESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYA 296          

HSP 2 Score: 96.6709 bits (239), Expect = 5.583e-19
Identity = 77/268 (28.73%), Postives = 121/268 (45.15%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGY--VALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFER----DRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            P+H+AA  G  ++++ LL + K      D  G TPL YA   +  E V+  LK  +  +  DL   TS  WA  KG   V    L L +  +IN  D +G +A H A     V  ++LL+E   +V+  D    TP   AC + H   +  L          I G  R    D++G +++HW+        C   + N+    ++D  G+T L  AA  G +    V++E      I+  D + RT+L  + N G+ + +  LL+  A
Sbjct:  258 PLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTL----------IKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQ--DKEGRTALHWSCNNGYLDAIKLLLDFAA 513          

HSP 3 Score: 80.4925 bits (197), Expect = 4.928e-14
Identity = 78/322 (24.22%), Postives = 131/322 (40.68%), Query Frame = 3
Query:  345 TLSRSSEALSPM-----TPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            T+   S+  +P+     + + E  + F  H +V D+   + R SF                 +AA KG  ++L  +L  K D+ +   D  G T L  A     +  V+ LL+  A  ++ D+ + T L  AC  G+  +I+ L+  GA ++  D  G S  HWA      +  Q+LIE +   N  D  G TP   A    +++ + VL        ++ D   +D+ GRT +HWS                                    G L+  K++++        + +++  T L  A  G   EV+ F+LE+GA
Sbjct:  282 TIPSDSQGATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFM----------------WAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLME------NNADPNIQDKEGRTALHWSC---------------------------------NNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFMLEHGA 548          

HSP 4 Score: 79.337 bits (194), Expect = 1.043e-13
Identity = 80/302 (26.49%), Postives = 128/302 (42.38%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNEL-----LLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEI-----TSLHWACFKGYVALIELLLDAG-ANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLI-LATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLII 1376
            P+H+AA   D   ++ +         + +L  QD  GRTPL +AV    + VV  L        SC+++       T LHWA   G+  ++ LLL+   +     DS G +  H+A   N  E +++ ++  +  +  D  G T  MWA        L  + ++K+     ID    D+ G T +H +            L N   V   D    T L  A E G  +  + +I K G++   D+ DQD  SL+  A  GG+ +V   L+EN  N   +D  G + +  A       C  ++
Sbjct:  185 PLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTSY----ESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSD----IDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTLI-KGGARV--DLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVL 475          

HSP 5 Score: 76.6406 bits (187), Expect = 8.709e-13
Identity = 74/279 (26.52%), Postives = 119/279 (42.65%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELL-LQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACF---KGYVALIELLLDAGAN---INTQDSFGRSACHWACTYNTVEPLQLLIEFET-KVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDD---EGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKD 1310
            P+H A      + L  LL       ++ QD   +T L ++ YY+  E V+ L+K  ++    D+     LHWA        V  +  +LDA      +N QD  GR+  H+A     V  + +L  +E+  +  +D    TP  WA  L H   +++L      E +       D  G T +H++ +     E +K  +   +V  KDD   EG+T  + AA +G+ +  + ++       I   D    T+L  A   GH   V  LLEN A +   D
Sbjct:  117 PLHLATRHKSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLL-----ERNKSGTIPSDSQGATPLHYAAQSNF-AETVKVFLKHPSV--KDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATD 387          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210PQK2 (Inversin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16669 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 3.805e-108
Identity = 190/429 (44.29%), Postives = 271/429 (63.17%), Query Frame = 3
Query:  117 MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSIN---TPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIRE 1394
            M VKR+DFQK A  +H+FLLKL +  ECAELRD+LN++LLQLQKYYR  Q R+      +++N        Q+   +LS ++  LSPMTP+++ P  F   W  LD     +R   S    S   SIN    PP+  A  +G+FE+  EL+      +E+QD +GRT L+YAV++D  ++++ LL+ G + N+      T+LH AC       + +LL  G +   QD+ GR+  HWA T  + E L+ LI     VN  D++GL+P MWACRLDH+ H  +L++  N  +D  DG ERD NGRT +HWSIRR  PLECL+ L+ + T  ++D++GKTVLLLAAE G+L  CK+I+E  G+  I D D+Q+RT+L LA+ GGHG++VN+LL++GA++   D+  A+  D A+N+ L Y QLII SH R+
Sbjct:    1 MAVKRKDFQKAAAFLHEFLLKLNEDSECAELRDTLNLALLQLQKYYRLLQNRI------HEKNA-------QATSTSLSLTARGLSPMTPFVDAPDKFQWRWMNLD----SLR---SLTGISNEESINFTRLPPIIQAVKEGNFEMCVELIQNDISCIEEQDGIGRTALIYAVHFDVFDILKCLLESGVEVNATAHDGSTALHQACHDANHKALSMLLQYGGDFTMQDTQGRAPIHWAVTTKSTECLKYLIGHNADVNSRDKDGLSPCMWACRLDHIKHFELLSSSSNFNVDDADGIERDNNGRTWMHWSIRRSEPLECLQTLLTQETAAIRDEDGKTVLLLAAEMGSLLACKIIVEIGGNDCIYDRDNQERTALHLASVGGHGDIVNYLLDHGADLSAIDKFSANAWDYAKNRQLHYVQLIIMSHQRQ 409          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2T7PI45 (ANK_REP_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08547 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 4.033e-105
Identity = 194/430 (45.12%), Postives = 261/430 (60.70%), Query Frame = 3
Query:  114 KMTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINT---PPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIRE 1394
            K+TV   DFQK A  IH+FLLK+ +  ECAELRD+LN++LL +QKYYR  Q R Q                 +S + TLS S+  LSPMTP+++ P  F   W  LD        S    N S   S+N    PP+  AA KGD  ++ +L+     ++ D D +GRT LMYAV++ +   V +LL+  A+ N+      T+LH AC       + LLLD GA+I+ QD  GR+A HWA T  T + LQLL++        D++GLTP MWACR+DH+ H  +L+   N EI   DG ERD NGRT +HW++RR  PLECL  L+ +     +D+EGKTVL+LAAE G+L   K+II+  G   + D D+Q+RT+L LAT GGHG+VVN+LLE+GA+I   DR  A+  D AR++ L YCQLII SH R+
Sbjct:   18 KLTVA--DFQKAAAFIHEFLLKMNEDMECAELRDTLNLALLHMQKYYRALQSRSQ----------------EKSTQHTLSLSARGLSPMTPFVDAPDKFRWRWLNLD-------SSRFPSNMSVSESVNMSVLPPIIEAAKKGDLTIMQDLIDHDPSIVNDCDSIGRTGLMYAVHFFQHNAVNFLLENNAEVNATAHDGSTALHRACHDSNDVAVSLLLDLGADIHIQDMQGRAAIHWAVTTETTDCLQLLLDNSADPATKDKDGLTPCMWACRMDHIKHFELLS-CSNYEISEPDGIERDSNGRTWLHWAVRRTEPLECLLTLLTKEGSSYQDEEGKTVLMLAAEMGSLPATKLIIDIAGPMCVGDCDNQNRTALHLATIGGHGDVVNYLLEHGADINQPDRYNATAWDYARSRQLHYCQLIIMSHQRQ 421          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3I869 (inversin-A-like OS=Lingula unguis OX=7574 GN=LOC106161865 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 7.133e-103
Identity = 179/434 (41.24%), Postives = 268/434 (61.75%), Query Frame = 3
Query:  117 MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQESI 1418
            M +KR+DFQK A  I++FLLKL +  ECAELRDSLN++LL +Q+YYR  + R Q   R ++QN              L  S   LSPMTP+ + P  FH  W  +D  S ++  S   E    G  +  P V  AA +GD EL+ +LL + K  ++  D  GRT +MYAV++ + E ++ LL  GAD N+      T++H AC  G+   + +L+D  A++ T D  GR+  HWA +    + L+LL+E E  +N  D++G+TP+MWACR+DH+ H  +L +V +Q     DG ERD +G+T +HWS+R+  PLECL+  + + +  +KDDEGKTV+L AAEQG++   K ++E  G   I D D+Q RTSL LAT GGHGE +NFLLE+G ++   D++ A+ +D A+ ++L Y  +I+S++ R+ +++   I
Sbjct:    1 MVIKRKDFQKAAAFINEFLLKLGEGVECAELRDSLNLTLLYMQRYYRTLRLRSQSRERTDNQN-----------EQNLGMSVRGLSPMTPFRDVPDKFHWRWINID--SPKVSGSLPLE----GDLVTLPLVIQAAKQGDIELIEQLLEKDKRCIDQTDSHGRTCVMYAVHFKQNEALKILLDNGADVNAVAYDGSTAVHRACCDGHHEALRILIDHQADLTTGDCMGRAPVHWAVSVPEQDCLKLLLEHEVSINVRDKDGMTPSMWACRMDHIQHFELLTSVDDQ-WSSGDGLERDNHGKTWMHWSVRKTEPLECLQTFLTQESAAIKDDEGKTVMLTAAEQGSVVAMKTVLEIGGEDVIYDEDNQGRTSLHLATIGGHGECINFLLEHGVDLSKCDKSNATAMDYAKARHLNYSMMILSAYQRQRDKQNRKI 416          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8HGI7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 5.279e-101
Identity = 185/428 (43.22%), Postives = 265/428 (61.92%), Query Frame = 3
Query:  117 MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSS-EALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQD-RTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIRE 1394
            M VKR+DFQK +  IHQFLLKL  T ECAE+RD+LN++LL +QKYYR  ++RL++  + N                +LS SS   LSPMTP +E P+ F   W  L+ +   + +S  QE   PG  +       A+  GD E L  L       L++ D +GR  LMYAV +++ +   WLL+ GAD NS    + T+LH A  KG     ELL++  A+++ QDS GR+  HWA T +T E L++L++     +  DR+  TP+MWACRLD++ H  +L+ +  Q  +  DG ERD +G T +HW++RRQ PLECL+ L+ E    + D  GK VL++AAEQG+L  CK+I+E  G K I D  DQD R+++ LAT GGHGEV+NFLL+ GA+++ +DR+ A+  D A+ + L YC+LI++SH R+
Sbjct:    1 MAVKRKDFQKTSAYIHQFLLKLDSTPECAEVRDALNLALLHMQKYYRYLRRRLENRDKDN---------------ASLSNSSLRGLSPMTPPVERPERFEWRWQDLEGRRMSLLRS--QE---PGLPLGMSLALSASKTGDLETLKALHSNNPACLDECDGMGRGLLMYAVQFEQFDTADWLLRHGADVNSVAHDQSTALHLAVHKGLWNFTELLVNHRASVDCQDSMGRAPLHWAVTTHTTECLKILLKSRANPSVRDRDLTTPSMWACRLDNIDHFAILSRLV-QVNEFADGMERDASGWTFLHWAVRRQEPLECLRTLITEENAVVTDMSGKNVLMVAAEQGSLPACKIIME-VGGKSIIDYRDQDSRSAVHLATIGGHGEVLNFLLDQGADMEARDRDHATPWDYAKQRQLNYCKLILASHYRQ 406          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3HNF5 (uncharacterized protein LOC106156736 OS=Lingula unguis OX=7574 GN=LOC106156736 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.154e-100
Identity = 178/434 (41.01%), Postives = 271/434 (62.44%), Query Frame = 3
Query:  117 MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQESI 1418
            M +KR+DFQK A  I++FLLKL +  ECAELRDSLN++LL +Q+YYR  + R Q   R ++QN        Q+L +++      LSPMTP+ + P  FH  W  +D  S ++  S   E    G  +  P V  AA +GD EL+ +LL + K  ++  D  GRT +MYAV++ + E ++ LL  GAD N+      T++H AC  G+   + +L+D  A++ T D  GR+  HWA +    + L+LL+E E  +N  D++G+TP+MW CR+DH+ H  +L +V +Q     DG ERD +G+T +HWS+R+  PLECL+  + + +  +KDDEGKTV+L AAEQG++   K ++E  G   I D D+Q RTSL LAT GGHGE +NFLLE+G ++   D++ A+ +D A+ ++L Y  +I+S++ R+ +++   I
Sbjct:    1 MVIKRKDFQKAAAFINEFLLKLGEGVECAELRDSLNLTLLYMQRYYRTLRLRSQSRERTDNQN-------EQNLGMSM----RGLSPMTPFRDVPDKFHWRWINID--SPKVSGSLPLE----GDLVTLPLVIQAAKQGDIELIEQLLEKDKRCIDQTDSHGRTCVMYAVHFKQNEALKILLDNGADVNAVAYDGSTAVHRACCDGHHEALRILIDHQADLTTGDCMGRAPVHWAVSVPEQDCLKLLLEHEVSINVRDKDGMTPSMWTCRMDHIQHFELLTSVDDQ-WSSGDGLERDNHGKTWMHWSVRKTEPLECLQTFLTQESAAIKDDEGKTVMLTAAEQGSVVAMKTVLEIGGEDVIYDEDNQGRTSLHLATIGGHGECINFLLEHGVDLSKCDKSNATAMDYAKARHLNYSMMILSAYQRQRDKQNRKI 416          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 115.931 bits (289), Expect = 9.121e-26
Identity = 87/286 (30.42%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            GRS N   P+  AA +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL   A     D+   T+L WA +KG V + ++LL+ GAN NT   +      WA      E ++LL++ + KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   41 GRSDNGQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLLLKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTAL 314          

HSP 2 Score: 84.3445 bits (207), Expect = 4.348e-16
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+++ L++RGA+ N  D+   ++L  A  +G+V +++ LLD+ A I  +D  G +A  WA     VE  ++L+E     N   +  + P +WA    H   + +L                                       L ++  V   D  G T L+ AA +G  E    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLL---------------------------------------LKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKE 254          

HSP 3 Score: 50.8322 bits (120), Expect = 8.025e-6
Identity = 46/177 (25.99%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  519 AATKGDF-ELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIR 1043
             A KG + E++ ELL +  +V + D+D  G T LM A      E+V+ LL  G   N  D S  T L  A   G+V ++  LL   A+I+ +    ++A +WA        ++ +++         ++  TP + A ++ ++  + +L + K  ++  +     D+ G T +H +IR
Sbjct:  217 VAVKGGYTEVVKELLKRNPNVNMTDKD--GNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRNIDIVELLLD-KGAKVSAV-----DKKGDTPLHIAIR 385          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 115.931 bits (289), Expect = 9.827e-26
Identity = 87/286 (30.42%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            GRS N   P+  AA +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL   A     D+   T+L WA +KG V + ++LL+ GAN NT   +      WA      E ++LL++ + KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   41 GRSDNGQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLLLKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTAL 314          

HSP 2 Score: 84.3445 bits (207), Expect = 4.767e-16
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+++ L++RGA+ N  D+   ++L  A  +G+V +++ LLD+ A I  +D  G +A  WA     VE  ++L+E     N   +  + P +WA    H   + +L                                       L ++  V   D  G T L+ AA +G  E    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLL---------------------------------------LKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKE 254          

HSP 3 Score: 50.8322 bits (120), Expect = 8.087e-6
Identity = 46/177 (25.99%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  519 AATKGDF-ELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIR 1043
             A KG + E++ ELL +  +V + D+D  G T LM A      E+V+ LL  G   N  D S  T L  A   G+V ++  LL   A+I+ +    ++A +WA        ++ +++         ++  TP + A ++ ++  + +L + K  ++  +     D+ G T +H +IR
Sbjct:  217 VAVKGGYTEVVKELLKRNPNVNMTDKD--GNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRNIDIVELLLD-KGAKVSAV-----DKKGDTPLHIAIR 385          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 115.931 bits (289), Expect = 9.827e-26
Identity = 87/286 (30.42%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            GRS N   P+  AA +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL   A     D+   T+L WA +KG V + ++LL+ GAN NT   +      WA      E ++LL++ + KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   41 GRSDNGQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLLLKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTAL 314          

HSP 2 Score: 84.3445 bits (207), Expect = 4.767e-16
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+++ L++RGA+ N  D+   ++L  A  +G+V +++ LLD+ A I  +D  G +A  WA     VE  ++L+E     N   +  + P +WA    H   + +L                                       L ++  V   D  G T L+ AA +G  E    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLL---------------------------------------LKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKE 254          

HSP 3 Score: 50.8322 bits (120), Expect = 8.087e-6
Identity = 46/177 (25.99%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  519 AATKGDF-ELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIR 1043
             A KG + E++ ELL +  +V + D+D  G T LM A      E+V+ LL  G   N  D S  T L  A   G+V ++  LL   A+I+ +    ++A +WA        ++ +++         ++  TP + A ++ ++  + +L + K  ++  +     D+ G T +H +IR
Sbjct:  217 VAVKGGYTEVVKELLKRNPNVNMTDKD--GNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRNIDIVELLLD-KGAKVSAV-----DKKGDTPLHIAIR 385          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 115.546 bits (288), Expect = 1.177e-25
Identity = 87/286 (30.42%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            GRS N   P+  AA +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL   A     D+   T+L WA +KG V + ++LL+ GAN NT   +      WA      E ++LL++ + KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   41 GRSDNGQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLLLKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTAL 314          

HSP 2 Score: 83.9593 bits (206), Expect = 5.208e-16
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+++ L++RGA+ N  D+   ++L  A  +G+V +++ LLD+ A I  +D  G +A  WA     VE  ++L+E     N   +  + P +WA    H   + +L                                       L ++  V   D  G T L+ AA +G  E    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLL---------------------------------------LKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKE 254          

HSP 3 Score: 50.447 bits (119), Expect = 9.238e-6
Identity = 46/177 (25.99%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  519 AATKGDF-ELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIR 1043
             A KG + E++ ELL +  +V + D+D  G T LM A      E+V+ LL  G   N  D S  T L  A   G+V ++  LL   A+I+ +    ++A +WA        ++ +++         ++  TP + A ++ ++  + +L + K  ++  +     D+ G T +H +IR
Sbjct:  217 VAVKGGYTEVVKELLKRNPNVNMTDKD--GNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRNIDIVELLLD-KGAKVSAV-----DKKGDTPLHIAIR 385          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 115.546 bits (288), Expect = 1.290e-25
Identity = 87/286 (30.42%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  486 GRSINT-PPVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            GRS N   P+  AA +G  E++ EL+ +  +V L+D DC   + L+ A     +EVV+ LL   A     D+   T+L WA +KG V + ++LL+ GAN NT   +      WA      E ++LL++ + KVN  D+ G TP +WA R  H    +++L N    ++D     +   N  T +  +++     E +K L+  +  V + D +G T L++AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A+I  + ++  + +
Sbjct:   41 GRSDNGQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCW--SALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLLLKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLEN--GADVD-----QEGANSMTALIVAVKGGY-TEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLD--AGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTAL 314          

HSP 2 Score: 83.9593 bits (206), Expect = 5.661e-16
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+++ L++RGA+ N  D+   ++L  A  +G+V +++ LLD+ A I  +D  G +A  WA     VE  ++L+E     N   +  + P +WA    H   + +L                                       L ++  V   D  G T L+ AA +G  E    ++E        DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMLAAEQGSLEIIQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLDSSAYIEHRDMGGWTALMWAAYKGRVEVTKVLLENGANPNTTGQYSVYPIIWAAGRGHAEIVKLL---------------------------------------LKHDAKVNCSDKYGTTPLIWAARKGHYECVMHLLENGA-----DVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKE 254          

HSP 3 Score: 50.447 bits (119), Expect = 9.549e-6
Identity = 46/177 (25.99%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  519 AATKGDF-ELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIR 1043
             A KG + E++ ELL +  +V + D+D  G T LM A      E+V+ LL  G   N  D S  T L  A   G+V ++  LL   A+I+ +    ++A +WA        ++ +++         ++  TP + A ++ ++  + +L + K  ++  +     D+ G T +H +IR
Sbjct:  217 VAVKGGYTEVVKELLKRNPNVNMTDKD--GNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRNIDIVELLLD-KGAKVSAV-----DKKGDTPLHIAIR 385          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 7.289e-22
Identity = 75/273 (27.47%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDH-IDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+H A+     +  + L+    +V    D  GRT L +A +   +E+V  L+ +GA+ N+ D  E  ++HWA + G+  ++++LL  GA++N +D  G +  H A     V  ++LL+  + ++N+ +  G T    AC        N    V ++ +D   D   R+  G T +H++        CL+ LVN H  V  +  +GK+ L + A  G     + +I+  G   I+  D +  T L +A   GH  ++N L+ NGA+   +  +G
Sbjct:   17 PLHVASANRAIKCADALIPLLSNV-NVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACH-------NGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGE--IDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHG 279          

HSP 2 Score: 92.4337 bits (228), Expect = 2.390e-19
Identity = 87/300 (29.00%), Postives = 129/300 (43.00%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-----HLNVLANVKNQEID-----HIDG----FER--------------DRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETC-KVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGA 1322
            +H+AA  G+ E++N LL+ K   +   D   R  + +A Y    EVV+ LL  GAD N  D    T LH A   G+V ++ LLL   A +N  + FG +A H AC       +  L++        +  G T   +A    H +      +N  A+V  Q  D     H+      F R              D+ G T +H + R    L     + N      +   G   L LAA  G  + C K++   F    ++ VD+  RT L  A  GG+ E +N LL +GA++  KDR G+
Sbjct:   51 LHHAAFNGNLEMVN-LLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFD---VDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGS 346          

HSP 3 Score: 66.6254 bits (161), Expect = 1.846e-11
Identity = 76/304 (25.00%), Postives = 124/304 (40.79%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTP-------AMWACRLDHL---------SH---------LNVLANVKNQEIDHI--DGFE---RDRNGRTIVHWS--------IRRQLPLECLKYLVNEHTVQL-KDDEGKTV---LLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            P+H  A  G F   ++ L+Q    ++  D  G TPL  A  Y    ++  L+  GAD        +  LH A   G+      LL  G +++  D FGR+  H A      E + LL+     + + DR G          + ++C +  +         SH          N  A   ++ ++H+  +G E   RD+ G T  H++        +    P   L+ L++    +L +D + +++   L LAA  G  +  +V++   G   + D     R  L LA   GH E V  LL NGA
Sbjct:  216 PLHMTAIHGRFTR-SQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGSIAFVQDSGNSRYSCNVRTIAMRQSYNQHSHDTRICEPLICNASAAALHRCLEHLLQNGAEPALRDKQGYTAAHYAAAFGHRLCLELVSPAPALQQLLDMAGAELLRDPDSRSLVSPLHLAAYHGHHQALEVLLRFVGEADLRD--GHGRAPLELAAARGHTECVETLLANGA 516          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 4.231e-21
Identity = 86/268 (32.09%), Postives = 128/268 (47.76%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGR-TPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAM-WACRLDHLSHLNVLANV------KNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANI 1298
            A + G +EL   LL    +V ED+   G  TPLM A     +++VR LL  GAD N+   +  T+L +AC  GYV ++ +LL+AGAN+   +  G +    A +   VE  +LL+E    +N H       A+  AC   HL  +  L         K  E+ H    E   +G    H  + R L       L +   V +  D  ++ L LAA  G +E   ++IE+  +  +E+V+D+  T L+ A   GH E+V  LL  GANI
Sbjct:  140 ACSAGYYELAQVLLAMHANV-EDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEM-HTALMEACMDG----HVEVARLL-------LESGAQVNMPADSFESPLTLAACGGHVELAALLIERGAN--LEEVNDEGYTPLMEAAREGHEEMVALLLAQGANI 392          

HSP 2 Score: 82.4185 bits (202), Expect = 3.290e-16
Identity = 83/275 (30.18%), Postives = 133/275 (48.36%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN--TQDSFGRSACHWACTYNTVEPLQLLIEFETKVN---QHDRN-GLTPAMWACRLDHLSHL-NVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKD 1310
            P+  AAT G   ++  LL    D+    +    TPL  A    + EVV  L+ RGA+    ++S+ T L  A   GYV +I++LL+AGA IN  T    G S    A        ++LL++  + +N   + +RN  LT A +  R + +S L    ANV+++    +       +G    +  + R L LE     VN   V    D   T L +AA++G  + C+++I +    +I+  + +  T L LA NGGH +VV  L+ +GA++   D
Sbjct:  969 PLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGG---YAEVGRVL-LE-RGADVNAAPVPSSRD---TALTIAADKGHYKFCELVISR--GAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAAD 1233          

HSP 3 Score: 82.0333 bits (201), Expect = 4.743e-16
Identity = 81/321 (25.23%), Postives = 145/321 (45.17%), Query Frame = 3
Query:  426 VLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDL-SEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQL-KDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANI-KFKDRNGASCVDIARNQYLFYCQLIIS 1379
             LDE +  + +  ++   + G+  N   +  A + GD   + +LL + + V E  +  G + L  A      E+ + LL   A+     +  +IT L  A   G+V ++ LLL  GA++N Q S G +A  +AC    V+ +++L+E    +  H+ +G TP M A    H+    +L         H + F+   +  T+  +       LE +++L+     Q  K DE  T L+ A   G +E  ++++E      +    D   + L LA  GGH E+   L+E GAN+ +  D      ++ AR  +     L+++
Sbjct:   77 ALDEAAAALTRMRAETAAATGQPDNRS-LAEACSDGDVNAVRKLLGEGRSVHETTE-EGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKE--SALTLACYKGH----LEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLES--GAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLA 387          

HSP 4 Score: 67.0106 bits (162), Expect = 1.605e-11
Identity = 50/154 (32.47%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDL--SEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQ 974
            A  +G  E+++ LL+++K  +E +   G TPLM A      EV R LL+RGAD N+  +  S  T+L  A  KG+    EL++  GA+I+ ++  G +    A     ++ +QLL+     V+  D   +TP M A R  H+  +  L    NQ
Sbjct: 1109 ACFQGRHEVVS-LLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQ 1261          

HSP 5 Score: 66.6254 bits (161), Expect = 2.018e-11
Identity = 84/295 (28.47%), Postives = 124/295 (42.03%), Query Frame = 3
Query:  579 LEDQDCLGR-----TPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGR-SACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT--VQLKDDEGK-----------TVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKF----KDRNGASCVDIARNQYLFYCQLIIS--SHI 1388
            L D DC+       T L  A      ++V  L+ RGA+    D    T L  A   G+V ++ELLLD GA+I  Q    + +    AC+    E ++LLI         + +  TP   A    +++ + +L N    EI          N RT     I    PL  +   +N HT  V+L  D G            T L LA  QG  E   +++E+     +E       T L+ A +GG+ EV   LLE GA++        R+ A  +   +  Y F C+L+IS  +HI
Sbjct:  921 LVDIDCIHTESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNA-GAEI----------NSRTGSKLGIS---PL--MLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVER--KANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKF-CELVISRGAHI 1196          

HSP 6 Score: 58.5362 bits (140), Expect = 7.551e-9
Identity = 46/144 (31.94%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  531 GDFELLNELLLQKKDVLEDQDCLG-RTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNG-LTPAMWACRLDHLSHLNVL 956
            G F  + + L++    LE    LG  TPLM A     +E+V++LL  GA+ ++   +  T+L +AC  G+  + +LLL AGA++  +   GR+    A     V  +Q LI     VN+   N   T    AC   HLS + +L
Sbjct:  410 GGFLEVADFLIKAGADLE----LGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELL 549          

HSP 7 Score: 53.1434 bits (126), Expect = 2.730e-7
Identity = 36/102 (35.29%), Postives = 52/102 (50.98%), Query Frame = 3
Query:  510 VHYAATKGDFEL----------LNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDL-SEITSLHWACFKGYVALIELLLDAGANIN 782
            VH     GD  L          + +LLLQ    LE +   GRTPLM A     +  V++L+ +GAD N     ++ T L  AC  G+++++ELLL  GA+ N
Sbjct:  456 VHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPN 557          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.362e-19
Identity = 95/340 (27.94%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  441 SDQIRKSFSQENFS--PGRSINTPPVHYAATKGDFELLNELLLQKKDV--LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSH-----LNVLANVKNQEID-----HIDG----FER--------------DRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKY-----------------IEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDR 1313
            ++ I    S  N S   GR+     +H+AA  G  E++N L+ +  ++   + +D   R  + +A Y    EVV+ L+  GAD    D    + LH A   G + +++LLLD G +I+  +SFG +A H AC       +  LI+    VNQ +  G TP  +A    H +      +N  A+V  Q  D     H+      F R              DR+G T +H + R    L     + N      +   G   L LAA  G  + C+ ++   G KY                 I+  D+  RT L  A +GG+ E +N LL  GA++  KDR
Sbjct:  121 AEAIIPMLSSSNVSDRAGRT----ALHHAAFNGHSEMVNFLVAKGANINAFDKKD---RRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSA-GQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDR 452          

HSP 2 Score: 85.8853 bits (211), Expect = 2.346e-17
Identity = 72/275 (26.18%), Postives = 130/275 (47.27%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNEL--LLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEID-HIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+H AA     +    +  +L   +V    D  GRT L +A +    E+V +L+ +GA+ N+ D  +  ++HWA + G+  ++++L+  GA++  +D  G S  H A +   +  ++LL++    ++  +  G T    AC        N    V N+ ID   +  + +  G T +H++        CL+ LVN    V ++  +GK+ L + A  G     + +I+  G    ED D    T L +A   GH  ++N L+ NGA+   +  +G
Sbjct:  108 PLHVAAANRAVKCAEAIIPMLSSSNV---SDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVAC-------YNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGN--TPLHIAARYGHELLINTLITNGADTAKRGIHG 370          

HSP 3 Score: 80.8777 bits (198), Expect = 9.507e-16
Identity = 79/274 (28.83%), Postives = 129/274 (47.08%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV--LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+  A   GD + +  L+ +K++V  ++D+    RTPL  A Y  + E++  L+  GA  NS D   +T LH AC     A ++ LL   A++N +D   ++  H A     V+  + +I   +  N  DR G T    A    H   +N L   K   I+  D  ++DR     +HW+       E +K LV     V+ KD +G + L  A+  G +   K++++  G   I+D +    T+L +A   G   VVN L++ GAN+   +  G
Sbjct:    9 PLIQAIFNGDPDEVRSLIYKKEEVNAVDDEK---RTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLV-AKGANINAFD--KKDRRA---IHWAAYMG-HTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLD-LGVD-IDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERG 270          

HSP 4 Score: 73.559 bits (179), Expect = 1.580e-13
Identity = 92/379 (24.27%), Postives = 149/379 (39.31%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKD---VLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFE----TKVNQHDRNGLTPAMWACRLDHLSHLNVLANV---KNQEIDH-------------------IDGFER------DRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR-------------------------------------TSLILATNGGHGEVVNFLLENGANIKFKDRNGAS-CVDIARNQYLFYCQLIISSHIREMERRQESIPS 1424
            +H AAT G  E L  LL++  D    ++  D   +TP+M AV     +    LL +GA  N+ D    T+LH     G+   ++LLL    +++ ++  GR+  H A     +  L  L++        +   DRNG TP  WAC   H   + +L  +   + QE +                    ID F        D  GR  +H +      +ECL+ L++ +  V + D  GK+ L++A E G     +V++    +K    + D +R                                     T L LA   G   VV  LL  GA+I   D NG +  +  A N+ +  C  +I   +  +    +++PS
Sbjct:  654 LHSAATNGHVECL-RLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTD-HVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNS--TKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCAPNKSVAECLSLILGAMLPLS--PDAVPS 1026          

HSP 5 Score: 72.0182 bits (175), Expect = 5.205e-13
Identity = 61/242 (25.21%), Postives = 105/242 (43.39%), Query Frame = 3
Query:  603 RTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNE-HTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGAS 1325
            + PL+ A++    + VR L+ +  + N+ D  + T LH A + G   +IELL+ +GA +N++D+   +  H AC   +   +Q L++    VN  D+N  TP                         H+    R                 ++C + ++    +  + D  G+T L  AA  G  E    ++ K     I   D +DR ++  A   GH EVV  L+ +GA+++ KD+ G S
Sbjct:    7 QAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPL------------------------HVAAANR----------------AVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAK--GANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYS 206          

HSP 6 Score: 63.1586 bits (152), Expect = 2.136e-10
Identity = 75/280 (26.79%), Postives = 120/280 (42.86%), Query Frame = 3
Query:  549 NELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWAC------------TYNTVEP----------------LQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERD-RNGRTI--VHWSI--RRQLPLECL-KYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            NE +L     ++  D  GRT L  A     +E +  LL  GAD N  D  E T+LH+A     V  +  L+ +GA +N QD    +  H+A              YNT+                  L+ L+  +      D+ G TP  +A    H   L +L       ++    F+ D ++G  I  +H +        LE L + LV+   + +++  G T L LAA +G  +  +V+I+   S  +++  D+ RT+L  A   GH E +  L+EN
Sbjct:  404 NEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELL-------LEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVD---LDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDR-RTALHSAATNGHVECLRLLVEN 672          

HSP 7 Score: 59.6918 bits (143), Expect = 3.059e-9
Identity = 79/314 (25.16%), Postives = 131/314 (41.72%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGA------------------DPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDH---------------LSHLNVLANVKNQEI--DHI-----DGFERDRNGRTIVHWSIRRQLPLECLKYLVNE-HTVQLKDDEGKTV--LLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKD 1310
            P+H AA  G   L+N L+    D  + +   G  PL  A      +  R LL  G                   + ++ D    T LH A   G V  + LLL  GA++N +D F R+A H+A     V+ +  L+    ++N+ D    TP  +A   D                 S+++V +     +I  +H+     D   +D+ G T VH++      + CL+ L+ +    Q     G  +  L LAA  G     +V+I     + + D+D ++    T L LA   GH + V  L+++GA++  K+
Sbjct:  340 PLHIAARYGHELLINTLITNGADTAK-RGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRV-CLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLI-----RSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKE 646          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.441e-19
Identity = 78/279 (27.96%), Postives = 136/279 (48.75%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            P+H AA  G  +++ E+LL++   +  +   G +PL  A   + +  V+ LL R A  +   L  +T LH A   G+  + +LLLD G   N +   G +  H AC  N ++ ++LL++    ++    +GLTP   A  + HL+ + +L  ++N    +      +  G T +H + R    LE +K L+     V +K  E +T L +A+  G  E  ++++++              T L  A+  GHG+V + LLENGA+I    + G + + IA
Sbjct:  281 PLHCAARSGHEKVI-EMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLL--LQNGASSN----ATNVRGETPLHMASRAG-QLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGS--TPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIA 549          

HSP 2 Score: 90.1225 bits (222), Expect = 1.018e-18
Identity = 89/316 (28.16%), Postives = 144/316 (45.57%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV----LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDH---------------------LSHLNVLANVKNQEIDHI---DGFERD---RNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            P+H A+  G  E++  LL     V     EDQ     TPL  A    K E+V+ LL+RG+DPN+   S  T L++A  +G+  +  LLL+ GA+I+     G +  H A  Y  +E   LL+E     +   +NGLTP   A   DH                      + L++ A     E+  +    G E +   + G   +H + +     + +  L+  H ++ L    G T + LAA++      KV + +  +K+  DV+   +   T L +A++ G+ ++VNFLL N A +  K RNG + +  A  Q
Sbjct:  446 PLHMASRAGQLEVVKTLLQSGARVGVKAREDQ-----TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHA-DMVALLLGRHASISLATKGGLTAMHLAAQED-----KVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQ 750          

HSP 3 Score: 83.1889 bits (204), Expect = 1.436e-16
Identity = 83/318 (26.10%), Postives = 144/318 (45.28%), Query Frame = 3
Query:  495 INTPPVHYAATKGDFELLNELLLQ--------KKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVL----ANVKNQEIDHID--------------------GFE---RDRNGRTIVHWSIRRQLPLECLKYLVNE-HTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            +  P +H AA K D      LLLQ         K +L      G TPL  A +Y  + V   LL  GA  +    + IT LH A  +G   +++LLLD GA I+T+   G +  H A      + +++L+E +  +    +NGL+P   A + +HL+ + +L    A V +  +D++                     G E   R  NG T +H + ++   ++ ++ L+    ++    + G T + +A+  G L   +++++   S    +V  +  T L +A+  G  EVV  LL++GA +  K R   + + IA
Sbjct:  170 VRLPALHIAARKDDTNA-AALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKN-RIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNV--RGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA 483          

HSP 4 Score: 82.4185 bits (202), Expect = 2.799e-16
Identity = 73/273 (26.74%), Postives = 118/273 (43.22%), Query Frame = 3
Query:  552 ELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLN-VLANVKNQEIDHIDGFE---------RDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            E LL K D          T  + A     +E +   LK G D N+C+ + + +LH A  +G+V ++  LL   A I+T    G +A H A      + +++L+EF   +N   +NG TP   A + +HL  +  +L N  NQ +   DGF           ++    ++    + ++ L  L      H    KDD     LLL  E  A  T K+++ +          +   T L +A + G+  V   LL  GA + F  RNG + + +A
Sbjct:    2 ETLLDKSDA--------ATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPAL------HIAARKDDTNAAALLLQHEHNADVTSKMMLNQ--------TTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVA 252          

HSP 5 Score: 78.5666 bits (192), Expect = 4.665e-15
Identity = 78/330 (23.64%), Postives = 142/330 (43.03%), Query Frame = 3
Query:  489 RSINT-PPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDH---------------------LSHLNVLANVKNQEI------DHIDGFERDRNGRTIVHWSI---RRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSH 1385
            R++N   P+H A  K   +++ ELLL+    +      G TP+  A +   + VV+ LL+ GA  N+ ++   T LH A   G + +++ LL +GA +  +    ++  H A      E +QLL++  +  N    +G TP  +A R  H                      + L++ +     E+       +     + +NG T +H +     +++ L  L    + H+       G T L +AA++  LE  KV++E  G++    +  Q    L LA   GH ++V  LL   A+I    + G + + +A  +       I++ H
Sbjct:  373 RALNGFTPLHIACKKNRIKVM-ELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTA---KNGYTPLHIAAKKNQLEVGKVLLE-LGAE-TNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKH 696          

HSP 6 Score: 60.4622 bits (145), Expect = 1.753e-9
Identity = 57/226 (25.22%), Postives = 102/226 (45.13%), Query Frame = 3
Query:  369 LSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRR 1046
            +SP+T     P +  + +  L+  +  + K  S +   P       P+H A T  D + +  LLL K          G TPL  A   +++EV + LL+ GA+ N      +  LH A  +G+  ++ LLL   A+I+     G +A H A   + V   ++L + +  VN   +   TP   A    ++  +N L  ++N+ + +     + RNG T +H + ++
Sbjct:  535 ISPVTKKGFTPLHIASKYGRLEVATLLLEKYASAD---PKGKNGLTPLHVA-THYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFL--LRNRALVN----AKTRNGYTPLHQAAQQ 750          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 92.0485 bits (227), Expect = 2.189e-19
Identity = 91/307 (29.64%), Postives = 142/307 (46.25%), Query Frame = 3
Query:  459 SFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEF--ETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFE-RDRNGRTIVHWSIRRQLP-----LEC-LKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQD---RTSLILATNGGHGEVVNFLLE-NGANIKFKDRNGASCVDIA 1340
            S S+ + S   S+ T  VH AA  GD   L ++L+   +  +  D  GRTPLMY V  D+ E    L+K GA+ N  D S+ T+LH A  KG   +++LLL   A++  +D  G +  H A  + T   L LL++     +V+  D    T   W+   +H  H+ +L       I H       D  G+  +HW+   + P     + C L+    +  +  +D EG+T L  A   G     + +++   S  + +V   D   RTSL  A   GH ++V+ LLE N +     D  GA+ +  A
Sbjct:    3 SASELSISKSPSL-TSQVHAAAINGDRSALQKILVANPEFRDAPDQFGRTPLMYCVLADRPECAEALVKAGANVNKTDKSKRTALHLAAQKGNYRILKLLLSRRASLLQKDLEGMTGLHLATRHETPRCLALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRML-------IKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNWQDYEGRTPLHFAVADGN----EAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPSDSQGATPLHYA 297          

HSP 2 Score: 87.8113 bits (216), Expect = 3.875e-18
Identity = 88/310 (28.39%), Postives = 133/310 (42.90%), Query Frame = 3
Query:  417 HWTVLDEKSDQIRKSFSQENFS---PGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLK--RGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIR---RQLPLECLKY--LVNEHTV--------QLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            HW  L   + +I     + N S   P  S    P+HYAA     E + E+ L    V ++ D   RT  M+A       VV  +L+     D N  D    T+LH A   G+V+ + LLL  GA ++  +    +    AC     E ++ LIE   +V+  D++G +P  WA            A   N +I  I      RNG   +H  +R   R+ PL+C  Y   +N   V         ++D EG T L      G L   K+++E        + +++  T L  A  GGH EV+ ++LE+GA
Sbjct:  261 HWAALLGHA-KIVHLLLERNSSGTIPSDSQGATPLHYAAQSNHAETV-EVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWA------------ALGGNADICLI----LIRNG---IHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQDKEGMTALHWCCNNGYLNAVKLLLEYGAFPNHMETNEERYTPLDYALLGGHQEVIQYMLEHGA 549          

HSP 3 Score: 73.1738 bits (178), Expect = 1.766e-13
Identity = 78/332 (23.49%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  417 HWTVLDEKSDQIRKSFSQE-NFSPGRSINTPPVHYAATKGDFELLNEL--LLQKK---DVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEI-----TSLHWACFKGYVALIELLLDAGANINT-QDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLII 1376
            HW+      + +R     + N     S    P+H+AA   D   ++ +  LL+      +L  QD  GRTPL +AV      VV  L      P  C+++       TSLHWA   G+  ++ LLL+  ++     DS G +  H+A   N  E +++ +   +  ++ D    T  MWA      + ++ +  +    I ++D    D+ G T +H +            L +   V   +    T L  A E G  E  + +IE  G   ++ VD    + L  A  GG+ ++   L+ NG +   +D    + +  A       C +++
Sbjct:  155 HWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNWQDYEGRTPLHFAVADGNEAVVDIL----TSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPSDSQGATPLHYAAQSNHAETVEVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRL----IPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIE--GGARVDLVDQDGHSPLHWAALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVL 476          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 61.6178 bits (148), Expect = 4.110e-10
Identity = 58/239 (24.27%), Postives = 100/239 (41.84%), Query Frame = 3
Query:  639 IEVVRWLLKRGA-DPNSCDLSEITSLHWACFKGYVALIELLLDAGANIN-TQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            ++VV+ +++ GA D N+  + E++ LHWAC     ++ + LL  GAN N      G +A HWA  Y  +  + LL++        D  GL    ++    ++  +  +        D++D   +D N RT + W                                 AA QG   T ++++ KFGS  +   D++   +L  A  GG   V+  L+ +GAN   ++     C D+A   
Sbjct:   63 LKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLW---------------------------------AAYQGDFLTVELLL-KFGST-VAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGM 266          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 59.3066 bits (142), Expect = 1.819e-9
Identity = 55/226 (24.34%), Postives = 91/226 (40.27%), Query Frame = 3
Query:  702 ITSLHWACFKGYVALIELLLDAGANINTQ-DSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-----VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFY 1361
            IT LHWA     +++++ L+  GA++N +  +   +  HWA  Y  V  +  L+          ++G  P M                              D  G  ++H S+     +  L  L N  +     +  +D +G+T LL AA QG   T   ++ KFG+  I+  D +  T L   T  G   V+ +L+++GA+   K   G  C  IA+     Y
Sbjct:  110 ITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLL----------KHGADPTM-----------------------------TDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL-KFGAS-IKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVY 294          

HSP 2 Score: 58.5362 bits (140), Expect = 3.890e-9
Identity = 38/142 (26.76%), Postives = 62/142 (43.66%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLL-----DAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWA 920
            +H+A+      +++ L+ Q  DV      L  TPL +A  Y  + +V +LLK GADP   D      LH +     + L+  +L         +I+ +D  GR++  WA        +  L++F   +   D  G TP  W 
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWG 254          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 55.8398 bits (133), Expect = 5.153e-9
Identity = 64/265 (24.15%), Postives = 109/265 (41.13%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDL---SEITSLHWACFKGYVALIELLLD--AGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
            P+H A  + +F  + ELL  K  +L  +D  GR PL ++V +   E+  +LL +  + N  D    S  T  H AC  G + +++ L D     ++N   + G +  H A      E  Q LIE    V   D+    P   A  +  L  + +L  +                G++ V+W                      +D +G T L  A  +G  +   +++EK+G++Y + VD++   +  +A N    +V  F L N
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGL----------------GKSAVNW----------------------QDKQGWTPLFHALAEGHGDAAVLLVEKYGAEY-DLVDNKGAKAEDVALN---EQVKKFFLNN 227          

HSP 2 Score: 51.6026 bits (122), Expect = 1.179e-7
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  996 FERDRNGRTIVHWSIRRQ---LPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDR 1313
             ++D++GR  +HWS+  Q   +    L  + N +     DD G T   +A   G LE  K + ++     +  + +Q  T L LA      EV  FL+ENGA+++ KD+
Sbjct:   30 LQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDK 138          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: SPT23 (ER membrane protein involved in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting; SPT23 has a paralog, MGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000001503])

HSP 1 Score: 54.299 bits (129), Expect = 8.882e-8
Identity = 25/72 (34.72%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  687 CDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGL 902
            CD+   T LH A F  + +L+ LL+  G+++N QD FG +  H AC    +  ++LL+E    + +  RNG 
Sbjct:  706 CDVRGRTLLHLAAFNNWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIRLLLECNVNIMKKTRNGF 777          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: MGA2 (ER membrane protein involved in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting; MGA2 has a paralog, SPT23, that arose from the whole genome duplication [Source:SGD;Acc:S000001472])

HSP 1 Score: 53.1434 bits (126), Expect = 1.691e-7
Identity = 29/97 (29.90%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  621 AVYYDKIEVVRWL--LKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLT 905
             +Y D++ + + +  L   ++ + CD    T LH AC K Y +L+  L+  GA +N  DSFG +  H+AC     + +++L+  +   +    NGLT
Sbjct:  692 VLYSDEVLIQKVIKSLNINSNISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKMLLNCKVNYSLRSHNGLT 788          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO44583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI8])

HSP 1 Score: 196.438 bits (498), Expect = 4.790e-55
Identity = 135/439 (30.75%), Postives = 209/439 (47.61%), Query Frame = 3
Query:  132 RDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPR-QSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAV--------------------------------------------YYDKIEVVRWLLK---RGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGF--ERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANI 1298
            +DFQKIA  +  FL KL+     AELRD+LN++LL +QKYY+        T R   Q+ T  +SPR     +  + S  A+SP++P    P  F   W   + +S ++  S   + FS         V  A   GD E + +L+ +    +E  D LGR  +MYAV                                            Y + + +VR  L    R A      +S  T+LH A  +   A + LLL   A+ N +D  GR+  HWA   ++++ L+LL++    +N  D  GLT AMWAC  D   +L+ L    ++     +    ++D  GRT+VHW++ R   LECLK L+ + T +L D E +++L  AAEQG L  C+++++  G   +  +D+Q RT L LA   G  +++N+LL+ G  +
Sbjct:    1 KDFQKIAQMVQDFLGKLSCEEGTAELRDALNLTLLYMQKYYK--------TLRSRSQSNTNGISPRCVGGTLLFTSSCGAISPVSPACGLPDIFE--WKWFNIESPKLSASLGTDEFSM-----LSNVLQATKAGDLEAVKDLIEKDPKCVESNDGLGRNAVMYAVHGKSDPHTECLEVLLEAGSNVDHQANGKTSSHYLCFEKGKSVRKYKELMAIVRNCLSPFLRSAHVQGFSISSSTALHVAAHETNSAALSLLLKYKASCNIEDHEGRTPLHWASGNSSLDNLKLLLQHGANINALDCEGLTAAMWACHYDQKHNLSTLKTALSRFDPREEALFEQQDVKGRTVVHWAVNRSTSLECLKELLTKETGKLLDGENRSILHTAAEQGCLAACELVLDVSGCDCLNLIDNQGRTPLHLAALCGQAQIINYLLDVGGML 424          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 73.559 bits (179), Expect = 1.521e-14
Identity = 66/236 (27.97%), Postives = 105/236 (44.49%), Query Frame = 3
Query:  609 PLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHI-----DGFERDRNGRTIVHWSIR--RQLPLE-CLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGA 1292
            PL  A      E  + LL  G D N+ D ++ T LH A   G V  +ELL+    + N  D  GR+  H+A  +     +  L+   + VN+ D    TP  +A            +++  + ++H+     +  +RD+ G + VH++     +L +E  L    N+   +       T L LAA  G     +V+I+ F    +E  DD+ RT L LA+  GH E V  LL + A
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYA----------AASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFND--LEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 2 Score: 55.4546 bits (132), Expect = 1.993e-8
Identity = 58/200 (29.00%), Postives = 87/200 (43.50%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVA-LIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNG---LTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTV 1094
            P+H AA  G+   L ELL+ +       D LGR PL YA  +     V  L+  G++ N  D    T LH+A      A  +E LL    N + +D  G SA H+A        +++L++       +  +G   +TP   A    H   L VL    N      D   RD  GRT +  +   Q  +EC++ L+N + +
Sbjct:   36 PLHCAACSGNVNCL-ELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFN------DLEVRDDRGRTPLDLA-SFQGHVECVECLLNHNAM 227          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO42780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Q6])

HSP 1 Score: 72.4034 bits (176), Expect = 1.875e-14
Identity = 53/188 (28.19%), Postives = 86/188 (45.74%), Query Frame = 3
Query:  489 RSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEF--ETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDH-IDGFERDRNGRTIVHWSIR 1043
            +++    +H     GD   L E   + K ++E  +  G TPL  AV    +E V++L   GA  N+ D    T L  A ++G+   +  LL  GA+    D+ GR   H A  Y++   + LL++      +N+ D  G+T   WA       H+ +L       IDH  +   RD  G+T +HW+ +
Sbjct:   11 QALMASIIHELVHAGDITALKEEFQRDKGLIEALNSEGMTPLFVAVSTGNLECVQFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAATYYSSGRTVGLLLQHLPSDHINKQDGEGMTALHWAAYHGRAEHVKLL-------IDHDAEIVARDTEGKTALHWAAQ 191          

HSP 2 Score: 69.707 bits (169), Expect = 1.495e-13
Identity = 47/145 (32.41%), Postives = 68/145 (46.90%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLD--AGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDH 935
            P+  A + G+ E + + L      L  +D LGRTPL  A Y    + V +LL  GAD    D      LH A +      + LLL      +IN QD  G +A HWA  +   E ++LLI+ + ++   D  G T   WA ++ H
Sbjct:   51 PLFVAVSTGNLECV-QFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAATYYSSGRTVGLLLQHLPSDHINKQDGEGMTALHWAAYHGRAEHVKLLIDHDAEIVARDTEGKTALHWAAQVSH 194          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK80])

HSP 1 Score: 71.2478 bits (173), Expect = 2.013e-13
Identity = 60/222 (27.03%), Postives = 104/222 (46.85%), Query Frame = 3
Query:  363 EALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQEN--FSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDR-NGLTPAMWACRLDHLSHLNVLANV---KNQEIDHIDGFERDR 1010
            ++L P T Y+   ++       L   + +    +SQ N  F+     +   +H A  + D + + ++L +   V+E  D  G TPLM A     I+V+  LL+ GADPN  + S  T +  +C+ G     +LL + G    ++D  G ++ HWA      + L  +++   +V+  D  NG TP M   R+  LS  + +A V   K  +++  D   +DR
Sbjct:   64 KSLEPNTEYLCRSRFVDGSQQTLGHGAAR----WSQPNHVFTAKEPPSGAELHKAVARQDLDQVRKILSENNSVVEVMDKFGLTPLMVAAQKGYIDVMETLLEFGADPNYFNSSGKTCMMISCYSGQEEPAKLLRERGVEWGSRDKNGLTSVHWAADGGHDDLLLWMLKDGAQVDLEDTYNGWTPLM---RVACLSGNDEVAEVLIAKGADVNRTDKSRKDR 278          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN63])

HSP 1 Score: 60.8474 bits (146), Expect = 2.435e-11
Identity = 38/107 (35.51%), Postives = 57/107 (53.27%), Query Frame = 3
Query:  480 SPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFG 800
            SPG +    P+H A  KG+ EL+ ELL    D+  +    GR+PL +AV   +  V+ +LL RGA  N    S  T++H A  +    ++ LL   GA++N Q+  G
Sbjct:    3 SPGMT----PLHLATLKGNRELITELLRMGADLNVEDGNSGRSPLHHAVESGRYHVIEFLLSRGALVNQRTFSGNTAMHTAAGRQMDEVVSLLASYGADVNIQNREG 105          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033617.1 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 119.013 bits (297), Expect = 9.391e-27
Identity = 88/278 (31.65%), Postives = 139/278 (50.00%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA  G+ E++ E + +  +V L+D DC   T L+ A     IEVVR LL+  A+    DL   T+L WA +KG   + ELLL+ GAN N    +      WA      E + LL++   KVN  D+ G TP +WA R  H    +++LAN    ++D     +   N  T +  ++R     E +K L+  +  V + D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A++  + ++G + +
Sbjct:   49 PLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLAN--GADVD-----QEGANSMTALIVAVRGGY-TEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLD--AGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTAL 314          

HSP 2 Score: 102.064 bits (253), Expect = 1.580e-21
Identity = 85/302 (28.15%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR---------------------LDHLSHLNVLANVKNQEI--DHIDGFE----RDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL    + LE +D  G T LM+A Y  + +V   LL++GA+PN      +  + WA  +G+  ++ LLL  GA +N  D +G +   WA      + +  L+     V+Q   N +T  + A R                      D  + L + A   + EI  D +D        DRNG T++  ++R    +E ++ L+N++  V ++  +GKT L  A E+G     + I++   +   E    +  T LI AT   + E+V  LL+ GA +   DR G + + IA
Sbjct:   86 AAKEGHIEVVRELLENHAN-LEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGG-HVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ--CNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 3 Score: 75.8702 bits (185), Expect = 1.930e-13
Identity = 65/253 (25.69%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+V+  ++RGA+ +  D+   T+L  A  +G++ ++  LL+  AN+  +D  G +A  WA      +  +LL+E     N   +  + P +WA    H                             IVH  ++    + C             D  G T L+ AA +G  + C + +   G+    DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAE---------------------------IVHLLLQHGAKVNC------------SDKYGTTPLIWAARKGHYD-CVMHLLANGA----DVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKE 254          

HSP 4 Score: 67.781 bits (164), Expect = 4.876e-11
Identity = 68/263 (25.86%), Postives = 115/263 (43.73%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +AA KG ++ +  LL    DV + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +G+  +++ LLDAG  +N                                   DRNG T  + A R  H+  +  L N K  ++D      R ++G+T ++W++ +   +     L      +    EG+T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWAARKGHYDCVMHLLANGADV-DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIP---------------------------------DRNGETMLIGAVRGGHVEIVRALLN-KYADVD-----VRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDK-GAK-VSAVDRKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 50.8322 bits (120), Expect = 7.793e-6
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + D G+T L++AAE G LE  +  I +  +  ++DVD    T+LI A   GH EVV  LLEN AN++ +D  G + +
Sbjct:   39 VDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022720.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 119.013 bits (297), Expect = 1.073e-26
Identity = 88/278 (31.65%), Postives = 139/278 (50.00%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA  G+ E++ E + +  +V L+D DC   T L+ A     IEVVR LL+  A+    DL   T+L WA +KG   + ELLL+ GAN N    +      WA      E + LL++   KVN  D+ G TP +WA R  H    +++LAN    ++D     +   N  T +  ++R     E +K L+  +  V + D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A++  + ++G + +
Sbjct:   49 PLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLAN--GADVD-----QEGANSMTALIVAVRGGY-TEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLD--AGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTAL 314          

HSP 2 Score: 102.064 bits (253), Expect = 1.728e-21
Identity = 85/302 (28.15%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR---------------------LDHLSHLNVLANVKNQEI--DHIDGFE----RDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL    + LE +D  G T LM+A Y  + +V   LL++GA+PN      +  + WA  +G+  ++ LLL  GA +N  D +G +   WA      + +  L+     V+Q   N +T  + A R                      D  + L + A   + EI  D +D        DRNG T++  ++R    +E ++ L+N++  V ++  +GKT L  A E+G     + I++   +   E    +  T LI AT   + E+V  LL+ GA +   DR G + + IA
Sbjct:   86 AAKEGHIEVVRELLENHAN-LEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGG-HVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ--CNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 3 Score: 75.485 bits (184), Expect = 2.217e-13
Identity = 65/253 (25.69%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+V+  ++RGA+ +  D+   T+L  A  +G++ ++  LL+  AN+  +D  G +A  WA      +  +LL+E     N   +  + P +WA    H                             IVH  ++    + C             D  G T L+ AA +G  + C + +   G+    DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAE---------------------------IVHLLLQHGAKVNC------------SDKYGTTPLIWAARKGHYD-CVMHLLANGA----DVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKE 254          

HSP 4 Score: 67.781 bits (164), Expect = 5.693e-11
Identity = 68/263 (25.86%), Postives = 115/263 (43.73%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +AA KG ++ +  LL    DV + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +G+  +++ LLDAG  +N                                   DRNG T  + A R  H+  +  L N K  ++D      R ++G+T ++W++ +   +     L      +    EG+T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWAARKGHYDCVMHLLANGADV-DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIP---------------------------------DRNGETMLIGAVRGGHVEIVRALLN-KYADVD-----VRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDK-GAK-VSAVDRKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 50.8322 bits (120), Expect = 7.806e-6
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + D G+T L++AAE G LE  +  I +  +  ++DVD    T+LI A   GH EVV  LLEN AN++ +D  G + +
Sbjct:   39 VDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000018863.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 118.627 bits (296), Expect = 1.094e-26
Identity = 88/278 (31.65%), Postives = 139/278 (50.00%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA  G+ E++ E + +  +V L+D DC   T L+ A     IEVVR LL+  A+    DL   T+L WA +KG   + ELLL+ GAN N    +      WA      E + LL++   KVN  D+ G TP +WA R  H    +++LAN    ++D     +   N  T +  ++R     E +K L+  +  V + D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A++  + ++G + +
Sbjct:   49 PLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLAN--GADVD-----QEGANSMTALIVAVRGGY-TEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLD--AGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTAL 314          

HSP 2 Score: 101.679 bits (252), Expect = 2.094e-21
Identity = 85/302 (28.15%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR---------------------LDHLSHLNVLANVKNQEI--DHIDGFE----RDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL    + LE +D  G T LM+A Y  + +V   LL++GA+PN      +  + WA  +G+  ++ LLL  GA +N  D +G +   WA      + +  L+     V+Q   N +T  + A R                      D  + L + A   + EI  D +D        DRNG T++  ++R    +E ++ L+N++  V ++  +GKT L  A E+G     + I++   +   E    +  T LI AT   + E+V  LL+ GA +   DR G + + IA
Sbjct:   86 AAKEGHIEVVRELLENHAN-LEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGG-HVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ--CNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 3 Score: 75.485 bits (184), Expect = 2.354e-13
Identity = 65/253 (25.69%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+V+  ++RGA+ +  D+   T+L  A  +G++ ++  LL+  AN+  +D  G +A  WA      +  +LL+E     N   +  + P +WA    H                             IVH  ++    + C             D  G T L+ AA +G  + C + +   G+    DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAE---------------------------IVHLLLQHGAKVNC------------SDKYGTTPLIWAARKGHYD-CVMHLLANGA----DVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKE 254          

HSP 4 Score: 67.781 bits (164), Expect = 5.465e-11
Identity = 68/263 (25.86%), Postives = 115/263 (43.73%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +AA KG ++ +  LL    DV + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +G+  +++ LLDAG  +N                                   DRNG T  + A R  H+  +  L N K  ++D      R ++G+T ++W++ +   +     L      +    EG+T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWAARKGHYDCVMHLLANGADV-DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIP---------------------------------DRNGETMLIGAVRGGHVEIVRALLN-KYADVD-----VRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDK-GAK-VSAVDRKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 50.447 bits (119), Expect = 9.203e-6
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + D G+T L++AAE G LE  +  I +  +  ++DVD    T+LI A   GH EVV  LLEN AN++ +D  G + +
Sbjct:   39 VDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022722.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 118.627 bits (296), Expect = 1.097e-26
Identity = 88/278 (31.65%), Postives = 139/278 (50.00%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA  G+ E++ E + +  +V L+D DC   T L+ A     IEVVR LL+  A+    DL   T+L WA +KG   + ELLL+ GAN N    +      WA      E + LL++   KVN  D+ G TP +WA R  H    +++LAN    ++D     +   N  T +  ++R     E +K L+  +  V + D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A++  + ++G + +
Sbjct:   49 PLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLAN--GADVD-----QEGANSMTALIVAVRGGY-TEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLD--AGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTAL 314          

HSP 2 Score: 101.679 bits (252), Expect = 1.977e-21
Identity = 85/302 (28.15%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR---------------------LDHLSHLNVLANVKNQEI--DHIDGFE----RDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL    + LE +D  G T LM+A Y  + +V   LL++GA+PN      +  + WA  +G+  ++ LLL  GA +N  D +G +   WA      + +  L+     V+Q   N +T  + A R                      D  + L + A   + EI  D +D        DRNG T++  ++R    +E ++ L+N++  V ++  +GKT L  A E+G     + I++   +   E    +  T LI AT   + E+V  LL+ GA +   DR G + + IA
Sbjct:   86 AAKEGHIEVVRELLENHAN-LEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGG-HVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ--CNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 3 Score: 75.485 bits (184), Expect = 2.378e-13
Identity = 65/253 (25.69%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+V+  ++RGA+ +  D+   T+L  A  +G++ ++  LL+  AN+  +D  G +A  WA      +  +LL+E     N   +  + P +WA    H                             IVH  ++    + C             D  G T L+ AA +G  + C + +   G+    DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAE---------------------------IVHLLLQHGAKVNC------------SDKYGTTPLIWAARKGHYD-CVMHLLANGA----DVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKE 254          

HSP 4 Score: 67.781 bits (164), Expect = 5.426e-11
Identity = 68/263 (25.86%), Postives = 115/263 (43.73%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +AA KG ++ +  LL    DV + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +G+  +++ LLDAG  +N                                   DRNG T  + A R  H+  +  L N K  ++D      R ++G+T ++W++ +   +     L      +    EG+T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWAARKGHYDCVMHLLANGADV-DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIP---------------------------------DRNGETMLIGAVRGGHVEIVRALLN-KYADVD-----VRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDK-GAK-VSAVDRKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 50.447 bits (119), Expect = 9.369e-6
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + D G+T L++AAE G LE  +  I +  +  ++DVD    T+LI A   GH EVV  LLEN AN++ +D  G + +
Sbjct:   39 VDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000018862.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 118.627 bits (296), Expect = 1.239e-26
Identity = 88/278 (31.65%), Postives = 139/278 (50.00%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLS-HLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEH-TVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            P+  AA  G+ E++ E + +  +V L+D DC   T L+ A     IEVVR LL+  A+    DL   T+L WA +KG   + ELLL+ GAN N    +      WA      E + LL++   KVN  D+ G TP +WA R  H    +++LAN    ++D     +   N  T +  ++R     E +K L+  +  V + D +G T L +AA++G  E  + +++     Y+   D    T LI A  GGH E+V  LL   A++  + ++G + +
Sbjct:   49 PLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLAN--GADVD-----QEGANSMTALIVAVRGGY-TEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLD--AGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTAL 314          

HSP 2 Score: 101.679 bits (252), Expect = 2.290e-21
Identity = 85/302 (28.15%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  519 AATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACR---------------------LDHLSHLNVLANVKNQEI--DHIDGFE----RDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            AA +G  E++ ELL    + LE +D  G T LM+A Y  + +V   LL++GA+PN      +  + WA  +G+  ++ LLL  GA +N  D +G +   WA      + +  L+     V+Q   N +T  + A R                      D  + L + A   + EI  D +D        DRNG T++  ++R    +E ++ L+N++  V ++  +GKT L  A E+G     + I++   +   E    +  T LI AT   + E+V  LL+ GA +   DR G + + IA
Sbjct:   86 AAKEGHIEVVRELLENHAN-LEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGG-HVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ--CNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 3 Score: 75.0998 bits (183), Expect = 2.614e-13
Identity = 65/253 (25.69%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  600 GRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQ---DRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQ 1349
            G+TPLM A     +E+V+  ++RGA+ +  D+   T+L  A  +G++ ++  LL+  AN+  +D  G +A  WA      +  +LL+E     N   +  + P +WA    H                             IVH  ++    + C             D  G T L+ AA +G  + C + +   G+    DVD +     T+LI+A  GG+ EVV  LL+   N+   D++G + + IA  +
Sbjct:   46 GQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAE---------------------------IVHLLLQHGAKVNC------------SDKYGTTPLIWAARKGHYD-CVMHLLANGA----DVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKE 254          

HSP 4 Score: 67.3958 bits (163), Expect = 6.547e-11
Identity = 68/263 (25.86%), Postives = 115/263 (43.73%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLEN 1286
             T P+ +AA KG ++ +  LL    DV + +     T L+ AV     EVV+ LLKR  + N  D    T+L  A  +G+  +++ LLDAG  +N                                   DRNG T  + A R  H+  +  L N K  ++D      R ++G+T ++W++ +   +     L      +    EG+T L+ A +   +E  +++++K G+K +  VD +  T L +A  G   ++   LL N
Sbjct:  178 GTTPLIWAARKGHYDCVMHLLANGADV-DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIP---------------------------------DRNGETMLIGAVRGGHVEIVRALLN-KYADVD-----VRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDK-GAK-VSAVDRKGDTPLHIAIRGRSRKLAELLLRN 398          

HSP 5 Score: 50.447 bits (119), Expect = 9.063e-6
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1092 VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCV 1331
            V  + D G+T L++AAE G LE  +  I +  +  ++DVD    T+LI A   GH EVV  LLEN AN++ +D  G + +
Sbjct:   39 VDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCW--TALISAAKEGHIEVVRELLENHANLEHRDLGGWTAL 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020576.1 (SMESG000020576.1)

HSP 1 Score: 1602.8 bits (4149), Expect = 0.000e+0
Identity = 808/815 (99.14%), Postives = 810/815 (99.39%), Query Frame = 3
Query:  117 MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEARQXXXXXXXXXXXXXXXXXXXXXXXXXXXLPIKYARTKNIDNDETPNGFDAMSSDPYQYPFNDLGTKTDSNDNDIGNHHENPLNSTELSRTLENFQYQRPQTLDVLDNETGQQYHRSYEHLHSNMSADNSRSDNLENKLPSSIQIETHKPIQRAKKVNRINGNNVNKPHFTPPELHPFTSETSENSQSVPAVNSPVKHIRSNSHQLSIMEISQKVNYGASLEPINKIHSNETPVRXXXXXXXDQRILAKSQDRLGNLNFDQDQNSKSLGTMQHARSLENMPNKVKQLPNGIISNRNSSFSETFPSPYGEQSINGNRQNSLLFDDRQRFEQEALTDKPNGKNLSSFEIRSSNWLKNGISQF 2561
            MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEARQQVKTPPRPPVSPKSPSSQSSKSPTIKRLPIKYARTKNIDNDETPNGFDAMSSDPYQYPFNDLGTKTDSNDNDIGNHHENPLNSTELSRTLENFQYQRPQTLDVLDNETGQQYHRSYEHLHSN SADNSRS+NLENKLPS IQIETHKPIQRAKKVNRINGNNVN PHFTPPELHP TSETSENSQSVPAVN+PVKHIRSNSHQLSIMEISQKVNYGASLEPINKIHSNETPVRKKKKKSKDQRILAKSQDRLGNLNFDQDQNSKSLGTMQHARSLENMPNKVKQLPNGIISNRNSSFSETFPSPYGEQSI GNRQNSLLFDDRQRFEQEALTDKPNGKNLSSFEIRSSNWLKNGISQF
Sbjct:    1 MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQQRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHAHWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQYLFYCQLIISSHIREMERRQESIPSDCVELIEKANSRHNSISEARQQVKTPPRPPVSPKSPSSQSSKSPTIKRLPIKYARTKNIDNDETPNGFDAMSSDPYQYPFNDLGTKTDSNDNDIGNHHENPLNSTELSRTLENFQYQRPQTLDVLDNETGQQYHRSYEHLHSNRSADNSRSENLENKLPSPIQIETHKPIQRAKKVNRINGNNVNMPHFTPPELHPLTSETSENSQSVPAVNNPVKHIRSNSHQLSIMEISQKVNYGASLEPINKIHSNETPVRKKKKKSKDQRILAKSQDRLGNLNFDQDQNSKSLGTMQHARSLENMPNKVKQLPNGIISNRNSSFSETFPSPYGEQSIKGNRQNSLLFDDRQRFEQEALTDKPNGKNLSSFEIRSSNWLKNGISQF 815          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 107.842 bits (268), Expect = 1.965e-23
Identity = 81/273 (29.67%), Postives = 134/273 (49.08%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTS---LILATNGGHGEVVNFLLENGANIKFKDR 1313
            P+HYA   G+ ELL  L+  K D+ + +D  G+ P+ YA+     E+V+ L+    D N+ D  +   +H+AC  G   L++LL++   +IN +D   +   H+AC     E LQLLI  +  +N  DR  + P  +AC+      L +L N K       D   RD +G+  +H++I R  P E ++ L+N    +  +D  GK  +  A +    E  +++I         D+D +DR     +  A + G+ E+V  L+ N  +I   DR
Sbjct:  839 PIHYACKAGNPELLQILINNKCDI-DARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNK------CDIDARDEDGKQPIHYAIDRGNP-EIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKC-----DIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDR 1098          

HSP 2 Score: 101.679 bits (252), Expect = 1.521e-21
Identity = 71/273 (26.01%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA   G  E++  L+  K D+   D+D  G+ P+ Y++     E+V+ L+    D N+ D      +H+AC +G   ++++L++   +IN +D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D++GK  +  A ++G  E  +++I       +   D   +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1136 PIHYACKDGKPEIVQILINNKCDIDACDRD--GKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD--LVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDG 1397          

HSP 3 Score: 101.293 bits (251), Expect = 1.850e-21
Identity = 73/272 (26.84%), Postives = 137/272 (50.37%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G+ E++ E+L+  K  ++ +D LG+ P+ YA   DK E+V+ L+    D ++ D +    +H+A  +G   ++++L++   +I+  D       H+A      E +Q+LI  +  ++  D   + P  +AC+      + +L N K  +ID       DR+G+  +H+S+ R  P E ++ L+N    +   D +GK  +  A E+G  E  +++I       I   D+  +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1004 PIHYAIDRGNPEIV-EILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKC-DIDAC-----DRDGKQPIHYSMDRGNP-EMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCD--INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDG 1265          

HSP 4 Score: 96.6709 bits (239), Expect = 4.872e-20
Identity = 75/276 (27.17%), Postives = 133/276 (48.19%), Query Frame = 3
Query:  495 INTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            ++  P+HYA   G  ELL +LL+  K  +  +D L + P+ YA    K E+++ L+    D N+ D   +  +H+AC  G   L+++L++   +I+ +D  G+   H+A      E +++LI  +  ++  D  G  P  +AC+ D    + +L N K       D   RDR G+  +H++I R  P E ++ L+N    +   D E    +  A ++G  E  +++I       I   D++    +  A   G  E+V  L+ N  +I   DR+G
Sbjct:  901 LDKQPIHYACKGGKPELL-QLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNK------CDIDARDRAGKQPIHYAIDRGNP-EMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCD--IHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDG 1166          

HSP 5 Score: 96.6709 bits (239), Expect = 5.216e-20
Identity = 73/280 (26.07%), Postives = 136/280 (48.57%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIAR 1343
            P+HYA  +G+ E++  L+  K D++   D LG+ P+ YA    K E+V+ L+    D N+ D      +H+A  +G   ++++L++   ++   D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D +GK  +  A + G  E  +++I       I   D+  +  +  A N G+ E+V  L+ N  +I   D+ G S ++ A+
Sbjct: 1268 PIHYAIDRGNPEMVQILINNKCDLVA-CDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCD--INARDEDGKQPIHYAINRGNPEMVQILINNKCDINALDKTGFSHLNYAK 1537          

HSP 6 Score: 96.6709 bits (239), Expect = 5.876e-20
Identity = 75/275 (27.27%), Postives = 130/275 (47.27%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQD---RTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G+ E +  L+  K D+    D  G+ P+ YA      E+++ L+    D ++ D      +H+A  +G   ++++L++   +IN +D   +   H+AC     E LQLLI  +  +N  DR    P  +AC+      L +L N K       D   RDR     +H++ +   P E LK L+N    +  +D++GK  +  A ++G  E  +++I         D+D +D   +  +  A  G   E+V  L+ N  +I  +DR G
Sbjct:  806 PIHYAIDRGNPETVQILINNKCDI-NALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNK------CDINARDREWMQPIHYACKGGKP-ELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKC-----DIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAG 1067          

HSP 7 Score: 91.2781 bits (225), Expect = 2.188e-18
Identity = 67/272 (24.63%), Postives = 134/272 (49.26%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  KGD   + ++L+  K  ++ +D  G+ P+ YA+     E+V+ L+    D ++CD   +  +H+A  +G   ++++L++   +I+ +D       H+AC     E +Q+LI  +  ++  DR+G  P  ++    +   + +L N K       D    D++G+  +H++  R  P E ++ L+N    +  +D+ GK  +  A + G  E  +++I       I   D+  +  +  A + G+ E+V  L+ N  ++   DR G
Sbjct: 1037 PIHYAC-KGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNK------CDINALDKDGKQPIHYACERGKP-EIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCD--INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLG 1298          

HSP 8 Score: 75.8702 bits (185), Expect = 1.131e-13
Identity = 68/262 (25.95%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  537 FELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            F L+NE          D+D  G+ P+ YA+     E V+ L+    D N+ D      +H+AC  G   L+++L++   +I+ +D  G+   H+A      E +Q+LI  +  +N  D     P  +AC+      L +L N K       D   RDR  +  +H++ +   P E L+ L+N    +  +D E    +  A + G  E  K++I       I+  D+  +  +  A + G+ E+V  L+ N  +I  +D  G
Sbjct:  793 FSLINE---------RDED--GKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNK------CDINARDRLDKQPIHYACKGGKP-ELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCD--IDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLG 1034          

HSP 9 Score: 74.7146 bits (182), Expect = 2.830e-13
Identity = 48/151 (31.79%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRL--DHLSHLNV 953
            P+HYA  +G+ E++  L+  K D++   D LG+ P+ YA    K E+V+ L+    D ++ D      +H+AC  G   LI+LL++   +IN +D  G+   H+A      E +Q+LI  +  +N  D+ G +   +A  L  D  SH N+
Sbjct: 1400 PIHYAIDRGNPEMVQILINNKCDLVA-CDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYAINRGNPEMVQILINNKCDINALDKTGFSHLNYAKGLLADLKSHSNI 1549          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 107.842 bits (268), Expect = 2.030e-23
Identity = 82/274 (29.93%), Postives = 134/274 (48.91%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTS---LILATNGGHGEVVNFLLENGANIKFKDR 1313
            P+HYA   G+ ELL  L+  K D+   D+D  G+ P+ YA+     E+V+ L+    D N+ D  +   +H+AC  G   L++LL++   +IN +D   +   H+AC     E LQLLI  +  +N  DR  + P  +AC+      L +L N K       D   RD +G+  +H++I R  P E ++ L+N    +  +D  GK  +  A +    E  +++I         D+D +DR     +  A + G+ E+V  L+ N  +I   DR
Sbjct:  839 PIHYACKAGNPELLQILINNKCDIDARDRD--GKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNK------CDIDARDEDGKQPIHYAIDRGNP-EIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKC-----DIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDR 1098          

HSP 2 Score: 101.679 bits (252), Expect = 1.656e-21
Identity = 71/273 (26.01%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA   G  E++  L+  K D+   D+D  G+ P+ Y++     E+V+ L+    D N+ D      +H+AC +G   ++++L++   +IN +D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D++GK  +  A ++G  E  +++I       +   D   +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1136 PIHYACKDGKPEIVQILINNKCDIDACDRD--GKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD--LVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDG 1397          

HSP 3 Score: 101.293 bits (251), Expect = 2.014e-21
Identity = 73/272 (26.84%), Postives = 137/272 (50.37%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G+ E++ E+L+  K  ++ +D LG+ P+ YA   DK E+V+ L+    D ++ D +    +H+A  +G   ++++L++   +I+  D       H+A      E +Q+LI  +  ++  D   + P  +AC+      + +L N K  +ID       DR+G+  +H+S+ R  P E ++ L+N    +   D +GK  +  A E+G  E  +++I       I   D+  +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1004 PIHYAIDRGNPEIV-EILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKC-DIDAC-----DRDGKQPIHYSMDRGNP-EMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCD--INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDG 1265          

HSP 4 Score: 97.8265 bits (242), Expect = 2.324e-20
Identity = 70/272 (25.74%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G  E++  L+  K D+   +D LG+ P+ YA    K E+V+ L+    D N+ D      +H+A  +G   ++++L++   ++   D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D++GK  +  A ++G  E  +++I       +   D   +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1202 PIHYACERGKPEIVQILINNKCDI-NARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD--LVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDG 1463          

HSP 5 Score: 96.6709 bits (239), Expect = 4.919e-20
Identity = 75/276 (27.17%), Postives = 133/276 (48.19%), Query Frame = 3
Query:  495 INTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            ++  P+HYA   G  ELL +LL+  K  +  +D L + P+ YA    K E+++ L+    D N+ D   +  +H+AC  G   L+++L++   +I+ +D  G+   H+A      E +++LI  +  ++  D  G  P  +AC+ D    + +L N K       D   RDR G+  +H++I R  P E ++ L+N    +   D E    +  A ++G  E  +++I       I   D++    +  A   G  E+V  L+ N  +I   DR+G
Sbjct:  901 LDKQPIHYACKGGKPELL-QLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNK------CDIDARDRAGKQPIHYAIDRGNP-EMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCD--IHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDG 1166          

HSP 6 Score: 96.2857 bits (238), Expect = 6.086e-20
Identity = 75/275 (27.27%), Postives = 130/275 (47.27%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQD---RTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G+ E +  L+  K D+    D  G+ P+ YA      E+++ L+    D ++ D      +H+A  +G   ++++L++   +IN +D   +   H+AC     E LQLLI  +  +N  DR    P  +AC+      L +L N K       D   RDR     +H++ +   P E LK L+N    +  +D++GK  +  A ++G  E  +++I         D+D +D   +  +  A  G   E+V  L+ N  +I  +DR G
Sbjct:  806 PIHYAIDRGNPETVQILINNKCDI-NALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNK------CDINARDREWMQPIHYACKGGKP-ELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKC-----DIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAG 1067          

HSP 7 Score: 91.2781 bits (225), Expect = 2.367e-18
Identity = 67/272 (24.63%), Postives = 134/272 (49.26%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  KGD   + ++L+  K  ++ +D  G+ P+ YA+     E+V+ L+    D ++CD   +  +H+A  +G   ++++L++   +I+ +D       H+AC     E +Q+LI  +  ++  DR+G  P  ++    +   + +L N K       D    D++G+  +H++  R  P E ++ L+N    +  +D+ GK  +  A + G  E  +++I       I   D+  +  +  A + G+ E+V  L+ N  ++   DR G
Sbjct: 1037 PIHYAC-KGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNK------CDINALDKDGKQPIHYACERGKP-EIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCD--INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLG 1298          

HSP 8 Score: 83.9593 bits (206), Expect = 3.799e-16
Identity = 59/224 (26.34%), Postives = 111/224 (49.55%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVII 1175
            P+HYA  +G+ E++  L+  K D++   D LG+ P+ YA    K E+V+ L+    D N+ D      +H+A  +G   ++++L++   ++   D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D +GK  +  A + G  E  +++I
Sbjct: 1268 PIHYAIDRGNPEMVQILINNKCDLVA-CDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLI 1483          

HSP 9 Score: 80.1073 bits (196), Expect = 6.952e-15
Identity = 54/193 (27.98%), Postives = 96/193 (49.74%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVN 1082
            P+HYA   G  E++  L+  K D+   D+D  G+ P+ YA+     E+V+ L+    D  +CD      +H+AC  G   ++++L++   +IN +D  G+   H+A      E +Q+LI  +  +   DR G  P  +AC+      + +L N K       D   RD +G+  +H++ +   P E ++ L+N
Sbjct: 1301 PIHYACKGGKPEIVQILINNKCDINARDED--GKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNK------CDIHARDWDGKQPIHYACKGGKP-ELIQLLIN 1484          

HSP 10 Score: 75.8702 bits (185), Expect = 1.167e-13
Identity = 68/262 (25.95%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  537 FELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            F L+NE          D+D  G+ P+ YA+     E V+ L+    D N+ D      +H+AC  G   L+++L++   +I+ +D  G+   H+A      E +Q+LI  +  +N  D     P  +AC+      L +L N K       D   RDR  +  +H++ +   P E L+ L+N    +  +D E    +  A + G  E  K++I       I+  D+  +  +  A + G+ E+V  L+ N  +I  +D  G
Sbjct:  793 FSLINE---------RDED--GKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNK------CDINARDRLDKQPIHYACKGGKP-ELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCD--IDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLG 1034          

HSP 11 Score: 73.1738 bits (178), Expect = 7.493e-13
Identity = 43/154 (27.92%), Postives = 80/154 (51.95%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVK 968
            P+HYA  +G+ E++  L+  K D++   D LG+ P+ YA    K E+V+ L+    D N+ D      +H+A  +G   ++++L++   ++   D  G+   H+AC     E +Q+LI  +  ++  D +G  P  +AC+      + +L N K
Sbjct: 1334 PIHYAIDRGNPEMVQILINNKCDLVA-CDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNK 1486          

HSP 12 Score: 67.781 bits (164), Expect = 3.534e-11
Identity = 39/129 (30.23%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHD 890
            P+HYA   G  E++  L+  K D+   D+D  G+ P+ YA+     E+V+ L+    D  +CD      +H+AC  G   ++++L++   +I+ +D  G+   H+AC     E +QLLI  +  +N  D
Sbjct: 1367 PIHYACKGGKPEIVQILINNKCDINARDED--GKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARD 1493          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 107.071 bits (266), Expect = 2.784e-23
Identity = 81/273 (29.67%), Postives = 134/273 (49.08%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTS---LILATNGGHGEVVNFLLENGANIKFKDR 1313
            P+HYA   G+ ELL  L+  K D+ + +D  G+ P+ YA+     E+V+ L+    D N+ D  +   +H+AC  G   L++LL++   +IN +D   +   H+AC     E LQLLI  +  +N  DR  + P  +AC+      L +L N K       D   RD +G+  +H++I R  P E ++ L+N    +  +D  GK  +  A +    E  +++I         D+D +DR     +  A + G+ E+V  L+ N  +I   DR
Sbjct:  839 PIHYACKAGNPELLQILINNKCDI-DARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNK------CDIDARDEDGKQPIHYAIDRGNP-EIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKC-----DIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDR 1098          

HSP 2 Score: 100.908 bits (250), Expect = 2.236e-21
Identity = 71/273 (26.01%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA   G  E++  L+  K D+   D+D  G+ P+ Y++     E+V+ L+    D N+ D      +H+AC +G   ++++L++   +IN +D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D++GK  +  A ++G  E  +++I       +   D   +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1136 PIHYACKDGKPEIVQILINNKCDIDACDRD--GKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD--LVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDG 1397          

HSP 3 Score: 100.908 bits (250), Expect = 2.720e-21
Identity = 73/272 (26.84%), Postives = 137/272 (50.37%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G+ E++ E+L+  K  ++ +D LG+ P+ YA   DK E+V+ L+    D ++ D +    +H+A  +G   ++++L++   +I+  D       H+A      E +Q+LI  +  ++  D   + P  +AC+      + +L N K  +ID       DR+G+  +H+S+ R  P E ++ L+N    +   D +GK  +  A E+G  E  +++I       I   D+  +  +  A  GG  E+V  L+ N  +I  +D +G
Sbjct: 1004 PIHYAIDRGNPEIV-EILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKC-DIDAC-----DRDGKQPIHYSMDRGNP-EMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCD--INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDG 1265          

HSP 4 Score: 96.2857 bits (238), Expect = 7.001e-20
Identity = 75/276 (27.17%), Postives = 133/276 (48.19%), Query Frame = 3
Query:  495 INTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            ++  P+HYA   G  ELL +LL+  K  +  +D L + P+ YA    K E+++ L+    D N+ D   +  +H+AC  G   L+++L++   +I+ +D  G+   H+A      E +++LI  +  ++  D  G  P  +AC+ D    + +L N K       D   RDR G+  +H++I R  P E ++ L+N    +   D E    +  A ++G  E  +++I       I   D++    +  A   G  E+V  L+ N  +I   DR+G
Sbjct:  901 LDKQPIHYACKGGKPELL-QLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNK------CDIDARDRAGKQPIHYAIDRGNP-EMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCD--IHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDG 1166          

HSP 5 Score: 95.9005 bits (237), Expect = 8.301e-20
Identity = 75/275 (27.27%), Postives = 130/275 (47.27%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQD---RTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  +G+ E +  L+  K D+    D  G+ P+ YA      E+++ L+    D ++ D      +H+A  +G   ++++L++   +IN +D   +   H+AC     E LQLLI  +  +N  DR    P  +AC+      L +L N K       D   RDR     +H++ +   P E LK L+N    +  +D++GK  +  A ++G  E  +++I         D+D +D   +  +  A  G   E+V  L+ N  +I  +DR G
Sbjct:  806 PIHYAIDRGNPETVQILINNKCDI-NALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNK------CDINARDREWMQPIHYACKGGKP-ELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKC-----DIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAG 1067          

HSP 6 Score: 90.8929 bits (224), Expect = 3.099e-18
Identity = 67/272 (24.63%), Postives = 134/272 (49.26%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            P+HYA  KGD   + ++L+  K  ++ +D  G+ P+ YA+     E+V+ L+    D ++CD   +  +H+A  +G   ++++L++   +I+ +D       H+AC     E +Q+LI  +  ++  DR+G  P  ++    +   + +L N K       D    D++G+  +H++  R  P E ++ L+N    +  +D+ GK  +  A + G  E  +++I       I   D+  +  +  A + G+ E+V  L+ N  ++   DR G
Sbjct: 1037 PIHYAC-KGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNK------CDINALDKDGKQPIHYACERGKP-EIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCD--INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLG 1298          

HSP 7 Score: 87.0409 bits (214), Expect = 3.983e-17
Identity = 59/224 (26.34%), Postives = 112/224 (50.00%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVII 1175
            P+HYA  +G  E++  L+  K D+   +D LG+ P+ YA    K E+V+ L+    D N+ D      +H+A  +G   ++++L++   ++   D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K       D    DR G+  +H++ +   P E ++ L+N    +  +D++GK  +  A ++G  E  +++I
Sbjct: 1202 PIHYACERGKPEIVQILINNKCDI-NARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK------CDLVACDRLGKQPIHYACKGGKP-EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI 1417          

HSP 8 Score: 75.485 bits (184), Expect = 1.573e-13
Identity = 68/262 (25.95%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  537 FELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHT-VQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNG 1319
            F L+NE          D+D  G+ P+ YA+     E V+ L+    D N+ D      +H+AC  G   L+++L++   +I+ +D  G+   H+A      E +Q+LI  +  +N  D     P  +AC+      L +L N K       D   RDR  +  +H++ +   P E L+ L+N    +  +D E    +  A + G  E  K++I       I+  D+  +  +  A + G+ E+V  L+ N  +I  +D  G
Sbjct:  793 FSLINE---------RDED--GKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNK------CDINARDRLDKQPIHYACKGGKP-ELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCD--IDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLG 1034          

HSP 9 Score: 72.0182 bits (175), Expect = 1.895e-12
Identity = 43/154 (27.92%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVK 968
            P+HYA  +G+ E++  L+  K D++   D LG+ P+ YA    K E+V+ L+    D N+ D      +H+A  +G   ++++L++   ++   D  G+   H+AC     E +Q+LI  +  +N  D +G  P  +A    +   + +L N K
Sbjct: 1268 PIHYAIDRGNPEMVQILINNKCDLVA-CDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNK 1420          

HSP 10 Score: 63.1586 bits (152), Expect = 1.084e-9
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDV-LEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDR 893
            P+HYA   G  E++  L+  K D+   D+D  G+ P+ YA+     E+V+ L+    D  +CD      +H+AC  G   ++++L++   +IN +D  G+   H+A      E +Q+LI  +  +   DR
Sbjct: 1301 PIHYACKGGKPEIVQILINNKCDINARDED--GKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDR 1428          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 103.99 bits (258), Expect = 3.359e-22
Identity = 89/296 (30.07%), Postives = 139/296 (46.96%), Query Frame = 3
Query:  498 NTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVR-WLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHI------DGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEK-FGSKYIEDVDDQDR---TSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIARNQY 1352
            N   +H AA +G  E+ + LLL+ +   + +   G TPL  A  Y +++V R  LL    +PNS     +T LH A +  +  +IELLLD  AN+N     G +  H     N +E  +LLI+    VN   + G TP           HLN +A   N+EI  +      D   +  NG T +H +  +       + L  E  +  K   G T L  A   G ++T K+++EK F      DV+ Q     TSL LA   GH  +V  LL+N  ++  +++ G + +++A+ Q+
Sbjct:  585 NYTALHIAAKEGRHEI-SRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPL----------HLNSMAG--NKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNF------DVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQH 861          

HSP 2 Score: 74.3294 bits (181), Expect = 3.822e-13
Identity = 78/307 (25.41%), Postives = 130/307 (42.35%), Query Frame = 3
Query:  510 VHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGA------------------------------NINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            +H A+  G  E+++ LLL+ K  +  +   G TPL  A   + ++VV+ LL+ GA+         T L  A  +G   ++++LLD  +                              N++ Q + G +  H A  YN V   +LLIE    VN   +N +TP   A +      L +L + K     +++   RD  G + +H + R       L  L N   +Q K   G T L +A +    E C+ +I K     ++ V     T+L +A + G+      LL+N  N+  +  NG + + IA
Sbjct:  162 LHIASLAGKLEVVS-LLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQK----ANVNSVTRD--GLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINK--GIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIA 459          

HSP 3 Score: 72.4034 bits (176), Expect = 1.399e-12
Identity = 77/326 (23.62%), Postives = 136/326 (41.72%), Query Frame = 3
Query:  399 PQYFHAHWTVLDEKSDQIRKSFSQE-NFSPGRSINTPPVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNGRTIVHWSIRRQLPL---------ECLKYLV--NEHTVQLKDDEGKTVLLLAAEQGALETCKVIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA 1340
            P +  A W     K + ++   SQ+ N +        P+H AA  G FE +  +LL+    ++ +   G T L  A   D+ EV + L+ +G D ++  +  +T+LH A   G +   E+LL    N+N +   G +  H AC     + ++LLI+++  +N     GLTP   A  +     +N+L                 +NG +I   +++ +  L         E  K L+   E     +  E +T L +A   G     + ++       +  V   + T+L +A   G  E+   LLE+      K + G + + IA
Sbjct:  323 PLHVAAKWG----KEEMLKLLISQKANVNSVTRDGLSPIHCAARSG-FENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILL----------------KNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNM--VTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIA 625          

HSP 4 Score: 65.4698 bits (158), Expect = 1.743e-10
Identity = 70/321 (21.81%), Postives = 126/321 (39.25%), Query Frame = 3
Query:  612 LMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANV-KNQEIDHIDGFE---------RDRNGRTIVHWSIRRQLPLECLKYLVNEHTVQLKDD--------------------EGKTVLLLAAEQGALETCKVIIEK----------------FGSKY---------------IEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRNGASCVDIA-RNQYLFYCQLIISSHI 1388
             + A     +E V+  L+    P+  + + + ++H A  +G   +++LL++ G +++     G ++ H A     +E + LL+E +  +N   +NG TP   A + +HL  + VL     NQ I   DGF           D+  + ++    R ++ L  L      H    KDD                     G T L +AA    +   K++IEK                  +K+               +  V     + +  A   G   ++  LLENGA+I+ K +NG + + +A +      CQ +I+  I
Sbjct:   96 FLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPAL------HIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGI 410          

HSP 5 Score: 62.3882 bits (150), Expect = 1.553e-9
Identity = 43/153 (28.10%), Postives = 77/153 (50.33%), Query Frame = 3
Query:  507 PVHYAATKGDFELLNELLLQKKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLHWACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEFETKVNQHDRNGLTPAMWACRLDHLSHLNVLANV 965
            P+H  +  G+ E++ ELLL     +  Q   G T L  A   ++ ++V  LLK  AD ++      T+LH A   G +  +++LL+   ++N Q + G ++ H A     +  ++LL++ E  VN  ++ GLT    A +  +L+    L+ V
Sbjct:  721 PLHLNSMAGNKEIM-ELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 872          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIDINS2204.250e-2429.03kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2205.021e-2429.03kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2202.611e-2329.03kinase D interacting substrate 220 [Source:HGNC Sy... [more]
ANKRD551.923e-2227.02ankyrin repeat domain 55 [Source:HGNC Symbol;Acc:H... [more]
INVS2.881e-2230.42inversin [Source:HGNC Symbol;Acc:HGNC:17870][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T28D6.42.003e-2429.58pep chromosome:WBcel235:III:11360456:11366214:1 ge... [more]
unc-445.434e-1829.43AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.434e-1829.43AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
nphp-25.736e-1826.60NePHronoPhthisis (Human kidney disease) homolog [... [more]
nphp-26.123e-1826.60NePHronoPhthisis (Human kidney disease) homolog [... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426723.315e-2025.23gene:FBgn0261554 transcript:FBtr0344189[more]
CG426724.205e-2025.47gene:FBgn0261554 transcript:FBtr0344188[more]
CG426727.881e-2025.47gene:FBgn0261554 transcript:FBtr0302707[more]
CG426727.945e-2024.52gene:FBgn0261554 transcript:FBtr0302703[more]
CG426728.193e-2024.52gene:FBgn0261554 transcript:FBtr0302706[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kidins220a2.088e-2530.66kinase D-interacting substrate 220a [Source:ZFIN;A... [more]
kidins220a3.058e-2530.04kinase D-interacting substrate 220a [Source:ZFIN;A... [more]
kidins220b1.919e-2331.18kinase D-interacting substrate 220b [Source:NCBI g... [more]
ankrd551.033e-2227.83ankyrin repeat domain 55 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd551.237e-2227.83ankyrin repeat domain 55 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab4b9.415e-2329.67RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b9.745e-2329.67RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.066e-2229.67RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.067e-2229.67RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.168e-2229.67RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kidins2203.979e-2529.75kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2204.343e-2529.75kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2203.358e-2429.82kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Invs4.295e-2330.64inversin [Source:MGI Symbol;Acc:MGI:1335082][more]
Ankrd551.255e-2227.33ankyrin repeat domain 55 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQG6|KDIS_RAT9.592e-2530.11Kinase D-interacting substrate of 220 kDa OS=Rattu... [more]
sp|Q9ULH0|KDIS_HUMAN2.041e-2329.03Kinase D-interacting substrate of 220 kDa OS=Homo ... [more]
sp|Q7T163|KDISB_DANRE1.524e-2231.18Kinase D-interacting substrate of 220 kDa B OS=Dan... [more]
sp|O89019|INVS_MOUSE2.688e-2230.64Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=... [more]
sp|Q6JAN1|INVS_CANLF3.869e-2230.56Inversin OS=Canis lupus familiaris OX=9615 GN=INVS... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PQK23.805e-10844.29Inversin OS=Mizuhopecten yessoensis OX=6573 GN=KP7... [more]
A0A2T7PI454.033e-10545.12ANK_REP_REGION domain-containing protein OS=Pomace... [more]
A0A1S3I8697.133e-10341.24inversin-A-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A1I8HGI75.279e-10143.22ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1S3HNF51.154e-10041.01uncharacterized protein LOC106156736 OS=Lingula un... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kidins220b9.121e-2630.42kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b9.827e-2630.42kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b9.827e-2630.42kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b1.177e-2530.42kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b1.290e-2530.42kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007954.17.289e-2227.47pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000002048.14.231e-2132.09pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000003991.11.362e-1927.94pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000000093.11.441e-1927.96pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
invs2.189e-1929.64inversin [Source:NCBI gene;Acc:245946][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR24.110e-1024.27Ankyrin repeat-containing protein; member of a fam... [more]
AKR11.819e-924.34Palmitoyl transferase involved in protein palmitoy... [more]
NAS65.153e-924.15Evolutionarily conserved 19S regulatory particle a... [more]
SPT238.882e-834.72ER membrane protein involved in regulation of OLE1... [more]
MGA21.691e-729.90ER membrane protein involved in regulation of OLE1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445834.790e-5530.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494851.521e-1427.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427801.875e-1428.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359102.013e-1327.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348622.435e-1135.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033617.19.391e-2731.65kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000022720.21.073e-2631.65kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018863.21.094e-2631.65kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000022722.21.097e-2631.65kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018862.21.239e-2631.65kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020576.10.000e+099.14SMESG000020576.1[more]
SMESG000032664.11.965e-2329.67SMESG000032664.1[more]
SMESG000032664.12.030e-2329.93SMESG000032664.1[more]
SMESG000032664.12.784e-2329.67SMESG000032664.1[more]
SMESG000026655.13.359e-2230.07SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002023 ID=SMED30002023|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2705bp
AAAAGATTTAAATTTTAACCTAATAATTAAAATTTCAATCTCTAATAATA
AATTTGTAACCTAAATTTATTTTTACTTAACCAAAATTGAATTAAATATT
ATTATGTAAATAAAAGATGACAGTGAAAAGAAGAGATTTTCAAAAAATCG
CGACAACTATTCATCAGTTTTTGCTCAAGCTCACAGATACATATGAATGT
GCCGAATTGCGCGATTCACTCAACATGTCTCTACTTCAACTGCAAAAGTA
TTATCGAAGATGCCAACAGCGATTGCAACATACGGGACGACACAACGATC
AAAATGGTACCGGTTACGTCTCTCCACGACAATCATTGCGAATAACATTG
AGCCGATCAAGTGAAGCTCTCTCCCCAATGACGCCTTACATAGAAGAACC
ACAATATTTTCACGCTCATTGGACTGTTCTCGACGAGAAATCTGATCAAA
TCCGGAAATCATTTTCCCAAGAAAATTTCAGTCCCGGAAGATCAATAAAC
ACTCCGCCTGTACATTATGCTGCCACCAAAGGAGATTTTGAACTCTTAAA
TGAATTATTATTACAAAAAAAAGATGTCTTAGAAGATCAAGATTGCCTCG
GCCGAACTCCTTTGATGTACGCGGTATATTATGATAAAATTGAAGTGGTT
AGATGGCTTTTGAAAAGGGGAGCAGATCCAAATTCATGTGATTTAAGTGA
AATAACATCTCTTCACTGGGCTTGCTTCAAAGGATATGTGGCATTAATTG
AATTATTGCTTGACGCTGGTGCTAATATCAACACTCAAGATTCATTTGGA
AGATCAGCTTGTCACTGGGCCTGCACCTACAATACTGTAGAACCGTTACA
ACTTTTAATTGAATTTGAAACTAAAGTTAATCAGCATGATCGCAATGGTC
TGACCCCTGCAATGTGGGCATGCCGACTAGATCATTTGTCACATTTAAAT
GTATTAGCAAATGTGAAAAATCAAGAAATTGACCACATTGACGGTTTCGA
AAGAGACAGAAATGGTCGGACTATTGTTCACTGGTCAATCCGAAGACAAC
TTCCACTTGAATGTTTGAAATATTTAGTCAATGAGCATACTGTTCAACTG
AAAGATGATGAAGGTAAAACAGTTCTATTATTGGCAGCTGAACAAGGTGC
ACTTGAAACTTGTAAGGTAATTATTGAAAAATTCGGGTCAAAATATATTG
AAGACGTTGATGATCAAGATAGGACAAGTTTGATTTTAGCAACAAATGGA
GGTCACGGTGAAGTCGTTAATTTTTTGCTTGAAAATGGAGCGAATATAAA
ATTCAAAGATAGAAACGGCGCGTCTTGCGTGGACATTGCGCGGAACCAAT
ATCTTTTCTATTGCCAGCTCATTATTTCTAGTCATATACGAGAAATGGAA
AGGAGACAAGAGTCAATTCCTAGCGACTGCGTTGAACTAATTGAAAAGGC
TAACAGTCGACATAATTCTATTAGCGAAGCTAGGCAACAAGTAAAAACAC
CTCCAAGACCTCCTGTTTCACCGAAGTCTCCGTCTTCTCAATCCAGTAAA
TCTCCCACAATAAAACGTCTTCCAATTAAATACGCTCGCACAAAAAATAT
AGATAATGATGAAACGCCAAACGGATTCGATGCGATGAGTTCAGATCCAT
ATCAGTATCCATTCAATGATTTGGGGACAAAAACTGATTCAAATGACAAT
GACATAGGCAATCACCACGAAAACCCACTAAACTCAACAGAGCTCTCTAG
AACCTTAGAGAATTTTCAATATCAACGACCCCAGACCCTTGACGTGTTGG
ACAATGAAACTGGTCAGCAATACCATAGATCTTATGAACATTTGCATTCA
AACATGTCTGCGGATAATTCGCGTTCTGACAATCTGGAAAACAAACTGCC
CTCATCTATTCAAATTGAAACCCACAAACCGATTCAACGTGCCAAAAAAG
TCAACCGAATCAATGGCAATAATGTGAATAAACCTCACTTTACGCCACCA
GAACTACATCCTTTCACCTCGGAAACCTCTGAAAATAGTCAAAGTGTTCC
TGCTGTAAATAGTCCAGTAAAGCATATTAGATCAAATTCACACCAATTAT
CGATCATGGAAATTTCTCAAAAGGTCAACTACGGTGCATCACTTGAGCCT
ATAAATAAAATACATTCAAATGAAACTCCTGTAAGAAAAAAGAAGAAGAA
ATCTAAAGACCAGCGCATTTTAGCCAAATCTCAAGACCGATTAGGAAATT
TAAATTTTGACCAAGACCAAAATTCTAAAAGTCTTGGTACAATGCAACAC
GCAAGATCTTTAGAGAATATGCCGAATAAAGTGAAGCAATTGCCGAACGG
TATCATTTCGAACAGAAACTCTTCATTTTCTGAAACGTTTCCTTCTCCAT
ATGGTGAACAGTCAATCAATGGAAACCGGCAAAATTCGCTTTTATTCGAT
GACCGTCAAAGATTTGAACAGGAAGCATTAACCGATAAACCTAATGGAAA
GAATTTATCATCATTCGAAATCCGAAGTTCTAATTGGTTAAAAAACGGAA
TTTCTCAATTTTAATGGATAACGTAATGTCACTTGACGAAATTACACAGT
TTTCACGTTGGAAACAAACATAATTTTTGTGCAGTTCCTATTTTTTGGTT
CGGAAATTTTATATGGGGTTTAGATTATTTTTCTACAATATTCATAATTT
TAGTT
back to top

protein sequence of SMED30002023-orf-1

>SMED30002023-orf-1 ID=SMED30002023-orf-1|Name=SMED30002023-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=816bp
MTVKRRDFQKIATTIHQFLLKLTDTYECAELRDSLNMSLLQLQKYYRRCQ
QRLQHTGRHNDQNGTGYVSPRQSLRITLSRSSEALSPMTPYIEEPQYFHA
HWTVLDEKSDQIRKSFSQENFSPGRSINTPPVHYAATKGDFELLNELLLQ
KKDVLEDQDCLGRTPLMYAVYYDKIEVVRWLLKRGADPNSCDLSEITSLH
WACFKGYVALIELLLDAGANINTQDSFGRSACHWACTYNTVEPLQLLIEF
ETKVNQHDRNGLTPAMWACRLDHLSHLNVLANVKNQEIDHIDGFERDRNG
RTIVHWSIRRQLPLECLKYLVNEHTVQLKDDEGKTVLLLAAEQGALETCK
VIIEKFGSKYIEDVDDQDRTSLILATNGGHGEVVNFLLENGANIKFKDRN
GASCVDIARNQYLFYCQLIISSHIREMERRQESIPSDCVELIEKANSRHN
SISEARQQVKTPPRPPVSPKSPSSQSSKSPTIKRLPIKYARTKNIDNDET
PNGFDAMSSDPYQYPFNDLGTKTDSNDNDIGNHHENPLNSTELSRTLENF
QYQRPQTLDVLDNETGQQYHRSYEHLHSNMSADNSRSDNLENKLPSSIQI
ETHKPIQRAKKVNRINGNNVNKPHFTPPELHPFTSETSENSQSVPAVNSP
VKHIRSNSHQLSIMEISQKVNYGASLEPINKIHSNETPVRKKKKKSKDQR
ILAKSQDRLGNLNFDQDQNSKSLGTMQHARSLENMPNKVKQLPNGIISNR
NSSFSETFPSPYGEQSINGNRQNSLLFDDRQRFEQEALTDKPNGKNLSSF
EIRSSNWLKNGISQF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 210..224
score: 39.2
coord: 162..177
score: 36.01
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 161..190
e-value: 1.6E-6
score: 37.7
coord: 367..396
e-value: 0.18
score: 20.9
coord: 127..156
e-value: 73.0
score: 12.2
coord: 332..361
e-value: 3.8
score: 16.5
coord: 299..329
e-value: 120.0
score: 11.6
coord: 194..223
e-value: 6.6E-4
score: 29.0
coord: 260..290
e-value: 180.0
score: 10.5
coord: 227..256
e-value: 3.7
score: 16.5
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 367..399
score: 11.728
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 194..226
score: 12.583
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 161..193
score: 12.689
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 128..190
e-value: 2.0E-10
score: 41.1
coord: 199..282
e-value: 6.4E-11
score: 42.7
coord: 332..398
e-value: 9.1E-9
score: 35.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 127..408
score: 52.417
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 114..460
e-value: 2.3E-66
score: 226.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 130..398
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 679..721
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 449..487
NoneNo IPR availablePANTHERPTHR24166FAMILY NOT NAMEDcoord: 130..401
coord: 133..280
NoneNo IPR availablePANTHERPTHR24166:SF48ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 65coord: 130..401
coord: 133..280