SMED30002006

Overview
NameSMED30002006
Smed IDSMED30002006
Length (bp)5007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002006 (SMED30002006) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002006 (SMED30002006) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002006 (SMED30002006) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002006 (SMED30002006) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002006

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30002006h1SMcG0022630 SmedASXL_015526SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30002006h1SMcG0022630 Contig49598uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002006h1SMcG0022630 Contig49598newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002006 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001434:11162..16558 -24973
Homology
BLAST of SMED30002006 vs. TrEMBL
Match: A0A0S4KJS1 (Receptor-type protein kinase, putative (Fragment) OS=Bodo saltans OX=75058 GN=BSAL_54135 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.846e-8
Identity = 82/292 (28.08%), Postives = 135/292 (46.23%), Query Frame = 3
Query: 2016 AAGSNLTCLDLSYSLLATNELLKCISKCSSLEELILDNEDHTFSNEGXXXXXXXXXXXXXXXNYCAKINDWGIQVVGALPSLSVLAI-KYTSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLTVSDECMTCIGMFTQLELLNLSSSHITNP--SSFPRLPELRHLDISHCH--------KLAWETQV-HVK-SLCDSFPKLSSINVRGVSNV-NLVHITMAISNCKFIRQLD-GILCHPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSSC 2846
            AA + L  LDLS S + T+  +KCI+  + L+ L L                          N C KI D G++ +  L  L  L + K   +T+VG++HI           +++  L+ +DLS   ++D  +  I   TQL+ L+L+   IT+        L +L+HLD++ C+        ++A  TQ+ H+  SLCD   K++   V  ++ +  L H  +  SNC  I+  D G+ C   +T      L HL L +     C+ ++D  +  ++  +  L HL LSSC
Sbjct: 1363 AALTQLQHLDLSKSYMITDAGVKCIAALTQLQHLDL--------------------------NSCDKITDAGVERIATLTQLQHLNLSKSYKITDVGVEHI-----------AALTQLQHLDLSNFNITDAGVKYIAALTQLQHLDLNCVKITDAGVKRIAALTQLQHLDLNSCNNITDVGVERIATLTQLQHLDLSLCD---KITDAGVERIAALTQLQH--LEFSNC--IKITDAGVKCIATLT-----QLQHLDLRS-----CKKITDAGVKCVSALT-QLKHLNLSSC 1599          
BLAST of SMED30002006 vs. TrEMBL
Match: A0A3T1CA16 (Uncharacterized protein OS=Neochlamydia sp. S13 OX=1353976 GN=NCS13_1_0868 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.390e-6
Identity = 61/241 (25.31%), Postives = 110/241 (45.64%), Query Frame = 3
Query: 2208 CAKINDWGIQVVGALPSLSVLAIKY-TSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLTVSDECMTCIGMFTQLELLNLSSSH-ITNPSSFP--RLPELRHLDISHCHKLAWETQVHVKSLCDSFPKLSSINVRG---VSNVNLVHI-------TMAISNCKFIR--------------QLDGILCHPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSSC 2846
            C +I+D  +++VG + SL  L +++  ++T+ G+ ++             +  L  ++LSG  +++  +  IG  + L  LNL S H +T+    P  +L  L+ LD+S+C  +   T  H KSL    P+L  +N+ G   +++  L  I       T+ + NC  +                LD   C     A+L    +   LE ++L  C+ ++D  L  L+ F   LT L ++ C
Sbjct:  225 CGQISDQSLKIVGTIHSLKELYLEHCETITDKGISYLKF-----------LKQLERLNLSGCDITNTALETIGTLSSLMYLNLKSCHQLTDKGGQPLSQLHNLKELDLSYCQDIGDFTMAHFKSL----PQLEVLNLHGCLLITDEGLKEIAQIRSLKTLNLRNCSKVSDEGFCSFKQLTHLTDLDLTYCQNISDATLAFIKTLSCLERLVLWGCKKITDKGLKHLS-FLENLTELNITGC 449          
BLAST of SMED30002006 vs. TrEMBL
Match: A0A0C1JTF1 (F-box/LRR-repeat protein 14 OS=Neochlamydia sp. EPS4 OX=1478175 GN=fbxL14 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.376e-6
Identity = 61/241 (25.31%), Postives = 110/241 (45.64%), Query Frame = 3
Query: 2208 CAKINDWGIQVVGALPSLSVLAIKY-TSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLTVSDECMTCIGMFTQLELLNLSSSH-ITNPSSFP--RLPELRHLDISHCHKLAWETQVHVKSLCDSFPKLSSINVRG---VSNVNLVHI-------TMAISNCKFIR--------------QLDGILCHPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSSC 2846
            C +I+D  +++VG + SL  L +++  ++T+ G+ ++             +  L  ++LSG  +++  +  IG  + L  LNL S H +T+    P  +L  L+ LD+S+C  +   T  H KSL    P+L  +N+ G   +++  L  I       T+ + NC  +                LD   C     A+L    +   LE ++L  C+ ++D  L  L+ F   LT L ++ C
Sbjct:  225 CGQISDQSLKIVGTIHSLKELYLEHCETITDKGISYLKF-----------LKQLERLNLSGCDITNTALETIGTLSSLIYLNLKSCHQLTDKGGQPLSQLHNLKELDLSYCQDIGDFTMAHFKSL----PQLEVLNLHGCLLITDEGLKEIAQIRSLKTLNLRNCSKVSDEGFCSFKQLTHLTDLDLTYCQNISDATLAFIKTLSCLERLVLWGCKKITDKGLKHLS-FLENLTELNITGC 449          
BLAST of SMED30002006 vs. Planmine SMEST
Match: SMESG000037096.1 (SMESG000037096.1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 454/454 (100.00%), Postives = 454/454 (100.00%), Query Frame = 3
Query:  144 MQHFSSIYEKLIDMGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFSESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQMTQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQRSIRNGSALDGGMGITEAIXXXXXXXXXXXXXXXNEQHPVAAVLVGAGEPNQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICWFHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFVMPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPSTAPFSMATVGGNHSNATEPTDASFSVDIEMIDXXXXXXXNIHYRLLCDPDKTTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIASCDEG 1505
            MQHFSSIYEKLIDMGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFSESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQMTQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQRSIRNGSALDGGMGITEAISSTVSSSSMLSVSSSNEQHPVAAVLVGAGEPNQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICWFHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFVMPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPSTAPFSMATVGGNHSNATEPTDASFSVDIEMIDSSSSSSSNIHYRLLCDPDKTTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIASCDEG
Sbjct:    1 MQHFSSIYEKLIDMGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFSESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQMTQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQRSIRNGSALDGGMGITEAISSTVSSSSMLSVSSSNEQHPVAAVLVGAGEPNQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICWFHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFVMPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPSTAPFSMATVGGNHSNATEPTDASFSVDIEMIDSSSSSSSNIHYRLLCDPDKTTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIASCDEG 454          
BLAST of SMED30002006 vs. Planmine SMEST
Match: SMESG000037096.1 (SMESG000037096.1)

HSP 1 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = 3
Query:  183 MGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFSESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQMTQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQRSIRNGSALDGGMGITEAIXXXXXXXXXXXXXXXNEQHPVAAVLVGAGEPNQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICWFHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFVMPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPSTAPFSMATVGGNHSNATEPTDASFSVDIEMIDXXXXXXXNIHYRLLCDPDKTTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIASCDEG 1505
            MGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFSESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQMTQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQRSIRNGSALDGGMGITEAISSTVSSSSMLSVSSSNEQHPVAAVLVGAGEPNQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICWFHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFVMPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPSTAPFSMATVGGNHSNATEPTDASFSVDIEMIDSSSSSSSNIHYRLLCDPDKTTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIASCDEG
Sbjct:    1 MGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFSESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQMTQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQRSIRNGSALDGGMGITEAISSTVSSSSMLSVSSSNEQHPVAAVLVGAGEPNQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICWFHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFVMPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPSTAPFSMATVGGNHSNATEPTDASFSVDIEMIDSSSSSSSNIHYRLLCDPDKTTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIASCDEG 441          
BLAST of SMED30002006 vs. Planmine SMEST
Match: SMESG000037097.1 (SMESG000037097.1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 399/399 (100.00%), Postives = 399/399 (100.00%), Query Frame = 3
Query: 1923 MKKLPNNTQQIFIKFXXXXXXXXXXXXXYFCAAGSNLTCLDLSYSLLATNELLKCISKCSSLEELILDNEDHTFSNEGXXXXXXXXXXXXXXXNYCAKINDWGIQVVGALPSLSVLAIKYTSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLTVSDECMTCIGMFTQLELLNLSSSHITNPSSFPRLPELRHLDISHCHKLAWETQVHVKSLCDSFPKLSSINVRGVSNVNLVHITMAISNCKFIRQLDGILCHPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSSCSGLIGXXXXXXXXXXXXXXXXXXXXTHLDNVASFQICQLLLGNHFPRLQVAWISLTXXXXXXXXXXXXHLNFKINVTRSLIKQLNAGGQNG 3119
            MKKLPNNTQQIFIKFLLDDKLLTPSLLSYFCAAGSNLTCLDLSYSLLATNELLKCISKCSSLEELILDNEDHTFSNEGLWHLRYLTRLRRLSLNYCAKINDWGIQVVGALPSLSVLAIKYTSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLTVSDECMTCIGMFTQLELLNLSSSHITNPSSFPRLPELRHLDISHCHKLAWETQVHVKSLCDSFPKLSSINVRGVSNVNLVHITMAISNCKFIRQLDGILCHPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSSCSGLIGDNNSILNNLSRLRNLSWLDLTHLDNVASFQICQLLLGNHFPRLQVAWISLTEQQESEFRSQSQHLNFKINVTRSLIKQLNAGGQNG
Sbjct:    1 MKKLPNNTQQIFIKFLLDDKLLTPSLLSYFCAAGSNLTCLDLSYSLLATNELLKCISKCSSLEELILDNEDHTFSNEGLWHLRYLTRLRRLSLNYCAKINDWGIQVVGALPSLSVLAIKYTSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLTVSDECMTCIGMFTQLELLNLSSSHITNPSSFPRLPELRHLDISHCHKLAWETQVHVKSLCDSFPKLSSINVRGVSNVNLVHITMAISNCKFIRQLDGILCHPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSSCSGLIGDNNSILNNLSRLRNLSWLDLTHLDNVASFQICQLLLGNHFPRLQVAWISLTEQQESEFRSQSQHLNFKINVTRSLIKQLNAGGQNG 399          
BLAST of SMED30002006 vs. Planmine SMEST
Match: SMESG000079713.1 (SMESG000079713.1)

HSP 1 Score: 56.225 bits (134), Expect = 2.022e-7
Identity = 42/151 (27.81%), Postives = 75/151 (49.67%), Query Frame = -3
Query: 3803 QREIGRIVSRFPTRV*RFEQSTSAFTWFFKPFLSNVIENRTPSYKIQLATKTVEKSELIEIKEDQALQIKLKSTQ-------IRRKIKFYTIKIRFCHL-------HSCEFVCSKMKLVK*KSRSQLPNQHLTELVQTTLITFTINFKDFV 4213
            Q ++  +++ F  R    E   +   +   PF  +VI +     K  +   +  + ELIEI+E+  L+++ K++Q          + K+  +K   C L       + CE + S MK +K K RS+L N+HLT L++T L ++  +F+ FV
Sbjct:  488 QEKLQELINYFELRYEDLEIFKTFINFLLNPFAVDVINDGFSIPKYLIPETSAGQKELIEIQENIILKMQHKTSQSPIEFWKFVAESKYSRLKNASCKLISIFGTTYCCESLYSTMKFIKSKYRSELTNEHLTGLIRTALTSYEPDFQKFV 638          
The following BLAST results are available for this feature:
BLAST of SMED30002006 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A0S4KJS17.846e-828.08Receptor-type protein kinase, putative (Fragment) ... [more]
A0A3T1CA162.390e-625.31Uncharacterized protein OS=Neochlamydia sp. S13 OX... [more]
A0A0C1JTF13.376e-625.31F-box/LRR-repeat protein 14 OS=Neochlamydia sp. EP... [more]
back to top
BLAST of SMED30002006 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002006 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000037096.10.000e+0100.00SMESG000037096.1[more]
SMESG000037096.10.000e+0100.00SMESG000037096.1[more]
SMESG000037097.10.000e+0100.00SMESG000037097.1[more]
SMESG000079713.12.022e-727.81SMESG000079713.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002006 ID=SMED30002006|Name=SMED30002006|organism=Schmidtea mediterranea sexual|type=transcript|length=5007bp
ATTTAAATGCTATATAATATTATAGTTATATTATGAAATTAATTTGTTAA
ATTATCATGCTTACTCTGAAGGTTTCACATATAAATTCATAAGTAGTTGT
TTTGAATTTAAACTGATTATACTCAGTTATACATTTATGAAAAATGCAAC
ATTTTTCAAGTATTTATGAGAAGCTTATTGACATGGGCTTTGCTAATGAT
GCCATAGATGCATCAATTAAGAAAGGCCTTTATACATTTGATATGATTTT
CAATGATTTAGTTGAAACGGATCCAGATTTAAAGACATTCTCGGAATCAA
ACAATTTTAATAAATATGGGAATACTTGCCAGCCAATATTGAAATTGCGA
GCAAACCCATATGTTGGCATATTTGAAGAGGGAATTGAGAAAAAATTTAT
GGACATGGCAATTTGTGATTCGACAGATTCCTTCAGTCAGATGACGCAAC
CAGCAAATGTTGGTGGCGATTGGAGGTGTCGCATGCCATCAGAGTTACAG
TGGACAAGCACAAGCCAGCATGACCAGTGGCTCGGACCGAATGCTGGCAG
CATCAACTCGATGTTGCCCATGGAATGTGGCGGCAACAAGCAGAGATCTA
TCAGAAACGGGTCGGCCTTGGACGGTGGCATGGGAATAACGGAGGCGATC
TCATCAACGGTATCCTCCTCATCTATGCTGTCAGTGAGCAGTAGCAATGA
GCAGCATCCTGTGGCGGCGGTGCTGGTGGGTGCTGGGGAGCCCAATCAGG
CGCCCATTCGAGCACCCAATCAAGCGCCCAATCAAACCGCCAGGATCCAA
ATCATGGATCTGCTAGATCCCTCGCTTGAGCCGGCCACCTTCAGCCATCC
GTTCCTGGCAGCGATCTGCACGATTCGGGACCTGATTTGCTGGTTCCATC
GGTGTCGCTACTCGAGCAATCGGATGAGCAAGCCGCATCCGGCCAATGAA
TCGGGCCGATCTGTGGGCCAGTTGGCAATTCCATATGATACAAGCCTGAG
TGAGATAATCGAGTTATTCCAGCGTTTGCGCTGGCATTTCGTAATGCCGT
CGGGCGCCCAATCAAATCGGATTGTCGGTGAGCATTGCCTTGACAGGAGC
ATTGGCAGCCTTGGCCTCCATCCGAATGCTCATTTGCTTGCCATTGTCAG
CTGTCCTTCACTGGAGCTGGGGCAGCGGCTGGAGCCGAGCACGGCCCCGT
TCTCCATGGCAACTGTCGGTGGCAACCATTCAAATGCCACAGAACCCACC
GATGCCAGTTTCTCAGTCGACATCGAAATGATTGACAGCTCCTCCTCCTC
CTCCAGTAACATTCATTACCGACTGCTCTGTGATCCCGACAAGACAACAC
TGGATAATATTGCCACAGAATTCTCCCGCATCAGTCGGATTGATGTCGGC
ACATTCACCTTGCTGCGACAGAAGCCCCGACAGATGTTCTCGTATCCAGA
GGATTATTTGCGCACGTTGACTGAGCTGGAGTTAATTGCTAGCTGTGATG
AGGGCCGAGTCTGTTTGAGTTGCTACCGACTGGATCAGCATTGGCCCAAT
CCTGATGCTGCCAGTGCTGTCGGATCCGGTAACCATGCCAACAACAGCAG
CGGGGAATCATTTCAGGCTCCGTTTGCAAGTCCTCTTTCAGACTCATCTG
CTATAATGGAGTTTGAATCAATCACCAGGACCCCCGATCTAGTGACATAT
AGAAATCCCACTGCGCCATTCTCTGGCATTGGCATTCCCCTGCCCGGTTG
CCAAGATAACAGATCAGTTGCGGAATTATGGGCGGATAGATCATTCGATA
TCTGTGCACTTAGCAACCCCTCTACTGCTCGTCTAGATAGGCGGCCAAAA
TCGCTGCTCCACCTCTGCTTCAAGGAGATTTACCGGTTGCTACGTATCCA
TAACAACTCGACTTGTAGGTCAATGAAAAAGTTACCTAATAATACCCAGC
AAATTTTTATTAAATTCCTCCTCGACGACAAACTGTTGACTCCTAGCTTG
CTTTCGTATTTCTGTGCCGCGGGTTCCAACTTGACATGTCTCGACCTTTC
GTACTCACTATTGGCCACAAATGAGCTGCTGAAATGCATCAGCAAATGCT
CATCTCTGGAAGAGCTGATCCTTGACAATGAGGATCATACATTTAGTAAT
GAGGGTCTCTGGCATTTGCGCTATCTGACCCGCCTTCGACGGCTCAGCCT
GAATTATTGTGCCAAAATCAATGATTGGGGTATCCAGGTAGTGGGCGCGC
TCCCCTCCCTCTCTGTGCTCGCCATCAAATACACCTCTGTCACGAATGTC
GGCCTCAAGCACATTTACCTTCACTTGAGTTCTCAGAACGACCCCGTCAG
TAGTGTTCCCGCCCTCCGATCTGTCGACTTGTCTGGGCTGACCGTATCTG
ATGAGTGCATGACTTGCATCGGCATGTTCACTCAGCTTGAACTGCTCAAC
CTCTCTTCCAGTCACATCACGAATCCCTCATCATTCCCTCGCTTGCCTGA
GCTGCGTCACCTGGACATAAGCCATTGTCACAAACTCGCATGGGAAACTC
AAGTCCACGTCAAATCGCTATGTGATTCGTTTCCCAAGCTCTCCTCAATC
AATGTCAGAGGCGTCTCTAATGTGAATCTCGTTCATATCACCATGGCAAT
ATCTAACTGCAAATTCATCAGGCAGCTCGATGGCATACTGTGCCACCCGC
AAATGACAGCTAGCCTAGTAGCCAGTCTGTCTCATCTACCATTGGAAACA
ATTATTCTCACCAACTGTCGTCATGTGAGCGATTTATGGCTGCCAGTCCT
TGCCCGATTCTCGGCCACTTTGACCCATCTGGTGCTTAGCTCGTGCTCAG
GACTCATAGGTGACAATAACTCAATACTAAACAATCTCAGCCGCCTCCGC
AATTTGTCATGGTTGGACCTGACCCATCTGGACAATGTCGCCAGTTTTCA
AATCTGTCAGCTGTTGCTAGGCAACCATTTCCCCAGGTTGCAAGTGGCCT
GGATTTCGCTCACCGAGCAGCAGGAATCAGAATTCAGATCTCAATCACAG
CATTTGAATTTCAAAATCAACGTGACCAGAAGCTTGATAAAACAATTGAA
TGCCGGCGGACAGAATGGCTGATTGGTTGCGAATTTTATTGATTATTCAT
TATCTCAGGGATCCGCAGCGCGCATGCATTCAATTGGTGGAAATTATGTC
ATCCAATCAATATCAATCTTTTTATTTTCTGCATTTACCGATGCGCATTT
TTATTTCTCGTCTTGTTTAATGATATTGATTATTTTGTCAATATTATCTC
ATTGCAAGTCGATTTTATATTGATTTTATTAAGATCATAGTGCCGATTGC
CTGTTGTGCTTGATTATTTTCACATACAATTTGTCACCGGACTCCCTCCT
TCCCATCCGATGCATAAAACCCATAGATTCTGCTCTGTAAAATTATTTAA
TCTTTTATCTCTTCATTTATCTTTACTCAGTTGTCGCAAATTTGGTCAAT
GTTTTGTATTTATCCAAATTTTTCCGTTGTTGATTTAATTATAGCAAATT
TGCAGGAAAACGAATCTCGTTTTGTAGCGCCTATAGGCCAAATTCATTGG
GCATGGCCAAGCTAGTTTGGAGGTTAAACGAAATTTCCGAATGAAAAATT
ACTCCAGTCACTGCCAAACTGGGGGGCGTGGACGTACGTCACTTATGGAC
GAAAGTATTGAACAGGTTGGAAGTCAATAAATAAAAATTCAAATAATTAT
ATTAAAATCTTGATGAAAAAATTGGCAATTCTTTAATTTGTTAAAAATAT
TTGACGAAATCTTTGAAATTTATTGTGAACGTTATCAGAGTCGTTTGCAC
CAGCTCTGTGAGATGTTGATTGGGCAGTTGTGAACGAGATTTCTACTTCA
CCAACTTCATTTTTGAGCATACAAATTCGCAGGAGTGAAGGTGACAGAAG
CGTATTTTAATTGTATAAAATTTTATTTTGCGACGAATTTGTGTGGATTT
GAGTTTGATTTGCAATGCCTGATCTTCTTTTATCTCTATCAATTCCGATT
TCTCAACCGTTTTTGTAGCAAGTTGGATTTTATAACTTGGAGTTCGATTT
TCAATAACATTACTGAGGAAAGGCTTGAAAAACCATGTAAATGCGGATGT
TGACTGCTCAAATCTCTAAACCCTTGTTGGAAATCTGCTTACGATTCTCC
CAATTTCTCTTTGTATTATCTCTTTTGTTTTCTTGAAAATCGATTAAATT
TTGATTTACTCGTGAAAAATTATTAAATGATTTCGTATTAATATCCTATA
CAAAAATTCGACATTTACCTTTAATACAAAATAAATGATTATTTCTTTTC
CTTATGCAAATGTTCCATAACGCCTGTAAACAACATAAAATTCAACTTTT
CAAAACCTTACAACATACCAAAGGTAAGAATCTCTGGGCAACCCATTTAT
TGCTTCATTTACCTGCAAATGCTCCGACATCCCTACTTAACCTTTTATGG
AAAAATCGGTAAGACGTCGAATGCTTAGTTTCAGCCTGACCTATGTTTTA
ATTTTGCTAATAAATTGAAATCTGTATGTCCGAACTGGCAGATCCGCGTA
TTTATAAGTAACAGTTGCAGGAACACCGAAATCCTCGAGACTAACATCCA
TCAAAGTGTAACTGAAAATAACAACAGAAACACAAAATAGCAATTTAGAA
CAATTTCATAGAGAGTTCGTATAAAAAGAAGTCATTATGAATACTCCCGT
GGAGATTTGGTGCGAGGGATCCATATTTAATCTGTAAAATCATGTCCAAG
GGAATCGCAAGGAATCGCAGGAATTGAAAGGAAATTGACCTGCACTTAAC
CTGAAAGTAACACTTTTATAAACATTTTAAATAAATATTCTTCTAATTTA
TAACATAAATATTTACATTCTACATAACAGCCTTCAATAGCGCCATGAGT
CCGCCAGTAAGTCAAGCAAAGCAAAGAGAAAATCTCACCAGCCGTTTCCG
GTCTTGG
back to top

protein sequence of SMED30002006-orf-1

>SMED30002006-orf-1 ID=SMED30002006-orf-1|Name=SMED30002006-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=993bp
MQHFSSIYEKLIDMGFANDAIDASIKKGLYTFDMIFNDLVETDPDLKTFS
ESNNFNKYGNTCQPILKLRANPYVGIFEEGIEKKFMDMAICDSTDSFSQM
TQPANVGGDWRCRMPSELQWTSTSQHDQWLGPNAGSINSMLPMECGGNKQ
RSIRNGSALDGGMGITEAISSTVSSSSMLSVSSSNEQHPVAAVLVGAGEP
NQAPIRAPNQAPNQTARIQIMDLLDPSLEPATFSHPFLAAICTIRDLICW
FHRCRYSSNRMSKPHPANESGRSVGQLAIPYDTSLSEIIELFQRLRWHFV
MPSGAQSNRIVGEHCLDRSIGSLGLHPNAHLLAIVSCPSLELGQRLEPST
APFSMATVGGNHSNATEPTDASFSVDIEMIDSSSSSSSNIHYRLLCDPDK
TTLDNIATEFSRISRIDVGTFTLLRQKPRQMFSYPEDYLRTLTELELIAS
CDEGRVCLSCYRLDQHWPNPDAASAVGSGNHANNSSGESFQAPFASPLSD
SSAIMEFESITRTPDLVTYRNPTAPFSGIGIPLPGCQDNRSVAELWADRS
FDICALSNPSTARLDRRPKSLLHLCFKEIYRLLRIHNNSTCRSMKKLPNN
TQQIFIKFLLDDKLLTPSLLSYFCAAGSNLTCLDLSYSLLATNELLKCIS
KCSSLEELILDNEDHTFSNEGLWHLRYLTRLRRLSLNYCAKINDWGIQVV
GALPSLSVLAIKYTSVTNVGLKHIYLHLSSQNDPVSSVPALRSVDLSGLT
VSDECMTCIGMFTQLELLNLSSSHITNPSSFPRLPELRHLDISHCHKLAW
ETQVHVKSLCDSFPKLSSINVRGVSNVNLVHITMAISNCKFIRQLDGILC
HPQMTASLVASLSHLPLETIILTNCRHVSDLWLPVLARFSATLTHLVLSS
CSGLIGDNNSILNNLSRLRNLSWLDLTHLDNVASFQICQLLLGNHFPRLQ
VAWISLTEQQESEFRSQSQHLNFKINVTRSLIKQLNAGGQNG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf