Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30001988
Length (bp)2965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30001988) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30001988) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific serine/threonine protein kinase (SMED30001988) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30001988) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001988

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001988SMESG000036933.1 dd_Smed_v4_3235_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001988SMESG000036933.1 dd_Smed_v4_3235_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001988SMESG000036933.1 dd_Smed_v4_3235_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001988SMESG000036933.1 dd_Smed_v4_3235_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001988SMESG000036933.1 dd_Smed_v4_3235_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 426.787 bits (1096), Expect = 3.170e-138
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  241 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKE 539          

HSP 2 Score: 72.0182 bits (175), Expect = 3.073e-12
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 424.861 bits (1091), Expect = 3.874e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  260 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 558          

HSP 2 Score: 57.3806 bits (137), Expect = 1.215e-7
Identity = 29/91 (31.87%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQIN---------------------GLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAK-SKQKFM 512
            EIS P+   H +HV FDA TG+                       G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++     + QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTNSPFQTSRPVTVASSQSEGKMGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYM 159          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 424.861 bits (1091), Expect = 3.874e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  260 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 558          

HSP 2 Score: 57.3806 bits (137), Expect = 1.215e-7
Identity = 29/91 (31.87%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQIN---------------------GLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAK-SKQKFM 512
            EIS P+   H +HV FDA TG+                       G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++     + QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTNSPFQTSRPVTVASSQSEGKMGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYM 159          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 423.705 bits (1088), Expect = 4.622e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  238 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 536          

HSP 2 Score: 69.707 bits (169), Expect = 1.668e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   68 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 137          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 423.705 bits (1088), Expect = 5.717e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  239 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 537          

HSP 2 Score: 69.707 bits (169), Expect = 1.730e-11
Identity = 29/70 (41.43%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAK-SKQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++     + QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 415.231 bits (1066), Expect = 1.570e-134
Identity = 199/296 (67.23%), Postives = 238/296 (80.41%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            K++D EV+ +L+ +VS G+P  KY   +K+G GASG VY++   ST   +AIKQM L  QPKK+LI+NEILVMR ++H NIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M++  IA VCRE LQALEFLHS+HVIHRDIKSDNILLG+DG VKLTDFGFCAQLS +  KRTTMVGTPYWMAPEVVT+KQYGPKVDVWSLGIMA+EM++GEPPYLNENP++A+YLIATNGKPD     +M+  FKDF+D  LEV VE RWSAS LL HPF+ + ++ +  L  LI  A++
Sbjct:  223 KMTDAEVLTKLRTIVSIGNPDRKYRKVDKIGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCD--ELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL-RCAKPLASLYYLIVAAKK 515          

HSP 2 Score: 67.781 bits (164), Expect = 2.212e-11
Identity = 26/68 (38.24%), Postives = 46/68 (67.65%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            IS P+   H +HV +D +TG+  G+P+AW+ +LT S ISK +Q++NP+ +++ L+ +     S QK++
Sbjct:   21 ISRPSNFEHTIHVGYDPKTGEFTGMPEAWARLLTDSQISKQEQQQNPQAVLDALKYYTQGESSGQKWL 88          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 416.387 bits (1069), Expect = 2.830e-134
Identity = 199/296 (67.23%), Postives = 238/296 (80.41%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            K++D EV+ +L+ +VS G+P  KY   +K+G GASG VY++   ST   +AIKQM L  QPKK+LI+NEILVMR ++H NIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M++  IA VCRE LQALEFLHS+HVIHRDIKSDNILLG+DG VKLTDFGFCAQLS +  KRTTMVGTPYWMAPEVVT+KQYGPKVDVWSLGIMA+EM++GEPPYLNENP++A+YLIATNGKPD     +M+  FKDF+D  LEV VE RWSAS LL HPF+ + ++ +  L  LI  A++
Sbjct:  269 KMTDAEVLTKLRTIVSIGNPDRKYRKVDKIGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCD--ELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL-RCAKPLASLYYLIVAAKK 561          

HSP 2 Score: 68.1662 bits (165), Expect = 2.194e-11
Identity = 26/68 (38.24%), Postives = 46/68 (67.65%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            IS P+   H +HV +D +TG+  G+P+AW+ +LT S ISK +Q++NP+ +++ L+ +     S QK++
Sbjct:   67 ISRPSNFEHTIHVGYDPKTGEFTGMPEAWARLLTDSQISKQEQQQNPQAVLDALKYYTQGESSGQKWL 134          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 416.387 bits (1069), Expect = 3.074e-134
Identity = 199/296 (67.23%), Postives = 238/296 (80.41%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            K++D EV+ +L+ +VS G+P  KY   +K+G GASG VY++   ST   +AIKQM L  QPKK+LI+NEILVMR ++H NIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M++  IA VCRE LQALEFLHS+HVIHRDIKSDNILLG+DG VKLTDFGFCAQLS +  KRTTMVGTPYWMAPEVVT+KQYGPKVDVWSLGIMA+EM++GEPPYLNENP++A+YLIATNGKPD     +M+  FKDF+D  LEV VE RWSAS LL HPF+ + ++ +  L  LI  A++
Sbjct:  272 KMTDAEVLTKLRTIVSIGNPDRKYRKVDKIGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCD--ELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL-RCAKPLASLYYLIVAAKK 564          

HSP 2 Score: 68.1662 bits (165), Expect = 2.205e-11
Identity = 26/68 (38.24%), Postives = 46/68 (67.65%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            IS P+   H +HV +D +TG+  G+P+AW+ +LT S ISK +Q++NP+ +++ L+ +     S QK++
Sbjct:   67 ISRPSNFEHTIHVGYDPKTGEFTGMPEAWARLLTDSQISKQEQQQNPQAVLDALKYYTQGESSGQKWL 134          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 346.665 bits (888), Expect = 1.002e-109
Identity = 158/297 (53.20%), Postives = 230/297 (77.44%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQ 2012
            K+SD EV+++L+ +V+  +PL KY + +++G GASG V+ +    +   +A+K+M   +QPKK++++ EI VM+ +RHPN+VNY++S+LVD + +LWVVM+YL+GG+LTDVV +  + E QIA V +E L+AL FLH   ++HRDIKSDN+LLG++G+VKLTD GFCAQ+    +KR T+VGTPYWM+PE++ KKQY  KVD+WSLGIMALEM+DGEPPYL E P+KA+YLIA NGKP++K+   +S+EF +FLD CL VD ++R   ++LL HPF+ KK++ ++ L+  I+  RE+
Sbjct:  133 KLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPG-SKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL-KKAKPLSSLIPYIRAVREK 426          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 349.362 bits (895), Expect = 1.831e-108
Identity = 158/297 (53.20%), Postives = 230/297 (77.44%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQ 2012
            K+SD EV+++L+ +V+  +PL KY + +++G GASG V+ +    +   +A+K+M   +QPKK++++ EI VM+ +RHPN+VNY++S+LVD + +LWVVM+YL+GG+LTDVV +  + E QIA V +E L+AL FLH   ++HRDIKSDN+LLG++G+VKLTD GFCAQ+    +KR T+VGTPYWM+PE++ KKQY  KVD+WSLGIMALEM+DGEPPYL E P+KA+YLIA NGKP++K+   +S+EF +FLD CL VD ++R   ++LL HPF+ KK++ ++ L+  I+  RE+
Sbjct:  305 KLSDSEVLNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDAD-DLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPG-SKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL-KKAKPLSSLIPYIRAVREK 598          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 442.195 bits (1136), Expect = 2.832e-142
Identity = 209/307 (68.08%), Postives = 252/307 (82.08%), Query Frame = 3
Query: 1098 PRTRS---KPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            P TR+   K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE   +S+ F+DFLD CLEV+V++R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  396 PNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKE 699          

HSP 2 Score: 73.1738 bits (178), Expect = 7.723e-13
Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK--QKFM 512
            IS PT   H +HV FDA TG+  G+P+AW+ +L  SNISK +Q+KNP+ +++VL+ F++  K +   K+M
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYM 152          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 442.195 bits (1136), Expect = 2.832e-142
Identity = 209/307 (68.08%), Postives = 252/307 (82.08%), Query Frame = 3
Query: 1098 PRTRS---KPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            P TR+   K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE   +S+ F+DFLD CLEV+V++R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  396 PNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKE 699          

HSP 2 Score: 73.1738 bits (178), Expect = 7.723e-13
Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK--QKFM 512
            IS PT   H +HV FDA TG+  G+P+AW+ +L  SNISK +Q+KNP+ +++VL+ F++  K +   K+M
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYM 152          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 442.195 bits (1136), Expect = 2.832e-142
Identity = 209/307 (68.08%), Postives = 252/307 (82.08%), Query Frame = 3
Query: 1098 PRTRS---KPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            P TR+   K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE   +S+ F+DFLD CLEV+V++R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  396 PNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKE 699          

HSP 2 Score: 73.1738 bits (178), Expect = 7.723e-13
Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK--QKFM 512
            IS PT   H +HV FDA TG+  G+P+AW+ +L  SNISK +Q+KNP+ +++VL+ F++  K +   K+M
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYM 152          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 442.195 bits (1136), Expect = 2.832e-142
Identity = 209/307 (68.08%), Postives = 252/307 (82.08%), Query Frame = 3
Query: 1098 PRTRS---KPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            P TR+   K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE   +S+ F+DFLD CLEV+V++R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  396 PNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKE 699          

HSP 2 Score: 73.1738 bits (178), Expect = 7.723e-13
Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK--QKFM 512
            IS PT   H +HV FDA TG+  G+P+AW+ +L  SNISK +Q+KNP+ +++VL+ F++  K +   K+M
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYM 152          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334544)

HSP 1 Score: 442.195 bits (1136), Expect = 2.832e-142
Identity = 209/307 (68.08%), Postives = 252/307 (82.08%), Query Frame = 3
Query: 1098 PRTRS---KPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            P TR+   K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE   +S+ F+DFLD CLEV+V++R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  396 PNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKE 699          

HSP 2 Score: 73.1738 bits (178), Expect = 7.723e-13
Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK--QKFM 512
            IS PT   H +HV FDA TG+  G+P+AW+ +L  SNISK +Q+KNP+ +++VL+ F++  K +   K+M
Sbjct:   83 ISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYM 152          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 425.246 bits (1092), Expect = 2.128e-137
Identity = 200/308 (64.94%), Postives = 253/308 (82.14%), Query Frame = 3
Query: 1092 SAPRT--RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            S P+T  +S+  K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH   VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  269 STPQTTDKSRKKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLIIAAKE 573          

HSP 2 Score: 70.8626 bits (172), Expect = 4.625e-12
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++    S  QK+M
Sbjct:   73 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETSNNQKYM 142          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 425.246 bits (1092), Expect = 2.128e-137
Identity = 200/308 (64.94%), Postives = 253/308 (82.14%), Query Frame = 3
Query: 1092 SAPRT--RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            S P+T  +S+  K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH   VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  269 STPQTTDKSRKKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLIIAAKE 573          

HSP 2 Score: 70.8626 bits (172), Expect = 4.625e-12
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++    S  QK+M
Sbjct:   73 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETSNNQKYM 142          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 418.698 bits (1075), Expect = 8.783e-135
Identity = 200/316 (63.29%), Postives = 253/316 (80.06%), Query Frame = 3
Query: 1092 SAPRT--RSKPVKVSDKEVIDRLKL--------VVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            S P+T  +S+  K+SD+E++++L +        +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH   VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  269 STPQTTDKSRKKKMSDEEILEKLNVLRSPSAGSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLIIAAKE 581          

HSP 2 Score: 70.8626 bits (172), Expect = 4.228e-12
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++    S  QK+M
Sbjct:   73 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETSNNQKYM 142          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 418.698 bits (1075), Expect = 8.783e-135
Identity = 200/316 (63.29%), Postives = 253/316 (80.06%), Query Frame = 3
Query: 1092 SAPRT--RSKPVKVSDKEVIDRLKL--------VVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            S P+T  +S+  K+SD+E++++L +        +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH   VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  269 STPQTTDKSRKKKMSDEEILEKLNVLRSPSAGSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLIIAAKE 581          

HSP 2 Score: 70.8626 bits (172), Expect = 4.228e-12
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++    S  QK+M
Sbjct:   73 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETSNNQKYM 142          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 418.698 bits (1075), Expect = 8.783e-135
Identity = 200/316 (63.29%), Postives = 253/316 (80.06%), Query Frame = 3
Query: 1092 SAPRT--RSKPVKVSDKEVIDRLKL--------VVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            S P+T  +S+  K+SD+E++++L +        +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH   VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  269 STPQTTDKSRKKKMSDEEILEKLNVLRSPSAGSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLIIAAKE 581          

HSP 2 Score: 70.8626 bits (172), Expect = 4.228e-12
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++    S  QK+M
Sbjct:   73 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETSNNQKYM 142          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 427.943 bits (1099), Expect = 3.652e-140
Identity = 199/289 (68.86%), Postives = 242/289 (83.74%), Query Frame = 3
Query: 1089 NSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQ 1955
            +S  +T+ KP K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY + + +TG+ +AIKQM L  QPKK+LI+NEILVMR ++HPNIVNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  MQE +IA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ+S +  KR+TMVGTPYWMAPEVVT+K YGPKVDVWSLGIMA+EM++GEPPYLNENP++ALYLIATNG P ++E +  S  F+DFL  CLE+DVEKR SA DLL HPF++
Sbjct:  132 SSVDKTKKKP-KMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGE--ELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 417          

HSP 2 Score: 51.6026 bits (122), Expect = 5.537e-6
Identity = 21/46 (45.65%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  378 GLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK-QKFM 512
            G+P+ W+ +L  +NISK+DQ+KNP+V+++VL  ++    SK QK+M
Sbjct:   38 GMPKQWAQLLQTANISKIDQKKNPQVVLDVLNFYSSETTSKSQKYM 83          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 427.943 bits (1099), Expect = 5.932e-139
Identity = 199/289 (68.86%), Postives = 242/289 (83.74%), Query Frame = 3
Query: 1089 NSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQ 1955
            +S  +T+ KP K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY + + +TG+ +AIKQM L  QPKK+LI+NEILVMR ++HPNIVNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  MQE +IA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ+S +  KR+TMVGTPYWMAPEVVT+K YGPKVDVWSLGIMA+EM++GEPPYLNENP++ALYLIATNG P ++E +  S  F+DFL  CLE+DVEKR SA DLL HPF++
Sbjct:  213 SSVDKTKKKP-KMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGE--ELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 498          

HSP 2 Score: 69.707 bits (169), Expect = 1.322e-11
Identity = 32/78 (41.03%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  282 RKSPDPIQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK-QKFM 512
            +K  +P   IS+P    H  HV  D  TG+  G+P+ W+ +L  +NISK+DQ+KNP+V+++VL  ++    SK QK+M
Sbjct:   56 KKVKNPPLVISSPFGYEHIYHVGIDPSTGEFTGMPKQWAQLLQTANISKIDQKKNPQVVLDVLNFYSSETTSKSQKYM 133          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 422.55 bits (1085), Expect = 2.382e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  192 RQRKKS-KMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 490          

HSP 2 Score: 69.3218 bits (168), Expect = 1.521e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   17 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 86          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 423.705 bits (1088), Expect = 5.820e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  244 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 542          

HSP 2 Score: 69.707 bits (169), Expect = 1.584e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 423.32 bits (1087), Expect = 1.340e-136
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  259 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 557          

HSP 2 Score: 59.6918 bits (143), Expect = 2.224e-8
Identity = 31/86 (36.05%), Postives = 51/86 (59.30%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQIN---------------GLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+                 G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTPDLCGSQMGTGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 153          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 426.402 bits (1095), Expect = 2.931e-138
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  240 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKE 538          

HSP 2 Score: 72.0182 bits (175), Expect = 2.105e-12
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 426.402 bits (1095), Expect = 2.931e-138
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  240 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKE 538          

HSP 2 Score: 72.0182 bits (175), Expect = 2.105e-12
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 424.091 bits (1089), Expect = 2.884e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  239 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 537          

HSP 2 Score: 69.707 bits (169), Expect = 1.128e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 424.091 bits (1089), Expect = 2.884e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  239 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 537          

HSP 2 Score: 69.707 bits (169), Expect = 1.128e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 424.091 bits (1089), Expect = 2.884e-137
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  239 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 537          

HSP 2 Score: 69.707 bits (169), Expect = 1.128e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|O88643|PAK1_MOUSE (Serine/threonine-protein kinase PAK 1 OS=Mus musculus OX=10090 GN=Pak1 PE=1 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 2.267e-138
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL CCLE+DVEKR SA +LL H F+ K ++ ++ L  L+  A+E
Sbjct:  241 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTPFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLQCCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLMHAAKE 539          

HSP 2 Score: 70.0922 bits (170), Expect = 5.357e-11
Identity = 29/67 (43.28%), Postives = 45/67 (67.16%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQK 506
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  K
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSK 140          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q13153|PAK1_HUMAN (Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2)

HSP 1 Score: 426.787 bits (1096), Expect = 1.522e-137
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  241 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKE 539          

HSP 2 Score: 72.0182 bits (175), Expect = 1.476e-11
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|P35465|PAK1_RAT (Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus OX=10116 GN=Pak1 PE=1 SV=3)

HSP 1 Score: 426.787 bits (1096), Expect = 1.805e-137
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  240 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKE 538          

HSP 2 Score: 72.0182 bits (175), Expect = 1.485e-11
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q08E52|PAK1_BOVIN (Serine/threonine-protein kinase PAK 1 OS=Bos taurus OX=9913 GN=PAK1 PE=1 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 2.675e-137
Identity = 199/303 (65.68%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            + + KP K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  240 KQKKKP-KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKE 538          

HSP 2 Score: 72.0182 bits (175), Expect = 1.524e-11
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ +N    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q62829|PAK3_RAT (Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus OX=10116 GN=Pak3 PE=1 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 1.304e-136
Identity = 197/303 (65.02%), Postives = 251/303 (82.84%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            R R K  K++D+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DV++R SA +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  239 RQRKK-SKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLILAAKE 537          

HSP 2 Score: 69.707 bits (169), Expect = 7.754e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLK-FYDSKETVNNQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A0K8U8R7 (Serine/threonine-protein kinase PAK 3 (Fragment) OS=Bactrocera latifrons OX=174628 GN=Pak3_2 PE=3 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 4.862e-145
Identity = 212/305 (69.51%), Postives = 253/305 (82.95%), Query Frame = 3
Query: 1098 PRT-RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            PR+  +K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE + +ST F+DFLD CLEVDVE+R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:   68 PRSGTAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHSNQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKEKLSTVFQDFLDQCLEVDVERRASAHDLLKHPFL-KLARPLASLTPLIMAAKE 369          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A034WHQ7 (Serine/threonine-protein kinase PAK 3 OS=Bactrocera dorsalis OX=27457 GN=PAK3 PE=3 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 6.279e-145
Identity = 212/305 (69.51%), Postives = 253/305 (82.95%), Query Frame = 3
Query: 1098 PRT-RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            PR+  +K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE + +ST F+DFLD CLEVDVE+R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  100 PRSGTAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHSNQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKEKLSTVFQDFLDQCLEVDVERRASAHDLLKHPFL-KLARPLASLTPLIMAAKE 401          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A0K8WG04 (Serine/threonine-protein kinase PAK 1 OS=Bactrocera latifrons OX=174628 GN=Pak1_2 PE=3 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 6.346e-145
Identity = 212/305 (69.51%), Postives = 253/305 (82.95%), Query Frame = 3
Query: 1098 PRT-RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            PR+  +K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE + +ST F+DFLD CLEVDVE+R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  100 PRSGTAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHSNQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKEKLSTVFQDFLDQCLEVDVERRASAHDLLKHPFL-KLARPLASLTPLIMAAKE 401          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A034WE81 (Serine/threonine-protein kinase PAK 3 (Fragment) OS=Bactrocera dorsalis OX=27457 GN=PAK3 PE=3 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 6.515e-145
Identity = 212/305 (69.51%), Postives = 253/305 (82.95%), Query Frame = 3
Query: 1098 PRT-RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            PR+  +K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE + +ST F+DFLD CLEVDVE+R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:   85 PRSGTAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHSNQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKEKLSTVFQDFLDQCLEVDVERRASAHDLLKHPFL-KLARPLASLTPLIMAAKE 386          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A034WJA5 (Serine/threonine-protein kinase PAK 3 (Fragment) OS=Bactrocera dorsalis OX=27457 GN=PAK3 PE=3 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 6.873e-145
Identity = 212/305 (69.51%), Postives = 253/305 (82.95%), Query Frame = 3
Query: 1098 PRT-RSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            PR+  +K  K+SD+E++++L+ +VS GDP  KY   EK+GQGASG VY++   STG  +AIKQM L+ QPKK+LI+NEILVMR ++HPN+VNYLDS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLGLDG VKLTDFGFCAQ+S + +KRTTMVGTPYWMAPEVVT+KQYGPKVD+WSLGIMA+EM++GEPPYLNENP+KALYLIATNGKP++KE + +ST F+DFLD CLEVDVE+R SA DLL HPF+ K +  +  L  LI  A+E
Sbjct:  102 PRSGTAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSE--ELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHSNQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKEKLSTVFQDFLDQCLEVDVERRASAHDLLKHPFL-KLARPLASLTPLIMAAKE 403          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 410.223 bits (1053), Expect = 6.241e-133
Identity = 192/306 (62.75%), Postives = 251/306 (82.03%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +A + + K  K++D+E++D+L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQ+ L  QPKK+LI+NEILVM+  ++PNIVN+LDSFLV +  EL+VVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDN+LLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL  CLE+DVEKR S+ +LL HPF+ K ++ ++ L  LI  A++
Sbjct:  181 AADKQKPKKGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGE--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPIFRDFLARCLEMDVEKRGSSKELLQHPFL-KLAKPLSSLTPLILAAKD 483          

HSP 2 Score: 50.8322 bits (120), Expect = 5.679e-6
Identity = 21/62 (33.87%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  327 VSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            V+ EL + F +Q     G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ ++     +QK++
Sbjct:   72 VNLELTLCFASQ-----GMPEQWARLLQTSNITKYEQKKNPQAVLDVLKFYDSTGNGRQKYL 128          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 408.683 bits (1049), Expect = 1.441e-130
Identity = 188/302 (62.25%), Postives = 248/302 (82.12%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQQQLSK 2027
            K++D+E++++L+ +VS GDP +KY   EK+GQGASG V+++ + +TG+ +AIKQ+ L  QPKK+LI+NEILVM+  ++PNIVN+LDSFLV +  EL+VVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDN+LLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  F+DFL+ CLE+DVEKR    +LL HPF+ K ++ ++ L  LI  A++  + S+
Sbjct:  314 KMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGE--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFL-KLAKPLSSLTPLILAAKDAMKNSR 612          

HSP 2 Score: 74.7146 bits (182), Expect = 2.838e-13
Identity = 29/69 (42.03%), Postives = 48/69 (69.57%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K +Q+KNP+ +++VL+ ++     KQK++
Sbjct:  164 EISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLKFYDSTGNGKQKYL 232          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 401.364 bits (1030), Expect = 5.463e-129
Identity = 193/306 (63.07%), Postives = 244/306 (79.74%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            SA +TR K  K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR ++          +LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S+ F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  226 SADKTRKK--KMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENK---------PYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLILAAKE 517          

HSP 2 Score: 70.0922 bits (170), Expect = 5.986e-12
Identity = 29/70 (41.43%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDA-AKSKQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++     + QK+M
Sbjct:   69 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETANSQKYM 138          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 382.104 bits (980), Expect = 5.541e-122
Identity = 183/283 (64.66%), Postives = 226/283 (79.86%), Query Frame = 3
Query: 1161 VVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR ++          +LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S+ F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  221 IVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENK---------PYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQHQFL-KVAKPLSSLTPLILAAKE 491          

HSP 2 Score: 69.3218 bits (168), Expect = 1.030e-11
Identity = 29/70 (41.43%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDA-AKSKQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++     + QK+M
Sbjct:   73 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETANSQKYM 142          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 357.066 bits (915), Expect = 2.428e-112
Identity = 165/238 (69.33%), Postives = 201/238 (84.45%), Query Frame = 3
Query: 1101 RTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYL 1814
            R R K  K++D+E+++RL+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQAL+FLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ +  KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++  +L
Sbjct:  247 RQRKK-SKMTDEEILERLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRHSFL 481          

HSP 2 Score: 68.9366 bits (167), Expect = 1.222e-11
Identity = 31/71 (43.66%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS--KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ F D+ ++   QK+M
Sbjct:   67 EISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVIDVLK-FYDSKETVNNQKYM 136          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 310.071 bits (793), Expect = 2.429e-93
Identity = 146/301 (48.50%), Postives = 212/301 (70.43%), Query Frame = 3
Query: 1113 KPVKVSDKEVIDRLKLVVSAGDP---LEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAR 2006
            +P ++S ++    L+ VV  GDP   LE ++   K+G+G++GVV  + ++ +G+ +A+K+M L  Q +++L+ NE+++MR + H N+V+  +S+LV D  ELWVVME+L+GG+LTD+VT   M E QIATVC   L+AL +LH + VIHRDIKSD+ILL  DG++KL+DFGFCAQ+S ++T+R ++VGTPYWMAPEV+++  YGP+VDVWSLGIM +EM+DGEPPY NE P++A+  I  N  P +K  Q  S   + FLD  L  D   R +A +LL HPF+Q       C+V L++  R
Sbjct:  393 EPPRISHEQFRAALQQVVDPGDPSEYLENFI---KIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVAD--ELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKEVTRRKSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQNAGPPA-CIVPLMRQHR 687          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 222.631 bits (566), Expect = 2.954e-64
Identity = 115/279 (41.22%), Postives = 169/279 (60.57%), Query Frame = 3
Query: 1167 SAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVN-EILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIK--SDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELI 1994
            S  DP E +   E++G+G+ G V+   +  T + +AIK + L     +   +  EI V+     P + +Y  S+L     +LW++MEYL GGS  D++    ++E+QIAT+ RE L+ L++LHS+  IHRDIK  + N+LL   G VKL DFG   QL++   KR T VGTP+WMAPEV+ +  Y  K D+WSLGI A+E+  GEPP    +P++ L+LI  N  P ++   N S  FK+F+D CL  D + R +A +LL H FIQ+ ++  + L ELI
Sbjct:   18 SCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYL--KGTKLWIIMEYLGGGSALDLIKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLE--GNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKTSYLTELI 292          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 205.297 bits (521), Expect = 5.061e-55
Identity = 111/279 (39.78%), Postives = 167/279 (59.86%), Query Frame = 3
Query: 1185 EKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVV-TEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVT---KKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNG--KPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVA 2003
            E + L E++G G  G V+ + N  TG+ +AIK + L       +I  EI++M+  +H NIV Y  S+L  D  +LW+ ME+  GGSL D+      + E QIA V RETLQ L +LHS+  +HRDIK  NILL  DG VKL DFG  AQ++  + KR + +GTPYWMAPEV     K  Y  + DVW++GI A+E+ + +PP  + +P++AL+L++ +G   P +++ Q  S  F +F+   L  + +KR +A  +L H ++Q+       L  L +V+
Sbjct:   12 EDFELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHD--KLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYVQQPLSRAQALELLERVS 288          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 201.83 bits (512), Expect = 2.523e-53
Identity = 107/266 (40.23%), Postives = 156/266 (58.65%), Query Frame = 3
Query: 1176 DPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTE--AFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVV---TKKQ--YGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFI 1952
            DP E + +  ++G GA G VY + NK +G   A K +   S+ + +  + EI ++    HPNIV  L++F  ++   LW+ +E+  GG++  ++ E    + E QI  VC++ L+AL +LH+  +IHRD+K+ NILL  +G VKL DFG  A+ +  L +R + +GTPYWMAPEVV   T K   Y  K D+WSLGI  +E+   EPP    NP++ +  IA N  P +      S EF DFL  CL+ + E RW+A  LL H FI
Sbjct:   28 DPAELWSVIGELGDGAFGKVYKAQNKESGVLAAAKVIETKSEEELEDYMVEIEILALCDHPNIVGLLNAFYYENK--LWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFI 291          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: myo3a (myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4])

HSP 1 Score: 192.2 bits (487), Expect = 3.434e-50
Identity = 112/297 (37.71%), Postives = 164/297 (55.22%), Query Frame = 3
Query: 1176 DPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIK------QMTLASQPKKDLIVNEILVMRAH-RHPNIVNYLDSFLVDDN---KELWVVMEYLDGGSLTDVVTEAF-----MQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQ-----YGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQ----KKSESVNCLVELI 1994
            DP + + L E +G+G  G VY +T++  G   A+K       +  ++Q   + I  E  ++ +   HPNIV +   +   D     +LW+V+E  +GGS+TD+V         M    IA + R  L  L  LHS ++IHRDIK +NILL  DG ++L DFG  AQ+S    +R T VGTP+WMAPEV+  +Q     Y  + DVWS+GI A+E+ DG+PP    +P++AL+ I  N  P +K+ +     F +F+  CL  D E+R + S LL  PFIQ    ++ E    L ELI
Sbjct:   19 DPSDTWELVETIGKGTYGKVYKATSRKDGSKAAVKTLDPVNNLETSNQDIDEEIEAEYSILTSLPEHPNIVRFFGMYYQKDGVNGDQLWIVLELCNGGSVTDLVKGQLKRGERMDVMLIAYILRGALLGLNHLHSHNIIHRDIKGNNILLTTDGGIRLVDFGVSAQVSKTRVERNTAVGTPFWMAPEVIACEQQLDYMYDRRCDVWSMGITAIELGDGDPPLYELHPMRALFKIPRNPPPTLKQPELWPPLFNEFIAQCLVKDFERRATVSQLLEDPFIQQVEGREQELQKQLTELI 315          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 377.096 bits (967), Expect = 6.821e-116
Identity = 172/286 (60.14%), Postives = 222/286 (77.62%), Query Frame = 3
Query: 1149 RLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAR 2006
            +L  + S GDP  KY    K+GQGASG VY++    T   +AIKQM L  QPKK+LI+NEILVM+  +HPNIVN++DS+++    +LWV+MEY++GGSLTDVVT   + E QI  VCRETL  LEFLHSK V+HRDIKSDNILL ++G +KLTDFGFCAQ++    KRTTMVGTPYWMAPEVV++K+YGPKVD+WSLGIM +EM++GEPPYLNE P++ALYLIATNG P +KE +N+S+  K FLD CL V+ E R SA++LL+  +I + +E+ + L  L+K+AR
Sbjct:  606 KLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKG--DLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLAR 889          

HSP 2 Score: 56.9954 bits (136), Expect = 1.251e-8
Identity = 23/63 (36.51%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS 497
            IS P    H  HV  D++TG+  GLP+ W  +LT+S ISK +Q++N + +M++++ + D  ++
Sbjct:  337 ISTPYNAKHIHHVGVDSKTGEYTGLPEEWEKLLTSSGISKREQQQNMQAVMDIVKFYQDVTET 399          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 327.02 bits (837), Expect = 2.897e-98
Identity = 160/314 (50.96%), Postives = 215/314 (68.47%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKS-------------------TGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVV--------TEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFI 1952
            + P+  ++P  +S  E++ +LK V    DP + + + EK GQGASG VY +                        G  +AIKQM L+ QP+K+LIVNEILVM+  RH NIVN+L+++L  D+ +LWVVME+++GGSLTD++        + + + E QIA + RET Q L+FLH KH+IHRDIKSDN+LL    +VK+TDFGFCA+L++  +KR TMVGTPYWMAPEVV +++Y  K+DVWSLGIM +EML+GEPPYLNE+P+KALYLIATNG P +K  +++S E K FL  CL VDV  R S  +LL+H F 
Sbjct:  514 AKPKKPARPT-MSTAEIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDD-DLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 825          

HSP 2 Score: 51.6026 bits (122), Expect = 6.472e-7
Identity = 21/59 (35.59%), Postives = 35/59 (59.32%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFND 485
            +S+PT  +H++HV FD +TG   G+P  W  +L  S I+  D   N   +++VLQ + +
Sbjct:  184 VSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNNSAAVIQVLQFYQE 242          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 311.227 bits (796), Expect = 2.609e-94
Identity = 156/316 (49.37%), Postives = 211/316 (66.77%), Query Frame = 3
Query: 1137 EVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVY-----------------SSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAF----------MQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVA 2003
            E+I ++K V    +P   + L EK GQGASG VY                 S  ++  G+ +AIKQ+ L+ QPKK LI+NE+LVM   R  NIVN+L+++++DD +ELWV+MEY++GG LTD++              + ENQ+A + +ET Q L+FLH+K +IHRDIKSDNILL   G VK+TDFGFC +L+   +KR TMVGTPYWMAPE+V +K Y  KVDVWSLGIM +EM++GEPPYLNE+P+KALYLIA NG P ++  +++S + K FLD CL+V+VE R S   LL   F+     S+ C  E +KV+
Sbjct:  342 EIIMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDD-EELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFL-----SMACSPEQLKVS 651          

HSP 2 Score: 52.373 bits (124), Expect = 2.782e-7
Identity = 20/59 (33.90%), Postives = 37/59 (62.71%), Query Frame = 3
Query:  309 ISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFND 485
            +S+PT  +H++HV FD + G   G+P +W+ +L  S I+  D  +N + +++ LQ + D
Sbjct:  123 VSSPTNFTHKVHVGFDPKVGNFVGVPDSWAKLLQTSEITYDDWNRNSKAVIKALQFYED 181          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 193.741 bits (491), Expect = 4.940e-51
Identity = 110/268 (41.04%), Postives = 157/268 (58.58%), Query Frame = 3
Query: 1203 EKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKK-DLIVNEILVMRAHRH-PNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKK-QYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQ-KKSESVNCLVELI 1994
            E +G+G  GVVY   N  TG+  AIK + L S   + + +  EI  + + +   NI  Y  S+L D +  LW++ME+  GGSL  ++    + E  I  + RE L AL+ +H  +VIHRDIK+ N+L+  +G VKL DFG  AQ++    +R TM GTPYWMAPEV+ +   Y  KVD+WSLGI   E+  G PPY +   ++A+ LI    KP   E ++ ST  K+F+  CL+ D ++R SA DLL   FI+  K+   + L ELI
Sbjct:   27 EVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTS--LWIIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLI-IKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELI 291          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 167.548 bits (423), Expect = 9.515e-45
Identity = 104/296 (35.14%), Postives = 163/296 (55.07%), Query Frame = 3
Query: 1161 VVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLA-SQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAF---MQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKK--QYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKS-ESVNCLVELIKVAREQQQLSK 2027
            + S   P + Y +   +G+G  G VY + ++ T + +AIK + L  S    +L+  EI  +   + P I NY+ + L D +  +W+VMEY  GGS +D++  ++   + E +++ +  E    L++LH +  IHRDIK+ NILL  +G VKL DFG    + + L KR T VGTPYWMAPEVV  +   Y  K D+WSLGI   E+L G PP    +P+K +  +     P ++     S   KDF+  CL      R SA +LL+  F++  +  ++   V+LIK  + Q++ +K
Sbjct:    8 IRSRTPPSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVS--MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTL-KRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP--FSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKNITITNLKSDVDLIKQKKVQERYTK 298          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 423.705 bits (1088), Expect = 2.514e-138
Identity = 200/296 (67.57%), Postives = 244/296 (82.43%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            K+SD+E++ RL+ +VS GDP +KY   EK+GQGASG VY++   +TG  +AIKQM L+ QPKK+LI+NEILVMR ++HPNIVNY+DS+LV +  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DGQVKLTDFGFCA ++ +  KR+TMVGTPYWMAPEVVT+KQYGP+VDVWSLGIMA+EM++GEPPYLNENP++ALYLIATNG P++   + +S  FKDFL   LE+DVEKR SA +LL HPF+ K+++ +  LV LI  A+E
Sbjct:  203 KMSDEEILARLRTIVSIGDPKKKYTKFEKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEILVMRENKHPNIVNYVDSYLVGE--ELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFL-KQAKPLASLVPLILAAKE 495          

HSP 2 Score: 69.707 bits (169), Expect = 2.549e-12
Identity = 30/65 (46.15%), Postives = 46/65 (70.77%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSK 500
            EIS PT   H +HV FD  TG+  G+P+AW+ +L  SNI++ +Q+KNP+ +++VL  F D++K K
Sbjct:   59 EISYPTQFEHTIHVGFDPVTGEFTGMPEAWARLLQVSNITQAEQKKNPQAVLDVLN-FYDSSKDK 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 286.574 bits (732), Expect = 3.710e-89
Identity = 132/250 (52.80%), Postives = 184/250 (73.60%), Query Frame = 3
Query: 1206 KVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQ 1955
            K+G+G++G+V  +T+K TG+ +A+K+M L  Q +++L+ NE+++MR + HPNIV    S LV D  ELWVVME+L+GG+LTD+VT   + E Q+A VCR  L+AL FLHS+ VIHRDIKSD+ILL  +G VKL+DFGFCAQ++ D+ +R ++VGTPYWMAPEV+++K YG +VD+WSLGIM LEM+DGEPPY NE P++A+  +     P  +    +S   + FLD  L  D   R +A +LLNHPFI+
Sbjct:   34 KIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGD--ELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIR 281          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 218.009 bits (554), Expect = 1.142e-63
Identity = 109/277 (39.35%), Postives = 178/277 (64.26%), Query Frame = 3
Query: 1179 PLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDV--VTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVA 2003
            P E + + EK+G+G+ G V+ + +K +G+ +AIKQ+ + +  ++  I+ EI +M+    P +V Y  S+    N +LW+VMEY   GS++D+  +    + E +I  V + TL+ LE+LH +  IHRDIK+ NILL  +G  KL DFG   QL++ + KR T++GTP+WMAPEV+ +  Y    D+WSLGI A+EM +G+PPY + +P++A+++I T   P  ++    S +FKDF+  CL  + E+R +A++LL H FIQ  ++ ++ L  +I+ A
Sbjct:   20 PEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQE--IIKEISMMQQCDSPYVVKYYGSYF--KNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQ-GAKQISILSSMIQEA 291          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 204.142 bits (518), Expect = 7.405e-58
Identity = 110/283 (38.87%), Postives = 168/283 (59.36%), Query Frame = 3
Query: 1173 GDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVN-EILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQQQ 2018
             DP + +   E++G+G+ G V+   +  T + +AIK + L     +   +  EI V+       +  Y  S+L     +LW++MEYL GGS  D++    ++E  IAT+ RE L+ L++LH++  +HRDIK+ N+L+   G VKL DFG   QL++ L KR T VGTP+WMAPEV+ +  Y  K D+WSLGI A+E+  GEPP  + +P++ L+LI  N  P++    N S  FK+F+  CL  D   R +A +LL H FI K ++    LVELI+  ++ +Q
Sbjct:    5 ADPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYL--KGTKLWIIMEYLGGGSALDLMKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPEL--TGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFI-KTAKKNAYLVELIERHKKWKQ 282          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 199.904 bits (507), Expect = 1.927e-57
Identity = 108/272 (39.71%), Postives = 162/272 (59.56%), Query Frame = 3
Query: 1152 LKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDV-VTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQ---YGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNG--KPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPF 1949
            L+  +S G+P + + L EKVG G  G V+ +   +TG   A+K + +      +LI  EI +M+  RH NI+NY+ +++  D  +LW+ MEY  GGS+ DV        E QI+ V  ETL+ L +LH K ++HRDIK  NILL  +G+VKL DFG  A+++  + KR + +GTPYWMAPE+   ++   Y  K D+W++GI A+EM + +PP  + +P++ALY+I       P +KE    S E   F+   L  + +KR SA  +L HPF
Sbjct:    5 LRAQISRGNPDKVFDLIEKVGGGTYGDVFKARVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAYMRRD--KLWIGMEYCGGGSIQDVYCVTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVERTGGYDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPF 274          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: pak1 (p21 (RAC1) activated kinase 1 [Source:NCBI gene;Acc:101164663])

HSP 1 Score: 422.935 bits (1086), Expect = 9.904e-137
Identity = 201/307 (65.47%), Postives = 253/307 (82.41%), Query Frame = 3
Query: 1089 NSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +S  +TR K  K+SD+E++++L+ +VS GDP +KY   EK+GQGASG VY++ + +TG+ +AIKQM L  QPKK+LI+NEILVMR +++PNIVNYLDS+LV D  ELWVVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLHS  VIHRDIKSDNILLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K Y PKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +ST F+DFL+ CLE+DVEKR SA +LL H F+ K ++ ++ L  LI  A+E
Sbjct:  256 HSQDKTRKK--KMSDEEILEKLRTIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYCPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSTIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KMAKPLSSLTPLILAAKE 557          

HSP 2 Score: 70.8626 bits (172), Expect = 3.917e-12
Identity = 30/70 (42.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKS-KQKFM 512
            EIS P+   H +HV FDA TG+  G+P+ W+ +L  SNI+K++Q+KNP+ +++VL+ ++    S  QK+M
Sbjct:   74 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETSNSQKYM 143          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 414.846 bits (1065), Expect = 8.664e-135
Identity = 194/306 (63.40%), Postives = 249/306 (81.37%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +A + + K  K++D+E++D+L+ +VS GDP +KY   EK+GQGASG VY++ + STG+ +AIKQ+ L  QPKK+LI+NEILVM+  ++PNIVN++DSFLV D  EL+VVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDN+LLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  FK FL  CLE+DVEKR S  +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  169 AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL-KIAKPLSSLTPLILAAKE 471          

HSP 2 Score: 72.0182 bits (175), Expect = 1.266e-12
Identity = 29/69 (42.03%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            EIS+P+   H +HV FD+ TG+  G+P+ W+ +L  SNISK++Q++NP+ ++ +L+ F D+   KQK++
Sbjct:   71 EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILK-FYDSTSGKQKYI 138          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 416.001 bits (1068), Expect = 9.118e-135
Identity = 194/306 (63.40%), Postives = 249/306 (81.37%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +A + + K  K++D+E++D+L+ +VS GDP +KY   EK+GQGASG VY++ + STG+ +AIKQ+ L  QPKK+LI+NEILVM+  ++PNIVN++DSFLV D  EL+VVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDN+LLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  FK FL  CLE+DVEKR S  +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  206 AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL-KIAKPLSSLTPLILAAKE 508          

HSP 2 Score: 72.0182 bits (175), Expect = 1.365e-12
Identity = 29/69 (42.03%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            EIS+P+   H +HV FD+ TG+  G+P+ W+ +L  SNISK++Q++NP+ ++ +L+ F D+   KQK++
Sbjct:   72 EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILK-FYDSTSGKQKYI 139          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000043480.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 416.001 bits (1068), Expect = 9.118e-135
Identity = 194/306 (63.40%), Postives = 249/306 (81.37%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +A + + K  K++D+E++D+L+ +VS GDP +KY   EK+GQGASG VY++ + STG+ +AIKQ+ L  QPKK+LI+NEILVM+  ++PNIVN++DSFLV D  EL+VVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDN+LLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  FK FL  CLE+DVEKR S  +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  206 AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL-KIAKPLSSLTPLILAAKE 508          

HSP 2 Score: 72.0182 bits (175), Expect = 1.365e-12
Identity = 29/69 (42.03%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            EIS+P+   H +HV FD+ TG+  G+P+ W+ +L  SNISK++Q++NP+ ++ +L+ F D+   KQK++
Sbjct:   72 EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILK-FYDSTSGKQKYI 139          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000030173.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 416.001 bits (1068), Expect = 9.118e-135
Identity = 194/306 (63.40%), Postives = 249/306 (81.37%), Query Frame = 3
Query: 1092 SAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVARE 2009
            +A + + K  K++D+E++D+L+ +VS GDP +KY   EK+GQGASG VY++ + STG+ +AIKQ+ L  QPKK+LI+NEILVM+  ++PNIVN++DSFLV D  EL+VVMEYL GGSLTDVVTE  M E QIA VCRE LQALEFLH+  VIHRDIKSDN+LLG+DG VKLTDFGFCAQ++ + +KR+TMVGTPYWMAPEVVT+K YGPKVD+WSLGIMA+EM++GEPPYLNENP++ALYLIATNG P+++  + +S  FK FL  CLE+DVEKR S  +LL HPF+ K ++ ++ L  LI  A+E
Sbjct:  206 AADKQKKKGGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGD--ELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL-KIAKPLSSLTPLILAAKE 508          

HSP 2 Score: 72.0182 bits (175), Expect = 1.365e-12
Identity = 29/69 (42.03%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  306 EISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            EIS+P+   H +HV FD+ TG+  G+P+ W+ +L  SNISK++Q++NP+ ++ +L+ F D+   KQK++
Sbjct:   72 EISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKLEQKQNPQTVLTILK-FYDSTSGKQKYI 139          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000036933.1 (SMESG000036933.1)

HSP 1 Score: 1147.5 bits (2967), Expect = 0.000e+0
Identity = 637/638 (99.84%), Postives = 638/638 (100.00%), Query Frame = 3
Query:  114 MFLNKNTELAPTPPTRSSSTLKKKEKVTTDXXXXXXXXXXXXXXXXXXXXXXXFRLRKSPDPIQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFMXXXXXXXXXXXXXXXXXXPRSQSQHNQESEDSLFSLEYEARSLNGSQDAIGNGSDHWRISDQSTNHSSIADSSGYGNQLENDESSSGFIESSLASGSSLHDEVAEDTPINGSPYSTNERPPRDESNKLGSSPLTGNYSNKPNKIPASADNDTDEGVALDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQQQLSK 2027
            MFLNKNTELAPTPPTRSSSTLKKKEKVTTDAPAKPLPLPPKSEKEKKKKKIKIFRLRKSPDPIQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFMTHMSQATSSSGSTESVPTPRSQSQHNQESEDSLFSLEYEARSLNGSQDAIGNGSDHWRISDQSTNHSSIADSSGYGNQLENDESSSGFIESSLASGSSLHDEVAEDTPINGSPYSTNERPPRDE+NKLGSSPLTGNYSNKPNKIPASADNDTDEGVALDTPPQSGISHSSSGTQQQQKSPTTPKATSPTEKSNSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQQQLSK
Sbjct:    1 MFLNKNTELAPTPPTRSSSTLKKKEKVTTDAPAKPLPLPPKSEKEKKKKKIKIFRLRKSPDPIQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFMTHMSQATSSSGSTESVPTPRSQSQHNQESEDSLFSLEYEARSLNGSQDAIGNGSDHWRISDQSTNHSSIADSSGYGNQLENDESSSGFIESSLASGSSLHDEVAEDTPINGSPYSTNERPPRDETNKLGSSPLTGNYSNKPNKIPASADNDTDEGVALDTPPQSGISHSSSGTQQQQKSPTTPKATSPTEKSNSAPRTRSKPVKVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQQQLSK 638          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000008326.1 (SMESG000008326.1)

HSP 1 Score: 451.055 bits (1159), Expect = 7.429e-147
Identity = 211/298 (70.81%), Postives = 248/298 (83.22%), Query Frame = 3
Query: 1131 DKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDN----KELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQ 2012
            ++E+ ++L+ +VS GDP  KY   EK+GQGASGVVY+    STGK +AIKQM L  QPKK+LI+NEI VM+A+RHPN+VNYLDS+LV        ELWVVMEYLDGGSLT+VVTE FM E  IA VCRE LQAL+FLH+ +VIHRDIKSDNILLGLDG VKLTDFGFCAQL+N+ TKR+TMVGTPYWMAPEVVT+KQYGPKVDVWSLGIMALEM+DGEPPYLNENP++ALYLIATNGKP++KE   +S  F DFLD CLEV VEKR SAS+LL HPFI +K++ ++ L  LI VA+EQ
Sbjct:  324 EEEICEKLRKIVSLGDPNRKYKKHEKIGQGASGVVYNGIETSTGKKVAIKQMQLKQQPKKELIINEICVMKANRHPNVVNYLDSYLVGGTGTVADELWVVMEYLDGGSLTEVVTETFMDEGHIAAVCRECLQALDFLHTNNVIHRDIKSDNILLGLDGSVKLTDFGFCAQLNNEQTKRSTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMALEMIDGEPPYLNENPLRALYLIATNGKPEIKEKSRLSVVFLDFLDKCLEVQVEKRISASELLTHPFIVRKAKPLSSLTPLIVVAKEQ 621          

HSP 2 Score: 62.7734 bits (151), Expect = 1.141e-9
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  300 IQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            I  ISAP  V H++H+ F   TG+  G+P  W  +L  +NISK++Q++NP  ++  L    D  K+K+K+M
Sbjct:   68 IPNISAPISVMHKVHITFSQDTGEFAGVPLEWQVIL-ENNISKIEQQQNPRAVLNALNILVDKNKNKEKYM 137          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000008326.1 (SMESG000008326.1)

HSP 1 Score: 451.055 bits (1159), Expect = 7.677e-147
Identity = 211/298 (70.81%), Postives = 248/298 (83.22%), Query Frame = 3
Query: 1131 DKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDN----KELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQ 2012
            ++E+ ++L+ +VS GDP  KY   EK+GQGASGVVY+    STGK +AIKQM L  QPKK+LI+NEI VM+A+RHPN+VNYLDS+LV        ELWVVMEYLDGGSLT+VVTE FM E  IA VCRE LQAL+FLH+ +VIHRDIKSDNILLGLDG VKLTDFGFCAQL+N+ TKR+TMVGTPYWMAPEVVT+KQYGPKVDVWSLGIMALEM+DGEPPYLNENP++ALYLIATNGKP++KE   +S  F DFLD CLEV VEKR SAS+LL HPFI +K++ ++ L  LI VA+EQ
Sbjct:  323 EEEICEKLRKIVSLGDPNRKYKKHEKIGQGASGVVYNGIETSTGKKVAIKQMQLKQQPKKELIINEICVMKANRHPNVVNYLDSYLVGGTGTVADELWVVMEYLDGGSLTEVVTETFMDEGHIAAVCRECLQALDFLHTNNVIHRDIKSDNILLGLDGSVKLTDFGFCAQLNNEQTKRSTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMALEMIDGEPPYLNENPLRALYLIATNGKPEIKEKSRLSVVFLDFLDKCLEVQVEKRISASELLTHPFIVRKAKPLSSLTPLIVVAKEQ 620          

HSP 2 Score: 62.7734 bits (151), Expect = 1.140e-9
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  300 IQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            I  ISAP  V H++H+ F   TG+  G+P  W  +L  +NISK++Q++NP  ++  L    D  K+K+K+M
Sbjct:   67 IPNISAPISVMHKVHITFSQDTGEFAGVPLEWQVIL-ENNISKIEQQQNPRAVLNALNILVDKNKNKEKYM 136          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000008326.1 (SMESG000008326.1)

HSP 1 Score: 451.055 bits (1159), Expect = 9.136e-147
Identity = 211/298 (70.81%), Postives = 248/298 (83.22%), Query Frame = 3
Query: 1131 DKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDN----KELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQ 2012
            ++E+ ++L+ +VS GDP  KY   EK+GQGASGVVY+    STGK +AIKQM L  QPKK+LI+NEI VM+A+RHPN+VNYLDS+LV        ELWVVMEYLDGGSLT+VVTE FM E  IA VCRE LQAL+FLH+ +VIHRDIKSDNILLGLDG VKLTDFGFCAQL+N+ TKR+TMVGTPYWMAPEVVT+KQYGPKVDVWSLGIMALEM+DGEPPYLNENP++ALYLIATNGKP++KE   +S  F DFLD CLEV VEKR SAS+LL HPFI +K++ ++ L  LI VA+EQ
Sbjct:  330 EEEICEKLRKIVSLGDPNRKYKKHEKIGQGASGVVYNGIETSTGKKVAIKQMQLKQQPKKELIINEICVMKANRHPNVVNYLDSYLVGGTGTVADELWVVMEYLDGGSLTEVVTETFMDEGHIAAVCRECLQALDFLHTNNVIHRDIKSDNILLGLDGSVKLTDFGFCAQLNNEQTKRSTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMALEMIDGEPPYLNENPLRALYLIATNGKPEIKEKSRLSVVFLDFLDKCLEVQVEKRISASELLTHPFIVRKAKPLSSLTPLIVVAKEQ 627          

HSP 2 Score: 62.7734 bits (151), Expect = 1.158e-9
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  300 IQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            I  ISAP  V H++H+ F   TG+  G+P  W  +L  +NISK++Q++NP  ++  L    D  K+K+K+M
Sbjct:   68 IPNISAPISVMHKVHITFSQDTGEFAGVPLEWQVIL-ENNISKIEQQQNPRAVLNALNILVDKNKNKEKYM 137          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000021793.1 (SMESG000021793.1)

HSP 1 Score: 429.869 bits (1104), Expect = 5.801e-139
Identity = 198/297 (66.67%), Postives = 248/297 (83.50%), Query Frame = 3
Query: 1122 KVSDKEVIDRLKLVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPKKDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVVTEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLTDFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALEMLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDVEKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQ 2012
            ++SD+++ ++++ +VS GDP+ KY L E++GQGASG+V S    STGK +AIKQM L SQPKK+L++NEI VM+A+ HPNIVNYLDS+L+  + ELWVVMEYLDGGSLT+VVTE +M+E  IA V RE LQAL+FLH + VIHRDIKSDNILLG+DG VKL DFGFCAQLS++  KR+TMVGTPYWMAPEVV KKQYGPKVD+WSLGIMA+EM+DGEPPYLNENP++ALYLIATNGKP++KE   +S+ F  FLD  L VDVE R SA+DLL HPFI++ ++ ++ L+ LI VA+EQ
Sbjct:  301 RMSDEQISEKIRAIVSLGDPIRKYELKERIGQGASGIVNSGIEISTGKKVAIKQMNLKSQPKKELLINEIYVMKANHHPNIVNYLDSYLLPHD-ELWVVMEYLDGGSLTEVVTETYMEEGHIAAVSRECLQALKFLHERKVIHRDIKSDNILLGIDGSVKLIDFGFCAQLSSEQMKRSTMVGTPYWMAPEVVAKKQYGPKVDIWSLGIMAIEMIDGEPPYLNENPLRALYLIATNGKPEIKERDKLSSLFISFLDNSLSVDVEMRSSAADLLVHPFIKQCAKPLSSLIPLIVVAKEQ 596          

HSP 2 Score: 73.9442 bits (180), Expect = 3.472e-13
Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  276 RLRKSPDPIQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNMLTASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFM 512
            +L+KS + +  ISAP  V+H+LH+ F ++TG+  G+P  W  ML   NISKV+Q++NP  ++  L  F D   +K KFM
Sbjct:   59 KLQKSKNTLPNISAPISVTHKLHITFCSETGEFTGMPPEWMRML-EDNISKVEQQQNPNAVVSALNFFADKNHTKDKFM 136          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK13.170e-13865.68p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK33.874e-13765.02p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK33.874e-13765.02p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK34.622e-13765.02p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK35.717e-13765.02p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak-11.570e-13467.23Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-12.830e-13467.23Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-13.074e-13467.23Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
max-21.002e-10953.20Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.831e-10853.20Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak2.832e-14268.08gene:FBgn0267698 transcript:FBtr0334539[more]
Pak2.832e-14268.08gene:FBgn0267698 transcript:FBtr0081714[more]
Pak2.832e-14268.08gene:FBgn0267698 transcript:FBtr0081716[more]
Pak2.832e-14268.08gene:FBgn0267698 transcript:FBtr0081715[more]
Pak2.832e-14268.08gene:FBgn0267698 transcript:FBtr0334544[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak12.128e-13764.94p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak12.128e-13764.94p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak18.783e-13563.29p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak18.783e-13563.29p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak18.783e-13563.29p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox23.652e-14068.86quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox25.932e-13968.86quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
flii2.382e-13765.02FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
flii5.820e-13765.02FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
flii1.340e-13665.02FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak12.931e-13865.68p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak12.931e-13865.68p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak32.884e-13765.02p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak32.884e-13765.02p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak32.884e-13765.02p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88643|PAK1_MOUSE2.267e-13865.68Serine/threonine-protein kinase PAK 1 OS=Mus muscu... [more]
sp|Q13153|PAK1_HUMAN1.522e-13765.68Serine/threonine-protein kinase PAK 1 OS=Homo sapi... [more]
sp|P35465|PAK1_RAT1.805e-13765.68Serine/threonine-protein kinase PAK 1 OS=Rattus no... [more]
sp|Q08E52|PAK1_BOVIN2.675e-13765.68Serine/threonine-protein kinase PAK 1 OS=Bos tauru... [more]
sp|Q62829|PAK3_RAT1.304e-13665.02Serine/threonine-protein kinase PAK 3 OS=Rattus no... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K8U8R74.862e-14569.51Serine/threonine-protein kinase PAK 3 (Fragment) O... [more]
A0A034WHQ76.279e-14569.51Serine/threonine-protein kinase PAK 3 OS=Bactrocer... [more]
A0A0K8WG046.346e-14569.51Serine/threonine-protein kinase PAK 1 OS=Bactrocer... [more]
A0A034WE816.515e-14569.51Serine/threonine-protein kinase PAK 3 (Fragment) O... [more]
A0A034WJA56.873e-14569.51Serine/threonine-protein kinase PAK 3 (Fragment) O... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2b6.241e-13362.75p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
pak2a1.441e-13062.25p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak15.463e-12963.07p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak15.541e-12264.66p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
PAK32.428e-11269.33p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak42.429e-9348.50p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
stk25a2.954e-6441.22serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K35.061e-5539.78mitogen-activated protein kinase kinase kinase kin... [more]
slka2.523e-5340.23STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
myo3a3.434e-5037.71myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4][more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE206.821e-11660.14Cdc42p-activated signal transducing kinase; involv... [more]
CLA42.897e-9850.96Cdc42p-activated signal transducing kinase; member... [more]
SKM12.609e-9449.37Member of the PAK family of serine/threonine prote... [more]
KIC14.940e-5141.04Protein kinase of the PAK/Ste20 family, required f... [more]
SPS19.515e-4535.14Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO336672.514e-13867.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458463.710e-8952.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428451.142e-6339.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319347.405e-5838.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490471.927e-5739.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak19.904e-13765.47p21 (RAC1) activated kinase 1 [Source:NCBI gene;Ac... [more]
ENSORLT00000015480.28.664e-13563.40serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000028689.19.118e-13563.40serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000043480.19.118e-13563.40serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000030173.19.118e-13563.40serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036933.10.000e+099.84SMESG000036933.1[more]
SMESG000008326.17.429e-14770.81SMESG000008326.1[more]
SMESG000008326.17.677e-14770.81SMESG000008326.1[more]
SMESG000008326.19.136e-14770.81SMESG000008326.1[more]
SMESG000021793.15.801e-13966.67SMESG000021793.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001988 ID=SMED30001988|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2965bp
GGTTTTTAAATATAACTGATGATTAATAAACATTTTATCATTTTTAAATT
TAAATTTTGAATTATTTATTGAATTTGATTTATTATCTTAATGAATTATA
GCTTATTATGAAAATGTTTCTTAATAAGAATACTGAGCTTGCTCCAACGC
CCCCAACTCGATCGTCAAGCACACTTAAAAAGAAAGAAAAGGTTACTACT
GATGCCCCTGCAAAGCCTCTCCCATTACCTCCCAAATCAGAAAAAGAAAA
GAAAAAAAAGAAAATTAAAATATTTCGTTTACGTAAATCTCCCGATCCAA
TTCAAGAGATCTCCGCTCCTACATGTGTAAGTCATGAATTGCATGTAGAA
TTCGATGCTCAGACAGGCCAAATCAATGGCCTTCCTCAAGCTTGGAGTAA
CATGCTTACGGCTTCAAATATTAGTAAAGTCGATCAAGAAAAGAACCCTG
AAGTGATTATGGAAGTATTACAATGTTTTAATGACGCTGCCAAGTCTAAG
CAGAAATTTATGACTCACATGTCTCAAGCAACCAGTTCCAGTGGATCTAC
AGAGTCAGTTCCAACTCCTCGATCACAATCACAACACAACCAAGAATCAG
AAGACAGTTTATTTAGCTTGGAATATGAAGCCAGGTCGCTAAATGGTTCC
CAAGATGCCATTGGCAATGGGTCCGATCATTGGAGAATCAGCGACCAGTC
TACCAATCATTCATCAATAGCTGATTCCAGTGGTTACGGAAATCAACTAG
AAAACGACGAATCGTCATCGGGATTCATAGAATCATCACTAGCAAGCGGA
TCTTCTCTTCATGATGAAGTTGCCGAAGATACTCCAATAAACGGATCTCC
TTATAGCACAAATGAACGTCCACCTAGAGATGAATCTAATAAACTGGGTT
CTTCCCCACTGACAGGAAACTATAGCAATAAACCAAACAAAATACCTGCA
TCAGCAGATAACGATACCGACGAAGGAGTAGCCCTAGACACTCCTCCACA
ATCTGGCATAAGTCATTCCTCGTCTGGCACTCAACAACAGCAAAAATCTC
CAACAACTCCTAAAGCAACTTCCCCAACTGAAAAGTCCAATAGTGCTCCT
CGTACTCGCTCGAAACCCGTCAAGGTTTCTGATAAAGAAGTGATTGATAG
ATTGAAATTGGTCGTGTCTGCTGGTGATCCGTTGGAAAAATACGTTCTCG
ATGAAAAAGTAGGCCAAGGAGCATCGGGTGTGGTATATAGTAGTACAAAT
AAATCCACCGGGAAACCTCTGGCTATCAAGCAAATGACATTAGCAAGTCA
ACCGAAAAAAGATTTGATTGTGAATGAAATTCTCGTAATGCGAGCTCATC
GTCATCCAAACATTGTTAATTACCTGGACAGTTTTCTAGTCGATGATAAC
AAGGAATTATGGGTCGTCATGGAATATTTAGACGGCGGTTCTCTCACTGA
TGTCGTTACGGAAGCATTCATGCAAGAAAATCAGATTGCAACTGTCTGTC
GGGAAACTTTACAGGCTTTGGAATTCTTGCATTCAAAACATGTGATACAT
CGTGACATCAAATCTGATAATATACTCCTTGGTCTCGATGGACAAGTTAA
ATTGACCGATTTCGGGTTCTGTGCCCAATTGAGCAATGATCTGACTAAGC
GAACAACAATGGTTGGCACTCCGTATTGGATGGCCCCAGAAGTTGTTACA
AAGAAGCAATATGGGCCGAAAGTCGATGTTTGGTCTTTGGGTATCATGGC
ACTAGAAATGCTTGACGGTGAACCACCATATCTCAATGAAAATCCTATCA
AAGCTCTCTATTTAATTGCTACAAATGGAAAACCTGATGTCAAAGAAGCT
CAGAATATGTCAACCGAATTCAAGGACTTTCTCGATTGCTGCTTAGAGGT
CGATGTAGAAAAACGGTGGTCAGCGAGTGATTTGTTAAATCATCCATTCA
TTCAAAAGAAATCGGAATCAGTGAACTGTTTAGTTGAATTGATCAAAGTC
GCAAGAGAACAACAACAATTATCAAAATGATGTCTTCATTAACTTTTGAG
TTTCAAAATTTGCAATCGAATCAATGTGAAGTATTCCGGTTTTGTAAACG
GTTTTTAGTATATAGTTGACAATTGAAATACACTTTGTCTCCTGATTTAT
GTATTTAACTTGGTATTTTTACATTTTATCGCAGTATCTGTCGATGATTT
TTTGTAGATTATACTTTTGCTTTTTCACGAAATTCTCTCGAGTTCTGTCA
ATATTTTGATGTTGACCAGTCATTTTTTTGTTGTTTTTTTCTTGTAAATA
ATGATGATGATAAAAATTTGTCGATTTTATTTCATTCTATTAATAGCAAT
ATTTTCATTTGCTATATATTAAAAATGAAGGAGGAGAAGTCGGGGAAAGA
AAAAGGAAATTAATTGATTTTTTGACATATTTATGGCAAATACGCATTTC
GGTGTTTATCTTATATAAAAGTAATCTTACTATTATTGATTTAATTTGGT
TTATTGTTGGTAATAATAAGTTTTCTAAGTCTCCAAATGGCTTTCTGAGT
TTGGTAAGTTGCCTTGACAAATATTGCTAGTTGAAAGTGTAATTTATTGA
GTTGTGTTAATCAATATTTTGTATCGATTTAGTATCATTTTTACTGATTT
TTTTTTACCTCAATCCTTATGCATGAGTTTTTCACCGAATTTATATTTAC
TAGTTTGACTGCGTGATCATATTGGCTTGGGTGGTATTGGATGAGTATCT
GTGTGTGTGTGTGTACCGTGTGTGCTTGGCTGTATGTGTGTGCGCGCAAT
ATTATGGGTAATTATTTGATCAGTTGTAAATATGTGAATCTTTAAAGTTA
TTTTTAAAATAACGCTAAAGATATTTTCAGTAATTATAACTAAATTATTT
ATTTGGGACGTTTTTATTAAGTCTGATGGCAGTAATTTTTTACTCTCAAA
TAAATCAATATTTTA
back to top

protein sequence of SMED30001988-orf-1

>SMED30001988-orf-1 ID=SMED30001988-orf-1|Name=SMED30001988-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=641bp
MKMFLNKNTELAPTPPTRSSSTLKKKEKVTTDAPAKPLPLPPKSEKEKKK
KKIKIFRLRKSPDPIQEISAPTCVSHELHVEFDAQTGQINGLPQAWSNML
TASNISKVDQEKNPEVIMEVLQCFNDAAKSKQKFMTHMSQATSSSGSTES
VPTPRSQSQHNQESEDSLFSLEYEARSLNGSQDAIGNGSDHWRISDQSTN
HSSIADSSGYGNQLENDESSSGFIESSLASGSSLHDEVAEDTPINGSPYS
TNERPPRDESNKLGSSPLTGNYSNKPNKIPASADNDTDEGVALDTPPQSG
ISHSSSGTQQQQKSPTTPKATSPTEKSNSAPRTRSKPVKVSDKEVIDRLK
LVVSAGDPLEKYVLDEKVGQGASGVVYSSTNKSTGKPLAIKQMTLASQPK
KDLIVNEILVMRAHRHPNIVNYLDSFLVDDNKELWVVMEYLDGGSLTDVV
TEAFMQENQIATVCRETLQALEFLHSKHVIHRDIKSDNILLGLDGQVKLT
DFGFCAQLSNDLTKRTTMVGTPYWMAPEVVTKKQYGPKVDVWSLGIMALE
MLDGEPPYLNENPIKALYLIATNGKPDVKEAQNMSTEFKDFLDCCLEVDV
EKRWSASDLLNHPFIQKKSESVNCLVELIKVAREQQQLSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036936CRIB_dom_sf
IPR000095CRIB_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000095CRIB domainSMARTSM00285PBD_5coord: 68..103
e-value: 0.0011
score: 28.3
IPR000095CRIB domainPFAMPF00786PBDcoord: 67..123
e-value: 1.9E-14
score: 53.7
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 362..615
e-value: 6.3E-100
score: 348.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 362..615
e-value: 6.5E-74
score: 248.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 362..615
score: 51.538
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 305..440
e-value: 1.2E-40
score: 141.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 441..639
e-value: 1.4E-74
score: 251.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 295..341
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 198..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 198..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 262..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 134..167
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..51
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 297..335
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 19..637
NoneNo IPR availablePANTHERPTHR45832:SF7coord: 19..637
IPR036936CRIB domain superfamilyGENE3DG3DSA:3.90.810.10coord: 65..141
e-value: 2.0E-23
score: 84.4
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 368..391
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 479..491
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 353..618